1YJ9Z

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yj9Z00
3CCE1 1W2BY 1K8A2 3CC2Z 1Q7Y1 3CD6Z 1K9M2 3CCV1 3CCLZ 1JJ2Z 3CPWY 3CCU1 1VQ6Z 3G6E1 1VQ51 1YI21 1VQ81 3CC41 3G4SZ 2OTJ1 1M902 1YJ91 1Q862 3CPWZ 1JJ2Y 1N8R2 1KD12 1YIJZ 3CCRZ 3CCL1 1VQPZ 1K732 1N8R1 3CCS1 3G71Z 3OW2Y 3I551 3CCQ1 2QA4Z 1VQ71 1VQK1 1QVFY 2OTL1 3OW2Z 1VQLZ 1KD11 1YITZ 1M1K1 1Q7Y2 1NJI1 1S72Z 1Q811 3I56Z 3CXCY 1YHQ1 2QEXZ 1QVFZ 1YJWZ 1VQN1 3CCJZ 1QVGY 1K8A1 1VQ8Z 1YI2Z 1Q812 3CD61 3CMEZ 3G6EZ 3CC21 2OTJZ 1QVGZ 3CC71 3CC4Z 3G4S1 1KQSZ 3CMAZ 1VQ41 1NJI2 3CCM1 1Q822 1YIJ1 1M1K2 1KQSY 1VQ91 1YJ9Z 3CXCZ 1VQMZ 1KC81 1VQ61 1YIT1 3CCEZ 1W2BZ 3CCVZ 1VQL1 3CME1 1KC82 3CMA1 3CCUZ 1VQNZ 1M901 1VQKZ 3CC7Z 1YJNZ 1YHQZ 3CCJ1 2QEX1 1K731 1YJW1 3I561 3CCR1 1VQOZ 1VQ7Z 1Q861 1VQP1 2OTLZ 3I55Z 3CCQZ 2QA41 1YJN1 1Q821 1VQM1 1K9M1 1S721 3CCMZ 3CCSZ 3G711 1VQO1 1VQ4Z 1VQ5Z 1VQ9Z
chains in the Genus database with same CATH superfamily
2J6AA 3M4OI 1I3QI 1K8A2 5FLXf 1Q7Y1 3CD6Z 2EGTA 1I6HI 4EWCA 1VQ6Z 3G4SZ 5C4JI 2IV2X 3U50C 3CPWZ 1JJ2Y 1Y1VS 3J80b 2I3CA 3NFZA 2QR1B 4S1TA 1RNIA 4NBAA 4BXXI 3D2LA 2LIYA 3I551 1Z02A 5IP9I 2E2HI 1VQK1 1QVFY 2AYDA 1QXFA 1YITZ 1M1K1 1NJI1 1S72Z 1RO4A 1QYPA 4A3KI 2JMOA 3IFUA 2VUGA 2JIQA 2H85A 2VPYA 2RT9A 3GTKI 2IZ3A 1VQ8Z 1Q812 3CMEZ 1ZB8A 4MXUA 5D1OB 3VTNA 5IT9f 3S2HI 1DL6A 5T67A 1KQSZ 3CMAZ 1VQ41 1Y1VI 3TE5B 1NUIA 5C44I 2Q51A 3GTLI 3LUSA 1YJ9Z 1N2FA 3CXCZ 1YIT1 1W2BZ 1KC82 3S17I 2NVXI 4HGYA 2NVTI 5AN9F 2M6NA 3GTOI 4A3CI 4A3MI 1VQOZ 3IF8A 4NFRA 2OTLZ 2OZKA 2R92I 3MZKB 2JA6I 1S721 2K5RA 3J81f 5T64A 4RVGA 2RBLA 1P9NA 2DE7A 2M48A 2V45A 4E30A 1VQ9Z 2KI7B 3CCE1 1Y8CA 1W2BY 3GTMI 2Q4ZA 3EERA 2YADA 1JJ2Z 3CPWY 3G6E1 2PK7A 2R6MA 2OTJ1 1N8R2 1X3WA 3FQQA 1KD12 3D6WA 3HOUI 4RS4A 3CCL1 1TFIA 3S1NI 1RO0A 3J81b 2E2II 1Y1WI 3JAMb 3G71Z 2JUBA 4E2XA 3NH5A 2W03A 4RV9A 1WCMI 2JIPA 3M3YI 3ESWA 4MH4A 3OW2Z 1VQLZ 1KD11 2JIOA 4BY7I 1YHQ1 2QEXZ 1S7MA 1QVFZ 3CQZI 1YJWZ 3VMGA 3BG1B 3I4NI 3H3VJ 3VMHA 4X6AI 1I50I 1Z01A 2F4OA 5CM2M 3HOZI 3S14I 1K8A1 2O4HA 1YI2Z 3G6EZ 4NBHA 2OTJZ 3GKQA 3CC71 3G4S1 2JR6A 3NH8A 3F3FC 3CCM1 1Q822 2K3RA 4A93I 1TWAI 3KIFA 4RVHA 3Q87A 2QRCB 1KQSY 3RZOI 2RHBA 3TDHB 4E2ZA 3CCUZ 4NH1C 2DE6A 1M901 2F4MA 1YHQZ 2QEX1 1K731 2OOXB 1YJW1 3JAMf 3NH4A 5A2Qf 4XX2A 4NB9A 1Q861 4A3DI 2HF1A 2QA41 1LQLA 1YJN1 4A3BI 3S1QI 1VQM1 1K9M1 3CCSZ 4A3GI 4MRIA 4A3FI 3CC2Z 1K9M2 3CCV1 3CCLZ 3I4MI 3CCU1 3HKZA 3EEDA 1VQ51 1VQ81 3CC41 4NOZA 1M902 4DQYB 3BG0B 4RVDA 1YJ91 2KPIA 4NBEA 2QREB 2BJOA 2V8KA 1WIIA 2DE5A 1N8R1 1TWFI 2PM9A 3OW2Y 3S15I 2QA4Z 2VPZA 1VQ71 3S1MI 1USPB 2YU9I 2OTL1 2P3YA 3I56Z 3CXCY 2V8JA 3D9XA 3S1RI 1JWHC 1VQN1 2HU9A 3HOVI 3CCJZ 4BY1I 2IZ4A 3MONA 4A3JI 1SIWA 2VPXA 2NVQI 3J80f 2B63I 4HH4A 3QWUA 1QVGZ 4CL1A 2JNYA 2OOYB 4QTTA 1FDIA 4DGLA 2VPWA 1VLAA 4DK1A 2R93I 1ZH1A 3MZLB 1YIJ1 4MONA 3S2DI 2NAPA 2E7ZA 3IR7A 1KC81 4E2WA 3CME1 2VF1A 3P5JB 4A3EI 3HOWI 1VQNZ 2P28A 1NP6A 1YJNZ 3CCJ1 2V8IA 3VB9A 1USPA 2AKLA 3HOXI 5D1OA 3CCR1 1VQ7Z 4Y52I 5D1PA 4RVFA 1VQP1 1Q16A 3CCQZ 1RQFA 3RZDI 3GTGI 1Q821 3IX0A 4E32A 1PFTA 1FDOA 2LFUA 1X0TA 2GTHA 3CCMZ 1TWHI 4AYBA 1VQ4Z 1VQ5Z 1RLYA 2JIRA 3K7AI 2WB1A 1ZB9A 2RIQA 1YI21 2JA5I 2RPRA 4E31A 1WZNA 2W04A 1Q862 3NDIA 5FLXb 1X3ZA 1L1OC 4E2YA 4MD8A 1YIJZ 3CCRZ 1VQPZ 2R7ZI 1K732 4HGZA 2QKDA 1TWGI 3CCS1 2E2JI 4NBDA 3NDJA 2O53A 3CCQ1 3KIHA 5T6BA 5C3EI 2JIMA 5C4XI 3H0GI 1Q7Y2 5A2Qb 1Q811 4E33A 5LL6f 2JA7I 2NVYI 3F3PC 4MD9A 3T4NB 1TWCI 1QVGY 1ML8A 4Y7NI 3CD61 4NBBA 3CC21 2E9HA 2G2KA 4NB8A 1AA6A 1YUKA 1R9TI 1K83I 1KRLA 3GTQI 2PMZA 3CC4Z 3FQMA 4NBCA 4NBFA 1NJI2 5IT9b 4A3II 2Y0SA 1YUAA 1WJ2A 4TNUA 1M1K2 3PO2I 2GU2A 1VQ91 3PO3I 1VQMZ 1VQ61 3GTPI 3CCEZ 5IP7I 3CCVZ 1VQL1 2VUMI 3PO3S 3CMA1 2WAQA 2V3VA 4MD7A 4NBGA 3VMIA 4BBSI 1VQKZ 3CC7Z 1SFOI 1Z03A 4A3LI 3I07A 3HOYI 3I561 5FLMI 3GCFA 3GTJI 2QRDB 3I55Z 1RO2A 2GTIA 2JA8I 3J7A4 2ZAEB 3S16I 4BBRI 2JS4A 3G711 1WW9A 1QF8A 3FKII 1VQO1 4QTUA 2QLVB 2LEXA 3GTMS
chains in the Genus database with same CATH topology
2J6AA 3M4OI 1I3QI 1K8A2 5FLXf 1Q7Y1 3CD6Z 2EGTA 1I6HI 4EWCA 1VQ6Z 3G4SZ 5C4JI 3U50C 3CPWZ 1JJ2Y 1Y1VS 3J80b 2I3CA 3NFZA 2QR1B 4S1TA 1RNIA 4NBAA 4BXXI 2LIYA 3I551 1Z02A 5IP9I 2E2HI 1VQK1 1QVFY 1YITZ 1M1K1 1NJI1 1S72Z 1RO4A 1QYPA 4A3KI 2JMOA 3IFUA 2VUGA 2H85A 2RT9A 3GTKI 2IZ3A 1VQ8Z 1Q812 3CMEZ 1ZB8A 4MXUA 5D1OB 3VTNA 5IT9f 3S2HI 1DL6A 5T67A 1KQSZ 3CMAZ 1VQ41 1Y1VI 3TE5B 1NUIA 5C44I 2Q51A 3GTLI 3LUSA 1YJ9Z 1N2FA 3CXCZ 1YIT1 1W2BZ 1KC82 3S17I 2NVXI 4HGYA 2NVTI 5AN9F 2M6NA 3GTOI 4A3CI 4A3MI 1VQOZ 3IF8A 4NFRA 2OTLZ 2OZKA 2R92I 3MZKB 2JA6I 1S721 2K5RA 3J81f 5T64A 4RVGA 2RBLA 1P9NA 2DE7A 2M48A 4E30A 1VQ9Z 2KI7B 3CCE1 1W2BY 3GTMI 2Q4ZA 3EERA 2YADA 1JJ2Z 3CPWY 3G6E1 2PK7A 2R6MA 2OTJ1 1N8R2 1X3WA 3FQQA 1KD12 3D6WA 3HOUI 4RS4A 3CCL1 1TFIA 3S1NI 1RO0A 3J81b 2E2II 1Y1WI 3JAMb 3G71Z 2JUBA 4E2XA 3NH5A 2W03A 4RV9A 1WCMI 3M3YI 3ESWA 4MH4A 3OW2Z 1VQLZ 1KD11 4BY7I 1YHQ1 2QEXZ 1S7MA 1QVFZ 3CQZI 1YJWZ 3VMGA 3BG1B 3I4NI 3H3VJ 3VMHA 4X6AI 1I50I 1Z01A 2F4OA 5CM2M 3HOZI 3S14I 1K8A1 2O4HA 1YI2Z 3G6EZ 4NBHA 2OTJZ 3GKQA 3CC71 3G4S1 2JR6A 3NH8A 3F3FC 3CCM1 1Q822 2K3RA 4A93I 1TWAI 3KIFA 4RVHA 3Q87A 2QRCB 1KQSY 3RZOI 2RHBA 3TDHB 4E2ZA 3CCUZ 4NH1C 2DE6A 1M901 2F4MA 1YHQZ 2QEX1 1K731 2OOXB 1YJW1 3JAMf 3NH4A 5A2Qf 4XX2A 4NB9A 1Q861 4A3DI 2HF1A 2QA41 1LQLA 1YJN1 4A3BI 3S1QI 1VQM1 1K9M1 3CCSZ 4A3GI 4MRIA 4A3FI 3CC2Z 1K9M2 3CCV1 3CCLZ 3I4MI 3CCU1 3HKZA 3EEDA 1VQ51 1VQ81 3CC41 4NOZA 1M902 4DQYB 3BG0B 4RVDA 1YJ91 2KPIA 4NBEA 2QREB 2BJOA 2V8KA 1WIIA 2DE5A 1N8R1 1TWFI 2PM9A 3OW2Y 3S15I 2QA4Z 1VQ71 3S1MI 1USPB 2YU9I 2OTL1 2P3YA 3I56Z 3CXCY 2V8JA 3D9XA 3S1RI 1JWHC 1VQN1 2HU9A 3HOVI 3CCJZ 4BY1I 2IZ4A 3MONA 4A3JI 2NVQI 3J80f 2B63I 4HH4A 3QWUA 1QVGZ 4CL1A 2JNYA 2OOYB 4QTTA 4DGLA 4DK1A 1VLAA 2R93I 1ZH1A 3MZLB 1YIJ1 4MONA 3S2DI 1KC81 4E2WA 3CME1 2VF1A 3P5JB 4A3EI 3HOWI 1VQNZ 2P28A 1NP6A 1YJNZ 3CCJ1 2V8IA 3VB9A 1USPA 2AKLA 3HOXI 5D1OA 3CCR1 1VQ7Z 4Y52I 5D1PA 4RVFA 1VQP1 3CCQZ 1RQFA 3RZDI 3GTGI 1Q821 3IX0A 4E32A 1PFTA 2LFUA 1X0TA 2GTHA 3CCMZ 1TWHI 4AYBA 1VQ4Z 1VQ5Z 1RLYA 3K7AI 2WB1A 1ZB9A 2RIQA 1YI21 2JA5I 2RPRA 4E31A 2W04A 1Q862 3NDIA 5FLXb 1X3ZA 1L1OC 4E2YA 4MD8A 1YIJZ 3CCRZ 1VQPZ 2R7ZI 1K732 4HGZA 2QKDA 1TWGI 3CCS1 2E2JI 4NBDA 3NDJA 2O53A 3CCQ1 3KIHA 5T6BA 5C3EI 5C4XI 3H0GI 1Q7Y2 5A2Qb 1Q811 4E33A 5LL6f 2JA7I 2NVYI 3F3PC 4MD9A 3T4NB 1TWCI 1QVGY 1ML8A 4Y7NI 3CD61 4NBBA 3CC21 2E9HA 2G2KA 4NB8A 1YUKA 1R9TI 1K83I 1KRLA 3GTQI 2PMZA 3CC4Z 3FQMA 4NBCA 4NBFA 1NJI2 5IT9b 4A3II 2Y0SA 1YUAA 4TNUA 1M1K2 3PO2I 2GU2A 1VQ91 3PO3I 1VQMZ 1VQ61 3GTPI 3CCEZ 5IP7I 3CCVZ 1VQL1 2VUMI 3PO3S 3CMA1 2WAQA 4MD7A 4NBGA 3VMIA 4BBSI 1VQKZ 3CC7Z 1SFOI 1Z03A 4A3LI 3I07A 3HOYI 3I561 5FLMI 3GCFA 3GTJI 2QRDB 3I55Z 1RO2A 2GTIA 2JA8I 3J7A4 2ZAEB 3S16I 4BBRI 2JS4A 3G711 1WW9A 1QF8A 3FKII 1VQO1 4QTUA 2QLVB 3GTMS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE 1;  1W2B Y;  1K8A 2;  3CC2 Z;  1Q7Y 1;  3CD6 Z;  1K9M 2;  3CCV 1;  3CCL Z;  1JJ2 Z;  3CPW Y;  3CCU 1;  1VQ6 Z;  3G6E 1;  1VQ5 1;  1YI2 1;  1VQ8 1;  3CC4 1;  3G4S Z;  2OTJ 1;  1M90 2;  1YJ9 1;  1Q86 2;  3CPW Z;  1JJ2 Y;  1N8R 2;  1KD1 2;  1YIJ Z;  3CCR Z;  3CCL 1;  1VQP Z;  1K73 2;  1N8R 1;  3CCS 1;  3G71 Z;  3OW2 Y;  3I55 1;  3CCQ 1;  2QA4 Z;  1VQ7 1;  1VQK 1;  1QVF Y;  2OTL 1;  3OW2 Z;  1VQL Z;  1KD1 1;  1YIT Z;  1M1K 1;  1Q7Y 2;  1NJI 1;  1S72 Z;  1Q81 1;  3I56 Z;  3CXC Y;  1YHQ 1;  2QEX Z;  1QVF Z;  1YJW Z;  1VQN 1;  3CCJ Z;  1QVG Y;  1K8A 1;  1VQ8 Z;  1YI2 Z;  1Q81 2;  3CD6 1;  3CME Z;  3G6E Z;  3CC2 1;  2OTJ Z;  1QVG Z;  3CC7 1;  3CC4 Z;  3G4S 1;  1KQS Z;  3CMA Z;  1VQ4 1;  1NJI 2;  3CCM 1;  1Q82 2;  1YIJ 1;  1M1K 2;  1KQS Y;  1VQ9 1;  1YJ9 Z;  3CXC Z;  1VQM Z;  1KC8 1;  1VQ6 1;  1YIT 1;  3CCE Z;  1W2B Z;  3CCV Z;  1VQL 1;  3CME 1;  1KC8 2;  3CMA 1;  3CCU Z;  1VQN Z;  1M90 1;  1VQK Z;  3CC7 Z;  1YJN Z;  1YHQ Z;  3CCJ 1;  2QEX 1;  1K73 1;  1YJW 1;  3I56 1;  3CCR 1;  1VQO Z;  1VQ7 Z;  1Q86 1;  1VQP 1;  2OTL Z;  3I55 Z;  3CCQ Z;  2QA4 1;  1YJN 1;  1Q82 1;  1VQM 1;  1K9M 1;  1S72 1;  3CCM Z;  3CCS Z;  3G71 1;  1VQO 1;  1VQ4 Z;  1VQ5 Z;  1VQ9 Z; 
#chains in the Genus database with same CATH topology
 2J6A A;  3M4O I;  1I3Q I;  1K8A 2;  5FLX f;  1Q7Y 1;  3CD6 Z;  2EGT A;  1I6H I;  4EWC A;  1VQ6 Z;  3G4S Z;  5C4J I;  2IV2 X;  3U50 C;  3CPW Z;  1JJ2 Y;  1Y1V S;  3J80 b;  2I3C A;  3NFZ A;  2QR1 B;  4S1T A;  1RNI A;  4NBA A;  4BXX I;  3D2L A;  2LIY A;  3I55 1;  1Z02 A;  5IP9 I;  2E2H I;  1VQK 1;  1QVF Y;  2AYD A;  1QXF A;  1YIT Z;  1M1K 1;  1NJI 1;  1S72 Z;  1RO4 A;  1QYP A;  4A3K I;  2JMO A;  3IFU A;  2VUG A;  2JIQ A;  2H85 A;  2VPY A;  2RT9 A;  3GTK I;  2IZ3 A;  1VQ8 Z;  1Q81 2;  3CME Z;  1ZB8 A;  4MXU A;  5D1O B;  3VTN A;  5IT9 f;  3S2H I;  1DL6 A;  5T67 A;  1KQS Z;  3CMA Z;  1VQ4 1;  1Y1V I;  3TE5 B;  1NUI A;  5C44 I;  2Q51 A;  3GTL I;  3LUS A;  1YJ9 Z;  1N2F A;  3CXC Z;  1YIT 1;  1W2B Z;  1KC8 2;  3S17 I;  2NVX I;  4HGY A;  2NVT I;  5AN9 F;  2M6N A;  3GTO I;  4A3C I;  4A3M I;  1VQO Z;  3IF8 A;  4NFR A;  2OTL Z;  2OZK A;  2R92 I;  3MZK B;  2JA6 I;  1S72 1;  2K5R A;  3J81 f;  5T64 A;  4RVG A;  2RBL A;  1P9N A;  2DE7 A;  2M48 A;  2V45 A;  4E30 A;  1VQ9 Z;  2KI7 B;  3CCE 1;  1Y8C A;  1W2B Y;  3GTM I;  2Q4Z A;  3EER A;  2YAD A;  1JJ2 Z;  3CPW Y;  3G6E 1;  2PK7 A;  2R6M A;  2OTJ 1;  1N8R 2;  1X3W A;  3FQQ A;  1KD1 2;  3D6W A;  3HOU I;  4RS4 A;  3CCL 1;  1TFI A;  3S1N I;  1RO0 A;  3J81 b;  2E2I I;  1Y1W I;  3JAM b;  3G71 Z;  2JUB A;  4E2X A;  3NH5 A;  2W03 A;  4RV9 A;  1WCM I;  2JIP A;  3M3Y I;  3ESW A;  4MH4 A;  3OW2 Z;  1VQL Z;  1KD1 1;  2JIO A;  4BY7 I;  1YHQ 1;  2QEX Z;  1S7M A;  1QVF Z;  3CQZ I;  1YJW Z;  3VMG A;  3BG1 B;  3I4N I;  3H3V J;  3VMH A;  4X6A I;  1I50 I;  1Z01 A;  2F4O A;  5CM2 M;  3HOZ I;  3S14 I;  1K8A 1;  2O4H A;  1YI2 Z;  3G6E Z;  4NBH A;  2OTJ Z;  3GKQ A;  3CC7 1;  3G4S 1;  2JR6 A;  3NH8 A;  3F3F C;  3CCM 1;  1Q82 2;  2K3R A;  4A93 I;  1TWA I;  3KIF A;  4RVH A;  3Q87 A;  2QRC B;  1KQS Y;  3RZO I;  2RHB A;  3TDH B;  4E2Z A;  3CCU Z;  4NH1 C;  2DE6 A;  1M90 1;  2F4M A;  1YHQ Z;  2QEX 1;  1K73 1;  2OOX B;  1YJW 1;  3JAM f;  3NH4 A;  5A2Q f;  4XX2 A;  4NB9 A;  1Q86 1;  4A3D I;  2HF1 A;  2QA4 1;  1LQL A;  1YJN 1;  4A3B I;  3S1Q I;  1VQM 1;  1K9M 1;  3CCS Z;  4A3G I;  4MRI A;  4A3F I;  3CC2 Z;  1K9M 2;  3CCV 1;  3CCL Z;  3I4M I;  3CCU 1;  3HKZ A;  3EED A;  1VQ5 1;  1VQ8 1;  3CC4 1;  4NOZ A;  1M90 2;  4DQY B;  3BG0 B;  4RVD A;  1YJ9 1;  2KPI A;  4NBE A;  2QRE B;  2BJO A;  2V8K A;  1WII A;  2DE5 A;  1N8R 1;  1TWF I;  2PM9 A;  3OW2 Y;  3S15 I;  2QA4 Z;  2VPZ A;  1VQ7 1;  3S1M I;  1USP B;  2YU9 I;  2OTL 1;  2P3Y A;  3I56 Z;  3CXC Y;  2V8J A;  3D9X A;  3S1R I;  1JWH C;  1VQN 1;  2HU9 A;  3HOV I;  3CCJ Z;  4BY1 I;  2IZ4 A;  3MON A;  4A3J I;  1SIW A;  2VPX A;  2NVQ I;  3J80 f;  2B63 I;  4HH4 A;  3QWU A;  1QVG Z;  4CL1 A;  2JNY A;  2OOY B;  4QTT A;  1FDI A;  4DGL A;  2VPW A;  1VLA A;  4DK1 A;  2R93 I;  1ZH1 A;  3MZL B;  1YIJ 1;  4MON A;  3S2D I;  2NAP A;  2E7Z A;  3IR7 A;  1KC8 1;  4E2W A;  3CME 1;  2VF1 A;  3P5J B;  4A3E I;  3HOW I;  1VQN Z;  2P28 A;  1NP6 A;  1YJN Z;  3CCJ 1;  2V8I A;  3VB9 A;  1USP A;  2AKL A;  3HOX I;  5D1O A;  3CCR 1;  1VQ7 Z;  4Y52 I;  5D1P A;  4RVF A;  1VQP 1;  1Q16 A;  3CCQ Z;  1RQF A;  3RZD I;  3GTG I;  1Q82 1;  3IX0 A;  4E32 A;  1PFT A;  1FDO A;  2LFU A;  1X0T A;  2GTH A;  3CCM Z;  1TWH I;  4AYB A;  1VQ4 Z;  1VQ5 Z;  1RLY A;  2JIR A;  3K7A I;  2WB1 A;  1ZB9 A;  2RIQ A;  1YI2 1;  2JA5 I;  2RPR A;  4E31 A;  1WZN A;  2W04 A;  1Q86 2;  3NDI A;  5FLX b;  1X3Z A;  1L1O C;  4E2Y A;  4MD8 A;  1YIJ Z;  3CCR Z;  1VQP Z;  2R7Z I;  1K73 2;  4HGZ A;  2QKD A;  1TWG I;  3CCS 1;  2E2J I;  4NBD A;  3NDJ A;  2O53 A;  3CCQ 1;  3KIH A;  5T6B A;  5C3E I;  2JIM A;  5C4X I;  3H0G I;  1Q7Y 2;  5A2Q b;  1Q81 1;  4E33 A;  5LL6 f;  2JA7 I;  2NVY I;  3F3P C;  4MD9 A;  3T4N B;  1TWC I;  1QVG Y;  1ML8 A;  4Y7N I;  3CD6 1;  4NBB A;  3CC2 1;  2E9H A;  2G2K A;  4NB8 A;  1AA6 A;  1YUK A;  1R9T I;  1K83 I;  1KRL A;  3GTQ I;  2PMZ A;  3CC4 Z;  3FQM A;  4NBC A;  4NBF A;  1NJI 2;  5IT9 b;  4A3I I;  2Y0S A;  1YUA A;  1WJ2 A;  4TNU A;  1M1K 2;  3PO2 I;  2GU2 A;  1VQ9 1;  3PO3 I;  1VQM Z;  1VQ6 1;  3GTP I;  3CCE Z;  5IP7 I;  3CCV Z;  1VQL 1;  2VUM I;  3PO3 S;  3CMA 1;  2WAQ A;  2V3V A;  4MD7 A;  4NBG A;  3VMI A;  4BBS I;  1VQK Z;  3CC7 Z;  1SFO I;  1Z03 A;  4A3L I;  3I07 A;  3HOY I;  3I56 1;  5FLM I;  3GCF A;  3GTJ I;  2QRD B;  3I55 Z;  1RO2 A;  2GTI A;  2JA8 I;  3J7A 4;  2ZAE B;  3S16 I;  4BBR I;  2JS4 A;  3G71 1;  1WW9 A;  1QF8 A;  3FKI I;  1VQO 1;  4QTU A;  2QLV B;  2LEX A;  3GTM S; 
#chains in the Genus database with same CATH homology
 2J6A A;  3M4O I;  1I3Q I;  1K8A 2;  5FLX f;  1Q7Y 1;  3CD6 Z;  2EGT A;  1I6H I;  4EWC A;  1VQ6 Z;  3G4S Z;  5C4J I;  3U50 C;  3CPW Z;  1JJ2 Y;  1Y1V S;  3J80 b;  2I3C A;  3NFZ A;  2QR1 B;  4S1T A;  1RNI A;  4NBA A;  4BXX I;  2LIY A;  3I55 1;  1Z02 A;  5IP9 I;  2E2H I;  1VQK 1;  1QVF Y;  1YIT Z;  1M1K 1;  1NJI 1;  1S72 Z;  1RO4 A;  1QYP A;  4A3K I;  2JMO A;  3IFU A;  2VUG A;  2H85 A;  2RT9 A;  3GTK I;  2IZ3 A;  1VQ8 Z;  1Q81 2;  3CME Z;  1ZB8 A;  4MXU A;  5D1O B;  3VTN A;  5IT9 f;  3S2H I;  1DL6 A;  5T67 A;  1KQS Z;  3CMA Z;  1VQ4 1;  1Y1V I;  3TE5 B;  1NUI A;  5C44 I;  2Q51 A;  3GTL I;  3LUS A;  1YJ9 Z;  1N2F A;  3CXC Z;  1YIT 1;  1W2B Z;  1KC8 2;  3S17 I;  2NVX I;  4HGY A;  2NVT I;  5AN9 F;  2M6N A;  3GTO I;  4A3C I;  4A3M I;  1VQO Z;  3IF8 A;  4NFR A;  2OTL Z;  2OZK A;  2R92 I;  3MZK B;  2JA6 I;  1S72 1;  2K5R A;  3J81 f;  5T64 A;  4RVG A;  2RBL A;  1P9N A;  2DE7 A;  2M48 A;  4E30 A;  1VQ9 Z;  2KI7 B;  3CCE 1;  1W2B Y;  3GTM I;  2Q4Z A;  3EER A;  2YAD A;  1JJ2 Z;  3CPW Y;  3G6E 1;  2PK7 A;  2R6M A;  2OTJ 1;  1N8R 2;  1X3W A;  3FQQ A;  1KD1 2;  3D6W A;  3HOU I;  4RS4 A;  3CCL 1;  1TFI A;  3S1N I;  1RO0 A;  3J81 b;  2E2I I;  1Y1W I;  3JAM b;  3G71 Z;  2JUB A;  4E2X A;  3NH5 A;  2W03 A;  4RV9 A;  1WCM I;  3M3Y I;  3ESW A;  4MH4 A;  3OW2 Z;  1VQL Z;  1KD1 1;  4BY7 I;  1YHQ 1;  2QEX Z;  1S7M A;  1QVF Z;  3CQZ I;  1YJW Z;  3VMG A;  3BG1 B;  3I4N I;  3H3V J;  3VMH A;  4X6A I;  1I50 I;  1Z01 A;  2F4O A;  5CM2 M;  3HOZ I;  3S14 I;  1K8A 1;  2O4H A;  1YI2 Z;  3G6E Z;  4NBH A;  2OTJ Z;  3GKQ A;  3CC7 1;  3G4S 1;  2JR6 A;  3NH8 A;  3F3F C;  3CCM 1;  1Q82 2;  2K3R A;  4A93 I;  1TWA I;  3KIF A;  4RVH A;  3Q87 A;  2QRC B;  1KQS Y;  3RZO I;  2RHB A;  3TDH B;  4E2Z A;  3CCU Z;  4NH1 C;  2DE6 A;  1M90 1;  2F4M A;  1YHQ Z;  2QEX 1;  1K73 1;  2OOX B;  1YJW 1;  3JAM f;  3NH4 A;  5A2Q f;  4XX2 A;  4NB9 A;  1Q86 1;  4A3D I;  2HF1 A;  2QA4 1;  1LQL A;  1YJN 1;  4A3B I;  3S1Q I;  1VQM 1;  1K9M 1;  3CCS Z;  4A3G I;  4MRI A;  4A3F I;  3CC2 Z;  1K9M 2;  3CCV 1;  3CCL Z;  3I4M I;  3CCU 1;  3HKZ A;  3EED A;  1VQ5 1;  1VQ8 1;  3CC4 1;  4NOZ A;  1M90 2;  4DQY B;  3BG0 B;  4RVD A;  1YJ9 1;  2KPI A;  4NBE A;  2QRE B;  2BJO A;  2V8K A;  1WII A;  2DE5 A;  1N8R 1;  1TWF I;  2PM9 A;  3OW2 Y;  3S15 I;  2QA4 Z;  1VQ7 1;  3S1M I;  1USP B;  2YU9 I;  2OTL 1;  2P3Y A;  3I56 Z;  3CXC Y;  2V8J A;  3D9X A;  3S1R I;  1JWH C;  1VQN 1;  2HU9 A;  3HOV I;  3CCJ Z;  4BY1 I;  2IZ4 A;  3MON A;  4A3J I;  2NVQ I;  3J80 f;  2B63 I;  4HH4 A;  3QWU A;  1QVG Z;  4CL1 A;  2JNY A;  2OOY B;  4QTT A;  4DGL A;  4DK1 A;  1VLA A;  2R93 I;  1ZH1 A;  3MZL B;  1YIJ 1;  4MON A;  3S2D I;  1KC8 1;  4E2W A;  3CME 1;  2VF1 A;  3P5J B;  4A3E I;  3HOW I;  1VQN Z;  2P28 A;  1NP6 A;  1YJN Z;  3CCJ 1;  2V8I A;  3VB9 A;  1USP A;  2AKL A;  3HOX I;  5D1O A;  3CCR 1;  1VQ7 Z;  4Y52 I;  5D1P A;  4RVF A;  1VQP 1;  3CCQ Z;  1RQF A;  3RZD I;  3GTG I;  1Q82 1;  3IX0 A;  4E32 A;  1PFT A;  2LFU A;  1X0T A;  2GTH A;  3CCM Z;  1TWH I;  4AYB A;  1VQ4 Z;  1VQ5 Z;  1RLY A;  3K7A I;  2WB1 A;  1ZB9 A;  2RIQ A;  1YI2 1;  2JA5 I;  2RPR A;  4E31 A;  2W04 A;  1Q86 2;  3NDI A;  5FLX b;  1X3Z A;  1L1O C;  4E2Y A;  4MD8 A;  1YIJ Z;  3CCR Z;  1VQP Z;  2R7Z I;  1K73 2;  4HGZ A;  2QKD A;  1TWG I;  3CCS 1;  2E2J I;  4NBD A;  3NDJ A;  2O53 A;  3CCQ 1;  3KIH A;  5T6B A;  5C3E I;  5C4X I;  3H0G I;  1Q7Y 2;  5A2Q b;  1Q81 1;  4E33 A;  5LL6 f;  2JA7 I;  2NVY I;  3F3P C;  4MD9 A;  3T4N B;  1TWC I;  1QVG Y;  1ML8 A;  4Y7N I;  3CD6 1;  4NBB A;  3CC2 1;  2E9H A;  2G2K A;  4NB8 A;  1YUK A;  1R9T I;  1K83 I;  1KRL A;  3GTQ I;  2PMZ A;  3CC4 Z;  3FQM A;  4NBC A;  4NBF A;  1NJI 2;  5IT9 b;  4A3I I;  2Y0S A;  1YUA A;  4TNU A;  1M1K 2;  3PO2 I;  2GU2 A;  1VQ9 1;  3PO3 I;  1VQM Z;  1VQ6 1;  3GTP I;  3CCE Z;  5IP7 I;  3CCV Z;  1VQL 1;  2VUM I;  3PO3 S;  3CMA 1;  2WAQ A;  4MD7 A;  4NBG A;  3VMI A;  4BBS I;  1VQK Z;  3CC7 Z;  1SFO I;  1Z03 A;  4A3L I;  3I07 A;  3HOY I;  3I56 1;  5FLM I;  3GCF A;  3GTJ I;  2QRD B;  3I55 Z;  1RO2 A;  2GTI A;  2JA8 I;  3J7A 4;  2ZAE B;  3S16 I;  4BBR I;  2JS4 A;  3G71 1;  1WW9 A;  1QF8 A;  3FKI I;  1VQO 1;  4QTU A;  2QLV B;  3GTM S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...