1YJ9Z

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yj9Z00
1Q812 2QEXZ 3I56Z 1VQL1 3CCM1 1VQ9Z 3CC2Z 1NJI1 1VQM1 1YHQ1 1YJNZ 3CCL1 1VQNZ 1JJ2Y 2OTJ1 1N8R2 1VQ6Z 3CCR1 1Q821 1VQ7Z 1KD11 3G6E1 3CC71 1W2BZ 1K732 1YJ91 1YIJ1 1QVGZ 3CPWY 1KQSY 1YIT1 3CC41 1M901 1YJW1 3I551 3CD61 1K9M1 3CCE1 1VQ4Z 2QA41 1YI21 3CXCZ 3CME1 3G4SZ 1QVGY 3CCJ1 3CCMZ 1VQP1 3CCS1 1S721 3OW2Y 3CCV1 1VQO1 1M1K1 3CMAZ 3CCRZ 3G6EZ 3CC7Z 1Q7Y1 3CCQZ 1NJI2 1VQK1 3CXCY 1VQ5Z 1YITZ 3G71Z 1VQ91 3CC21 1Q822 3CD6Z 1KD12 1VQ81 1Q862 1W2BY 3CCU1 1KC82 1VQ61 2QA4Z 2OTL1 1M902 1VQ71 1VQLZ 1K8A1 3CCJZ 1VQMZ 1YHQZ 1K9M2 3CCLZ 1VQPZ 1Q811 3CCSZ 1S72Z 2OTJZ 1VQOZ 1YJ9Z 1YIJZ 1VQ41 1N8R1 2QEX1 3CC4Z 3I561 1KQSZ 3G4S1 1YJWZ 1K731 1M1K2 1YJN1 1QVFZ 3I55Z 1VQN1 3CCEZ 1Q7Y2 1VQ8Z 1YI2Z 3CMA1 3CCUZ 3CMEZ 2OTLZ 3CCQ1 1Q861 1VQ51 1KC81 3CCVZ 1QVFY 3G711 3OW2Z 1JJ2Z 1K8A2 1VQKZ 3CPWZ
chains in the Genus database with same CATH superfamily
4MD7A 3TDHB 2QEXZ 1N2FA 1VQL1 1NJI1 4HGYA 3M3YI 5FLXf 5FLXb 4QTTA 2HU9A 2NVQI 2NAPA 1KD11 3G6E1 3CC71 3S2HI 4NFRA 2Q4ZA 2VPXA 3GCFA 1YIT1 1LQLA 3CC41 1QXFA 3NDJA 1K9M1 3CCE1 3H3VJ 3S17I 2W03A 1S721 1WW9A 3OW2Y 4NBHA 1VQO1 5C3EI 4A3BI 2GTHA 2JMOA 3CCRZ 1NJI2 2P3YA 4MRIA 2R6MA 3S1NI 2JIMA 3CC21 4AYBA 1KD12 4E2XA 3GTKI 1RO0A 3CCU1 3J81f 1KC82 3S15I 4RV9A 1YHQZ 1K9M2 3CCLZ 1USPB 4HGZA 1VQPZ 3GTJI 5IP9I 3VTNA 4RS4A 3H0GI 5D1OB 4Y52I 3KIHA 4MXUA 2R92I 1Z01A 2F4OA 3NDIA 4A3LI 4BY7I 2HF1A 1QVFZ 1Y8CA 5IP7I 2O53A 2OOXB 4MD8A 3MONA 1SIWA 3EERA 4RVFA 3CMA1 2OTLZ 2OZKA 1X3WA 3CCQ1 3Q87A 1Q861 3GKQA 1SFOI 2OOYB 1QVFY 2KPIA 4E2WA 1X3ZA 3PO2I 3VB9A 2PK7A 2P28A 1VQKZ 4E2YA 3QWUA 3CCM1 1VQ9Z 1FDOA 3GTOI 1YJNZ 1JWHC 2OTJ1 1Z02A 1VQ6Z 1RQFA 1VQ7Z 4E31A 1W2BZ 1YJ91 1YIJ1 5CM2M 1KQSY 4NB9A 3FQQA 2E2II 4Y7NI 2DE7A 2H85A 1ML8A 5FLMI 3I551 4BBRI 3F3FC 3GTGI 4RVDA 2NVTI 1RLYA 3CME1 3CCJ1 3K7AI 3LUSA 3CCS1 2LFUA 4BY1I 1YUKA 2NVXI 4TNUA 3G6EZ 3CC7Z 3RZOI 1Q7Y1 3D9XA 1YITZ 3P5JB 1X0TA 2VUMI 2V45A 1TWCI 3HOXI 3U50C 4BBSI 3S1RI 1K8A1 3FKII 1VQMZ 1ZB9A 1Q811 1S72Z 2DE6A 1VQOZ 3F3PC 2NVYI 3HOWI 2V3VA 3VMIA 1TWFI 3I561 1S7MA 2F4MA 2QLVB 1YJWZ 1Q16A 1K731 3ESWA 2JUBA 3CQZI 1VQN1 4MD9A 2QREB 2G2KA 3HOVI 1Q7Y2 3J81b 1YI2Z 3CCUZ 1DL6A 5T6BA 4XX2A 5D1PA 3NH8A 4A3JI 4A3II 2JR6A 2JIOA 2VPYA 1KRLA 1YUAA 3D6WA 3GTPI 1USPA 2K5RA 3CCVZ 1RO4A 3S1MI 3VMGA 4A3KI 4A3DI 1JJ2Z 2VF1A 1K8A2 4NH1C 2VPWA 5C44I 1Q812 4NOZA 3GTLI 2LEXA 1YHQ1 3NH4A 3CCL1 1WIIA 1JJ2Y 2JS4A 1K732 1I6HI 4A93I 2IZ4A 2JA7I 2PMZA 4MH4A 2E9HA 3CD61 1NUIA 3PO3I 2V8IA 1VQ4Z 2QA41 4E2ZA 3CXCZ 3IF8A 3NH5A 4NBDA 3G4SZ 1P9NA 1PFTA 3CCMZ 4NBGA 2Q51A 2ZAEB 1M1K1 1R9TI 3IR7A 2O4HA 1VQK1 3CXCY 1VQ5Z 1VLAA 3G71Z 1VQ91 3M4OI 2GU2A 3KIFA 1VQ81 4RVHA 5A2Qf 1Q862 1W2BY 3BG1B 5A2Qb 1VQ61 3VMHA 1RNIA 1VQ71 3S16I 1VQLZ 4A3EI 5IT9f 3CCJZ 3S14I 2JIRA 1TWHI 3CCSZ 2JA5I 2QR1B 2R93I 1WJ2A 3D2LA 1ZH1A 3T4NB 2E2HI 4NBAA 1N8R1 2WB1A 4X6AI 2QEX1 2JIPA 2R7ZI 3CC4Z 3HOZI 3MZLB 1M1K2 4S1TA 1TWAI 3I07A 2RPRA 2YU9I 2B63I 4BXXI 1K83I 3CCEZ 2W04A 4QTUA 3GTMI 2I3CA 2VPZA 2IZ3A 2K3RA 1ZB8A 4MONA 1KC81 3IX0A 4NBEA 2VUGA 5LL6f 3OW2Z 5C4JI 3TE5B 1Y1WI 5T64A 3S1QI 3CPWZ 2GTIA 3PO3S 2KI7B 3I56Z 1Y1VS 3CC2Z 1VQM1 1I50I 1VQNZ 2RT9A 4NB8A 1WCMI 1N8R2 3CCR1 1Q821 5C4XI 3CPWY 1QVGZ 2RHBA 2M6NA 2J6AA 3EEDA 1M901 3HOUI 1YJW1 4A3FI 5D1OA 2PM9A 1RO2A 2JA6I 1YI21 4EWCA 1QVGY 4RVGA 2Y0SA 1VQP1 3FQMA 1TFIA 2AYDA 3IFUA 3CCV1 4A3GI 3BG0B 3CMAZ 1QF8A 2JNYA 4CL1A 3I4NI 4E33A 3CCQZ 3GTQI 2V8KA 3MZKB 3J80f 3J80b 3J7A4 3S2DI 2QRDB 2YADA 1Q822 2DE5A 3CD6Z 3NFZA 1Y1VI 1QYPA 4NBFA 2QA4Z 2OTL1 4E30A 1M902 2E2JI 3JAMf 2JA8I 1L1OC 1AA6A 3JAMb 4A3CI 3GTMS 2LIYA 4DGLA 1FDIA 2OTJZ 3RZDI 2IV2X 1I3QI 1YJ9Z 1YIJZ 4NBCA 1VQ41 1KQSZ 5T67A 3G4S1 4HH4A 3HKZA 1YJN1 2V8JA 3I55Z 4NBBA 4DQYB 1VQ8Z 3CMEZ 2EGTA 2E7ZA 2BJOA 1WZNA 2RBLA 5IT9b 5AN9F 2WAQA 4DK1A 1VQ51 3G711 1TWGI 2AKLA 1Z03A 4A3MI 3I4MI 3HOYI 2QKDA 2QRCB 2M48A 2RIQA 4E32A 2JIQA 1NP6A
chains in the Genus database with same CATH topology
4MD7A 3TDHB 2QEXZ 1N2FA 1VQL1 1NJI1 4HGYA 3M3YI 5FLXf 5FLXb 4QTTA 2HU9A 2NVQI 1KD11 3G6E1 3CC71 3S2HI 4NFRA 2Q4ZA 3GCFA 1YIT1 1LQLA 3CC41 3NDJA 1K9M1 3CCE1 3H3VJ 3S17I 2W03A 1S721 1WW9A 3OW2Y 4NBHA 1VQO1 5C3EI 4A3BI 2GTHA 2JMOA 3CCRZ 1NJI2 2P3YA 4MRIA 2R6MA 3S1NI 3CC21 4AYBA 1KD12 4E2XA 3GTKI 1RO0A 3CCU1 3J81f 1KC82 3S15I 4RV9A 1YHQZ 1K9M2 3CCLZ 1USPB 4HGZA 1VQPZ 3GTJI 5IP9I 3VTNA 4RS4A 3H0GI 5D1OB 4Y52I 3KIHA 4MXUA 2R92I 1Z01A 2F4OA 3NDIA 4A3LI 4BY7I 2HF1A 1QVFZ 5IP7I 2O53A 2OOXB 4MD8A 3MONA 3EERA 4RVFA 3CMA1 2OTLZ 2OZKA 1X3WA 3CCQ1 3Q87A 1Q861 3GKQA 1SFOI 2OOYB 1QVFY 2KPIA 4E2WA 1X3ZA 3PO2I 3VB9A 2PK7A 2P28A 1VQKZ 4E2YA 3QWUA 3CCM1 1VQ9Z 3GTOI 1YJNZ 1JWHC 2OTJ1 1Z02A 1VQ6Z 1RQFA 1VQ7Z 4E31A 1W2BZ 1YJ91 1YIJ1 5CM2M 1KQSY 4NB9A 3FQQA 2E2II 4Y7NI 2DE7A 2H85A 1ML8A 5FLMI 3I551 4BBRI 3F3FC 3GTGI 4RVDA 2NVTI 1RLYA 3CME1 3CCJ1 3K7AI 3LUSA 3CCS1 2LFUA 4BY1I 1YUKA 2NVXI 4TNUA 3G6EZ 3CC7Z 3RZOI 1Q7Y1 3D9XA 1YITZ 3P5JB 1X0TA 2VUMI 1TWCI 3HOXI 3U50C 4BBSI 3S1RI 1K8A1 3FKII 1VQMZ 1ZB9A 1Q811 1S72Z 2DE6A 1VQOZ 3F3PC 2NVYI 3HOWI 3VMIA 1TWFI 3I561 1S7MA 2F4MA 2QLVB 1YJWZ 1K731 3ESWA 2JUBA 3CQZI 1VQN1 4MD9A 2QREB 2G2KA 3HOVI 1Q7Y2 3J81b 1YI2Z 3CCUZ 1DL6A 5T6BA 4XX2A 5D1PA 3NH8A 4A3JI 4A3II 2JR6A 1KRLA 1YUAA 3D6WA 3GTPI 1USPA 2K5RA 3CCVZ 1RO4A 3S1MI 3VMGA 4A3KI 4A3DI 1JJ2Z 2VF1A 1K8A2 4NH1C 5C44I 1Q812 4NOZA 3GTLI 1YHQ1 3NH4A 3CCL1 1WIIA 1JJ2Y 2JS4A 1K732 1I6HI 4A93I 2IZ4A 2JA7I 2PMZA 4MH4A 2E9HA 3CD61 1NUIA 3PO3I 2V8IA 1VQ4Z 2QA41 4E2ZA 3CXCZ 3IF8A 3NH5A 4NBDA 3G4SZ 1P9NA 1PFTA 3CCMZ 4NBGA 2Q51A 2ZAEB 1M1K1 1R9TI 2O4HA 1VQK1 3CXCY 1VQ5Z 1VLAA 3G71Z 1VQ91 3M4OI 2GU2A 3KIFA 1VQ81 4RVHA 5A2Qf 1Q862 1W2BY 3BG1B 5A2Qb 1VQ61 3VMHA 1RNIA 1VQ71 3S16I 1VQLZ 4A3EI 5IT9f 3CCJZ 3S14I 1TWHI 3CCSZ 2JA5I 2QR1B 2R93I 1ZH1A 3T4NB 2E2HI 4NBAA 1N8R1 2WB1A 4X6AI 2QEX1 2R7ZI 3CC4Z 3HOZI 3MZLB 1M1K2 4S1TA 1TWAI 3I07A 2RPRA 2YU9I 2B63I 4BXXI 1K83I 3CCEZ 2W04A 4QTUA 3GTMI 2I3CA 2IZ3A 2K3RA 1ZB8A 4MONA 1KC81 3IX0A 4NBEA 2VUGA 5LL6f 3OW2Z 5C4JI 3TE5B 1Y1WI 5T64A 3S1QI 3CPWZ 2GTIA 3PO3S 2KI7B 3I56Z 1Y1VS 3CC2Z 1VQM1 1I50I 1VQNZ 2RT9A 4NB8A 1WCMI 1N8R2 3CCR1 1Q821 5C4XI 3CPWY 1QVGZ 2RHBA 2M6NA 2J6AA 3EEDA 1M901 3HOUI 1YJW1 4A3FI 5D1OA 2PM9A 1RO2A 2JA6I 1YI21 4EWCA 1QVGY 4RVGA 2Y0SA 1VQP1 3FQMA 1TFIA 3IFUA 3CCV1 4A3GI 3BG0B 3CMAZ 1QF8A 2JNYA 4CL1A 3I4NI 4E33A 3CCQZ 3GTQI 2V8KA 3MZKB 3J80f 3J80b 3J7A4 3S2DI 2QRDB 2YADA 1Q822 2DE5A 3CD6Z 3NFZA 1Y1VI 1QYPA 4NBFA 2QA4Z 2OTL1 4E30A 1M902 2E2JI 3JAMf 2JA8I 1L1OC 3JAMb 4A3CI 3GTMS 2LIYA 4DGLA 2OTJZ 3RZDI 1I3QI 1YJ9Z 1YIJZ 4NBCA 1VQ41 1KQSZ 5T67A 3G4S1 4HH4A 3HKZA 1YJN1 2V8JA 3I55Z 4NBBA 4DQYB 1VQ8Z 3CMEZ 2EGTA 2BJOA 2RBLA 5IT9b 5AN9F 2WAQA 4DK1A 1VQ51 3G711 1TWGI 2AKLA 1Z03A 4A3MI 3I4MI 3HOYI 2QKDA 2QRCB 2M48A 2RIQA 4E32A 1NP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 2;  2QEX Z;  3I56 Z;  1VQL 1;  3CCM 1;  1VQ9 Z;  3CC2 Z;  1NJI 1;  1VQM 1;  1YHQ 1;  1YJN Z;  3CCL 1;  1VQN Z;  1JJ2 Y;  2OTJ 1;  1N8R 2;  1VQ6 Z;  3CCR 1;  1Q82 1;  1VQ7 Z;  1KD1 1;  3G6E 1;  3CC7 1;  1W2B Z;  1K73 2;  1YJ9 1;  1YIJ 1;  1QVG Z;  3CPW Y;  1KQS Y;  1YIT 1;  3CC4 1;  1M90 1;  1YJW 1;  3I55 1;  3CD6 1;  1K9M 1;  3CCE 1;  1VQ4 Z;  2QA4 1;  1YI2 1;  3CXC Z;  3CME 1;  3G4S Z;  1QVG Y;  3CCJ 1;  3CCM Z;  1VQP 1;  3CCS 1;  1S72 1;  3OW2 Y;  3CCV 1;  1VQO 1;  1M1K 1;  3CMA Z;  3CCR Z;  3G6E Z;  3CC7 Z;  1Q7Y 1;  3CCQ Z;  1NJI 2;  1VQK 1;  3CXC Y;  1VQ5 Z;  1YIT Z;  3G71 Z;  1VQ9 1;  3CC2 1;  1Q82 2;  3CD6 Z;  1KD1 2;  1VQ8 1;  1Q86 2;  1W2B Y;  3CCU 1;  1KC8 2;  1VQ6 1;  2QA4 Z;  2OTL 1;  1M90 2;  1VQ7 1;  1VQL Z;  1K8A 1;  3CCJ Z;  1VQM Z;  1YHQ Z;  1K9M 2;  3CCL Z;  1VQP Z;  1Q81 1;  3CCS Z;  1S72 Z;  2OTJ Z;  1VQO Z;  1YJ9 Z;  1YIJ Z;  1VQ4 1;  1N8R 1;  2QEX 1;  3CC4 Z;  3I56 1;  1KQS Z;  3G4S 1;  1YJW Z;  1K73 1;  1M1K 2;  1YJN 1;  1QVF Z;  3I55 Z;  1VQN 1;  3CCE Z;  1Q7Y 2;  1VQ8 Z;  1YI2 Z;  3CMA 1;  3CCU Z;  3CME Z;  2OTL Z;  3CCQ 1;  1Q86 1;  1VQ5 1;  1KC8 1;  3CCV Z;  1QVF Y;  3G71 1;  3OW2 Z;  1JJ2 Z;  1K8A 2;  1VQK Z;  3CPW Z; 
#chains in the Genus database with same CATH topology
 4MD7 A;  3TDH B;  2QEX Z;  1N2F A;  1VQL 1;  1NJI 1;  4HGY A;  3M3Y I;  5FLX f;  5FLX b;  4QTT A;  2HU9 A;  2NVQ I;  2NAP A;  1KD1 1;  3G6E 1;  3CC7 1;  3S2H I;  4NFR A;  2Q4Z A;  2VPX A;  3GCF A;  1YIT 1;  1LQL A;  3CC4 1;  1QXF A;  3NDJ A;  1K9M 1;  3CCE 1;  3H3V J;  3S17 I;  2W03 A;  1S72 1;  1WW9 A;  3OW2 Y;  4NBH A;  1VQO 1;  5C3E I;  4A3B I;  2GTH A;  2JMO A;  3CCR Z;  1NJI 2;  2P3Y A;  4MRI A;  2R6M A;  3S1N I;  2JIM A;  3CC2 1;  4AYB A;  1KD1 2;  4E2X A;  3GTK I;  1RO0 A;  3CCU 1;  3J81 f;  1KC8 2;  3S15 I;  4RV9 A;  1YHQ Z;  1K9M 2;  3CCL Z;  1USP B;  4HGZ A;  1VQP Z;  3GTJ I;  5IP9 I;  3VTN A;  4RS4 A;  3H0G I;  5D1O B;  4Y52 I;  3KIH A;  4MXU A;  2R92 I;  1Z01 A;  2F4O A;  3NDI A;  4A3L I;  4BY7 I;  2HF1 A;  1QVF Z;  1Y8C A;  5IP7 I;  2O53 A;  2OOX B;  4MD8 A;  3MON A;  1SIW A;  3EER A;  4RVF A;  3CMA 1;  2OTL Z;  2OZK A;  1X3W A;  3CCQ 1;  3Q87 A;  1Q86 1;  3GKQ A;  1SFO I;  2OOY B;  1QVF Y;  2KPI A;  4E2W A;  1X3Z A;  3PO2 I;  3VB9 A;  2PK7 A;  2P28 A;  1VQK Z;  4E2Y A;  3QWU A;  3CCM 1;  1VQ9 Z;  1FDO A;  3GTO I;  1YJN Z;  1JWH C;  2OTJ 1;  1Z02 A;  1VQ6 Z;  1RQF A;  1VQ7 Z;  4E31 A;  1W2B Z;  1YJ9 1;  1YIJ 1;  5CM2 M;  1KQS Y;  4NB9 A;  3FQQ A;  2E2I I;  4Y7N I;  2DE7 A;  2H85 A;  1ML8 A;  5FLM I;  3I55 1;  4BBR I;  3F3F C;  3GTG I;  4RVD A;  2NVT I;  1RLY A;  3CME 1;  3CCJ 1;  3K7A I;  3LUS A;  3CCS 1;  2LFU A;  4BY1 I;  1YUK A;  2NVX I;  4TNU A;  3G6E Z;  3CC7 Z;  3RZO I;  1Q7Y 1;  3D9X A;  1YIT Z;  3P5J B;  1X0T A;  2VUM I;  2V45 A;  1TWC I;  3HOX I;  3U50 C;  4BBS I;  3S1R I;  1K8A 1;  3FKI I;  1VQM Z;  1ZB9 A;  1Q81 1;  1S72 Z;  2DE6 A;  1VQO Z;  3F3P C;  2NVY I;  3HOW I;  2V3V A;  3VMI A;  1TWF I;  3I56 1;  1S7M A;  2F4M A;  2QLV B;  1YJW Z;  1Q16 A;  1K73 1;  3ESW A;  2JUB A;  3CQZ I;  1VQN 1;  4MD9 A;  2QRE B;  2G2K A;  3HOV I;  1Q7Y 2;  3J81 b;  1YI2 Z;  3CCU Z;  1DL6 A;  5T6B A;  4XX2 A;  5D1P A;  3NH8 A;  4A3J I;  4A3I I;  2JR6 A;  2JIO A;  2VPY A;  1KRL A;  1YUA A;  3D6W A;  3GTP I;  1USP A;  2K5R A;  3CCV Z;  1RO4 A;  3S1M I;  3VMG A;  4A3K I;  4A3D I;  1JJ2 Z;  2VF1 A;  1K8A 2;  4NH1 C;  2VPW A;  5C44 I;  1Q81 2;  4NOZ A;  3GTL I;  2LEX A;  1YHQ 1;  3NH4 A;  3CCL 1;  1WII A;  1JJ2 Y;  2JS4 A;  1K73 2;  1I6H I;  4A93 I;  2IZ4 A;  2JA7 I;  2PMZ A;  4MH4 A;  2E9H A;  3CD6 1;  1NUI A;  3PO3 I;  2V8I A;  1VQ4 Z;  2QA4 1;  4E2Z A;  3CXC Z;  3IF8 A;  3NH5 A;  4NBD A;  3G4S Z;  1P9N A;  1PFT A;  3CCM Z;  4NBG A;  2Q51 A;  2ZAE B;  1M1K 1;  1R9T I;  3IR7 A;  2O4H A;  1VQK 1;  3CXC Y;  1VQ5 Z;  1VLA A;  3G71 Z;  1VQ9 1;  3M4O I;  2GU2 A;  3KIF A;  1VQ8 1;  4RVH A;  5A2Q f;  1Q86 2;  1W2B Y;  3BG1 B;  5A2Q b;  1VQ6 1;  3VMH A;  1RNI A;  1VQ7 1;  3S16 I;  1VQL Z;  4A3E I;  5IT9 f;  3CCJ Z;  3S14 I;  2JIR A;  1TWH I;  3CCS Z;  2JA5 I;  2QR1 B;  2R93 I;  1WJ2 A;  3D2L A;  1ZH1 A;  3T4N B;  2E2H I;  4NBA A;  1N8R 1;  2WB1 A;  4X6A I;  2QEX 1;  2JIP A;  2R7Z I;  3CC4 Z;  3HOZ I;  3MZL B;  1M1K 2;  4S1T A;  1TWA I;  3I07 A;  2RPR A;  2YU9 I;  2B63 I;  4BXX I;  1K83 I;  3CCE Z;  2W04 A;  4QTU A;  3GTM I;  2I3C A;  2VPZ A;  2IZ3 A;  2K3R A;  1ZB8 A;  4MON A;  1KC8 1;  3IX0 A;  4NBE A;  2VUG A;  5LL6 f;  3OW2 Z;  5C4J I;  3TE5 B;  1Y1W I;  5T64 A;  3S1Q I;  3CPW Z;  2GTI A;  3PO3 S;  2KI7 B;  3I56 Z;  1Y1V S;  3CC2 Z;  1VQM 1;  1I50 I;  1VQN Z;  2RT9 A;  4NB8 A;  1WCM I;  1N8R 2;  3CCR 1;  1Q82 1;  5C4X I;  3CPW Y;  1QVG Z;  2RHB A;  2M6N A;  2J6A A;  3EED A;  1M90 1;  3HOU I;  1YJW 1;  4A3F I;  5D1O A;  2PM9 A;  1RO2 A;  2JA6 I;  1YI2 1;  4EWC A;  1QVG Y;  4RVG A;  2Y0S A;  1VQP 1;  3FQM A;  1TFI A;  2AYD A;  3IFU A;  3CCV 1;  4A3G I;  3BG0 B;  3CMA Z;  1QF8 A;  2JNY A;  4CL1 A;  3I4N I;  4E33 A;  3CCQ Z;  3GTQ I;  2V8K A;  3MZK B;  3J80 f;  3J80 b;  3J7A 4;  3S2D I;  2QRD B;  2YAD A;  1Q82 2;  2DE5 A;  3CD6 Z;  3NFZ A;  1Y1V I;  1QYP A;  4NBF A;  2QA4 Z;  2OTL 1;  4E30 A;  1M90 2;  2E2J I;  3JAM f;  2JA8 I;  1L1O C;  1AA6 A;  3JAM b;  4A3C I;  3GTM S;  2LIY A;  4DGL A;  1FDI A;  2OTJ Z;  3RZD I;  2IV2 X;  1I3Q I;  1YJ9 Z;  1YIJ Z;  4NBC A;  1VQ4 1;  1KQS Z;  5T67 A;  3G4S 1;  4HH4 A;  3HKZ A;  1YJN 1;  2V8J A;  3I55 Z;  4NBB A;  4DQY B;  1VQ8 Z;  3CME Z;  2EGT A;  2E7Z A;  2BJO A;  1WZN A;  2RBL A;  5IT9 b;  5AN9 F;  2WAQ A;  4DK1 A;  1VQ5 1;  3G71 1;  1TWG I;  2AKL A;  1Z03 A;  4A3M I;  3I4M I;  3HOY I;  2QKD A;  2QRC B;  2M48 A;  2RIQ A;  4E32 A;  2JIQ A;  1NP6 A; 
#chains in the Genus database with same CATH homology
 4MD7 A;  3TDH B;  2QEX Z;  1N2F A;  1VQL 1;  1NJI 1;  4HGY A;  3M3Y I;  5FLX f;  5FLX b;  4QTT A;  2HU9 A;  2NVQ I;  1KD1 1;  3G6E 1;  3CC7 1;  3S2H I;  4NFR A;  2Q4Z A;  3GCF A;  1YIT 1;  1LQL A;  3CC4 1;  3NDJ A;  1K9M 1;  3CCE 1;  3H3V J;  3S17 I;  2W03 A;  1S72 1;  1WW9 A;  3OW2 Y;  4NBH A;  1VQO 1;  5C3E I;  4A3B I;  2GTH A;  2JMO A;  3CCR Z;  1NJI 2;  2P3Y A;  4MRI A;  2R6M A;  3S1N I;  3CC2 1;  4AYB A;  1KD1 2;  4E2X A;  3GTK I;  1RO0 A;  3CCU 1;  3J81 f;  1KC8 2;  3S15 I;  4RV9 A;  1YHQ Z;  1K9M 2;  3CCL Z;  1USP B;  4HGZ A;  1VQP Z;  3GTJ I;  5IP9 I;  3VTN A;  4RS4 A;  3H0G I;  5D1O B;  4Y52 I;  3KIH A;  4MXU A;  2R92 I;  1Z01 A;  2F4O A;  3NDI A;  4A3L I;  4BY7 I;  2HF1 A;  1QVF Z;  5IP7 I;  2O53 A;  2OOX B;  4MD8 A;  3MON A;  3EER A;  4RVF A;  3CMA 1;  2OTL Z;  2OZK A;  1X3W A;  3CCQ 1;  3Q87 A;  1Q86 1;  3GKQ A;  1SFO I;  2OOY B;  1QVF Y;  2KPI A;  4E2W A;  1X3Z A;  3PO2 I;  3VB9 A;  2PK7 A;  2P28 A;  1VQK Z;  4E2Y A;  3QWU A;  3CCM 1;  1VQ9 Z;  3GTO I;  1YJN Z;  1JWH C;  2OTJ 1;  1Z02 A;  1VQ6 Z;  1RQF A;  1VQ7 Z;  4E31 A;  1W2B Z;  1YJ9 1;  1YIJ 1;  5CM2 M;  1KQS Y;  4NB9 A;  3FQQ A;  2E2I I;  4Y7N I;  2DE7 A;  2H85 A;  1ML8 A;  5FLM I;  3I55 1;  4BBR I;  3F3F C;  3GTG I;  4RVD A;  2NVT I;  1RLY A;  3CME 1;  3CCJ 1;  3K7A I;  3LUS A;  3CCS 1;  2LFU A;  4BY1 I;  1YUK A;  2NVX I;  4TNU A;  3G6E Z;  3CC7 Z;  3RZO I;  1Q7Y 1;  3D9X A;  1YIT Z;  3P5J B;  1X0T A;  2VUM I;  1TWC I;  3HOX I;  3U50 C;  4BBS I;  3S1R I;  1K8A 1;  3FKI I;  1VQM Z;  1ZB9 A;  1Q81 1;  1S72 Z;  2DE6 A;  1VQO Z;  3F3P C;  2NVY I;  3HOW I;  3VMI A;  1TWF I;  3I56 1;  1S7M A;  2F4M A;  2QLV B;  1YJW Z;  1K73 1;  3ESW A;  2JUB A;  3CQZ I;  1VQN 1;  4MD9 A;  2QRE B;  2G2K A;  3HOV I;  1Q7Y 2;  3J81 b;  1YI2 Z;  3CCU Z;  1DL6 A;  5T6B A;  4XX2 A;  5D1P A;  3NH8 A;  4A3J I;  4A3I I;  2JR6 A;  1KRL A;  1YUA A;  3D6W A;  3GTP I;  1USP A;  2K5R A;  3CCV Z;  1RO4 A;  3S1M I;  3VMG A;  4A3K I;  4A3D I;  1JJ2 Z;  2VF1 A;  1K8A 2;  4NH1 C;  5C44 I;  1Q81 2;  4NOZ A;  3GTL I;  1YHQ 1;  3NH4 A;  3CCL 1;  1WII A;  1JJ2 Y;  2JS4 A;  1K73 2;  1I6H I;  4A93 I;  2IZ4 A;  2JA7 I;  2PMZ A;  4MH4 A;  2E9H A;  3CD6 1;  1NUI A;  3PO3 I;  2V8I A;  1VQ4 Z;  2QA4 1;  4E2Z A;  3CXC Z;  3IF8 A;  3NH5 A;  4NBD A;  3G4S Z;  1P9N A;  1PFT A;  3CCM Z;  4NBG A;  2Q51 A;  2ZAE B;  1M1K 1;  1R9T I;  2O4H A;  1VQK 1;  3CXC Y;  1VQ5 Z;  1VLA A;  3G71 Z;  1VQ9 1;  3M4O I;  2GU2 A;  3KIF A;  1VQ8 1;  4RVH A;  5A2Q f;  1Q86 2;  1W2B Y;  3BG1 B;  5A2Q b;  1VQ6 1;  3VMH A;  1RNI A;  1VQ7 1;  3S16 I;  1VQL Z;  4A3E I;  5IT9 f;  3CCJ Z;  3S14 I;  1TWH I;  3CCS Z;  2JA5 I;  2QR1 B;  2R93 I;  1ZH1 A;  3T4N B;  2E2H I;  4NBA A;  1N8R 1;  2WB1 A;  4X6A I;  2QEX 1;  2R7Z I;  3CC4 Z;  3HOZ I;  3MZL B;  1M1K 2;  4S1T A;  1TWA I;  3I07 A;  2RPR A;  2YU9 I;  2B63 I;  4BXX I;  1K83 I;  3CCE Z;  2W04 A;  4QTU A;  3GTM I;  2I3C A;  2IZ3 A;  2K3R A;  1ZB8 A;  4MON A;  1KC8 1;  3IX0 A;  4NBE A;  2VUG A;  5LL6 f;  3OW2 Z;  5C4J I;  3TE5 B;  1Y1W I;  5T64 A;  3S1Q I;  3CPW Z;  2GTI A;  3PO3 S;  2KI7 B;  3I56 Z;  1Y1V S;  3CC2 Z;  1VQM 1;  1I50 I;  1VQN Z;  2RT9 A;  4NB8 A;  1WCM I;  1N8R 2;  3CCR 1;  1Q82 1;  5C4X I;  3CPW Y;  1QVG Z;  2RHB A;  2M6N A;  2J6A A;  3EED A;  1M90 1;  3HOU I;  1YJW 1;  4A3F I;  5D1O A;  2PM9 A;  1RO2 A;  2JA6 I;  1YI2 1;  4EWC A;  1QVG Y;  4RVG A;  2Y0S A;  1VQP 1;  3FQM A;  1TFI A;  3IFU A;  3CCV 1;  4A3G I;  3BG0 B;  3CMA Z;  1QF8 A;  2JNY A;  4CL1 A;  3I4N I;  4E33 A;  3CCQ Z;  3GTQ I;  2V8K A;  3MZK B;  3J80 f;  3J80 b;  3J7A 4;  3S2D I;  2QRD B;  2YAD A;  1Q82 2;  2DE5 A;  3CD6 Z;  3NFZ A;  1Y1V I;  1QYP A;  4NBF A;  2QA4 Z;  2OTL 1;  4E30 A;  1M90 2;  2E2J I;  3JAM f;  2JA8 I;  1L1O C;  3JAM b;  4A3C I;  3GTM S;  2LIY A;  4DGL A;  2OTJ Z;  3RZD I;  1I3Q I;  1YJ9 Z;  1YIJ Z;  4NBC A;  1VQ4 1;  1KQS Z;  5T67 A;  3G4S 1;  4HH4 A;  3HKZ A;  1YJN 1;  2V8J A;  3I55 Z;  4NBB A;  4DQY B;  1VQ8 Z;  3CME Z;  2EGT A;  2BJO A;  2RBL A;  5IT9 b;  5AN9 F;  2WAQ A;  4DK1 A;  1VQ5 1;  3G71 1;  1TWG I;  2AKL A;  1Z03 A;  4A3M I;  3I4M I;  3HOY I;  2QKD A;  2QRC B;  2M48 A;  2RIQ A;  4E32 A;  1NP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...