1YJ9Z

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yj9Z00
1Q7Y1 1W2BY 3G71Z 3CCJZ 1KC81 3CCQZ 1K9M2 3CCLZ 3CCUZ 1YHQZ 1NJI1 3OW2Z 3G6E1 1YJW1 3G4S1 1YI21 1K8A2 1Q862 1KD11 3CC7Z 3CME1 1QVFZ 3CCVZ 1N8R2 2OTJ1 1Q7Y2 1M1K2 1YITZ 3CCR1 1KC82 1Q821 2QA41 3G6EZ 1Q811 1VQ71 3CD61 3I561 1VQM1 1YI2Z 1VQN1 1NJI2 2OTL1 1YJNZ 1VQ51 1KQSZ 3I551 1VQK1 1JJ2Y 3CCS1 1M901 2OTJZ 3CPWZ 3CCRZ 3CCE1 3CXCZ 1K732 1VQ81 3CC41 3CD6Z 3I56Z 1VQMZ 3CCM1 1S721 2OTLZ 1QVGZ 1VQ41 1VQ5Z 1Q822 3I55Z 3OW2Y 3CMA1 1VQP1 1K9M1 3CCSZ 1YJWZ 3G4SZ 1VQO1 3CCJ1 1YIJ1 1VQL1 3CC21 1VQ61 1VQ91 3CMEZ 3CCU1 1QVFY 1YJ91 1KD12 3CMAZ 1VQPZ 2QA4Z 1VQ7Z 1M1K1 1VQOZ 1VQNZ 1YIJZ 3CC71 1VQLZ 3CC2Z 1VQ6Z 1Q812 3CCV1 1KQSY 1VQKZ 2QEX1 1VQ9Z 1YIT1 1W2BZ 1YJ9Z 3G711 3CPWY 3CCEZ 3CXCY 3CCQ1 1VQ8Z 3CC4Z 3CCL1 1M902 1YHQ1 1YJN1 1K8A1 3CCMZ 1K731 1S72Z 1Q861 1JJ2Z 1VQ4Z 1QVGY 2QEXZ 1N8R1
chains in the Genus database with same CATH superfamily
1VLAA 4BXXI 1K9M2 4MONA 1FDOA 4A3MI 2Y0SA 1YJW1 2VUMI 3S1NI 2E2HI 4NBHA 1YI21 3GTPI 1K8A2 3CC7Z 2IV2X 2NAPA 2OOYB 3Q87A 2JIRA 3I4MI 1Q7Y2 1M1K2 1YITZ 2OTJ1 3S2DI 3CCR1 2JUBA 4NBBA 1Q821 4NB8A 3G6EZ 1Q811 1VQ71 2Q51A 4NBDA 1RO0A 1VQM1 2VF1A 2OTL1 2LEXA 2VPXA 2RHBA 4A3BI 1JJ2Y 1M901 4NOZA 3NDIA 3H3VJ 3CPWZ 2GTIA 3RZOI 1VQ81 3GKQA 2JR6A 2QREB 3F3PC 1QVGZ 5T64A 4MD8A 3VMGA 3OW2Y 5T67A 3CCSZ 3S15I 3G4SZ 4RS4A 2P3YA 2RT9A 1TFIA 4E30A 5IT9f 1YIJ1 2JIQA 5D1OB 1VQ61 3MONA 3VMIA 1QVFY 3RZDI 4DQYB 2QA4Z 2O53A 2PK7A 1Z02A 4EWCA 3QWUA 1VQNZ 3CC71 5D1PA 1Q812 4E2ZA 1VQKZ 2JS4A 1VQ9Z 1YIT1 2LIYA 1W2BZ 2YADA 2WB1A 1YJ9Z 3CCEZ 1WZNA 3CCL1 1M902 3M4OI 1RNIA 4MXUA 1YHQ1 1LQLA 3H0GI 1K8A1 3CCMZ 1K731 4A3LI 2R92I 5IP7I 2QRCB 3P5JB 3PO3I 2QEXZ 3MZKB 1Q7Y1 1W2BY 2E7ZA 3G71Z 3VB9A 3CCJZ 2VUGA 2OZKA 3NH5A 1I50I 2G2KA 3S1QI 3HOVI 1PFTA 1FDIA 3D9XA 3IF8A 4HGZA 4QTTA 2VPZA 5CM2M 3G4S1 4S1TA 4DGLA 2E2II 3TE5B 1SFOI 5A2Qf 1SIWA 5A2Qb 3MZLB 1Q16A 1ML8A 1N2FA 2NVQI 3PO2I 3GTLI 4AYBA 2QA41 4HGYA 3GTOI 3IR7A 2JIPA 2W03A 3CD61 1VQN1 1WIIA 4NBGA 1VQ51 3EEDA 1YJNZ 1KQSZ 1VQK1 5C3EI 3GTQI 2QR1B 2QKDA 2F4MA 1X3ZA 3CCE1 3CXCZ 1K732 2JA6I 3FQQA 3HKZA 3J81b 3I56Z 1Y1VS 3CCM1 2KPIA 3JAMb 3I55Z 1VQP1 3GTMS 2QLVB 1VQO1 3S17I 3CCJ1 1VQL1 3CC21 2PM9A 4A3DI 1X3WA 2B63I 2Q4ZA 1TWCI 3CMAZ 4A3GI 2VPWA 3EERA 2R6MA 2YU9I 2K3RA 4Y52I 2M48A 5C44I 3KIHA 3I4NI 1WW9A 2OOXB 3CPWY 4BY1I 5FLXf 2RPRA 5FLXb 2JA5I 1YJN1 2DE6A 4XX2A 1S72Z 4A3II 3HOUI 3GTGI 4RVGA 1QVGY 3CQZI 3D6WA 4NBAA 3FKII 1TWFI 3GTKI 4MD9A 1TWGI 1Y1WI 3NFZA 3CCQZ 2WAQA 3CCUZ 5D1OA 2V45A 3S1RI 1I6HI 3GTJI 3G6E1 4BBRI 3LUSA 1AA6A 2V8KA 1Z01A 2VPYA 1YUAA 1Q862 1WCMI 3M3YI 3BG1B 3CCVZ 4X6AI 2QRDB 1KC82 1Y8CA 1YI2Z 1NJI2 3ESWA 5FLMI 5C4JI 2JMOA 1USPB 3CCS1 4A93I 2OTJZ 3KIFA 3J80b 3CCRZ 2R7ZI 4A3FI 4DK1A 5T6BA 1QXFA 3U50C 1VQMZ 1S721 2OTLZ 2BJOA 4BBSI 1P9NA 2H85A 4Y7NI 2NVXI 1S7MA 1USPA 3I07A 2NVYI 2GU2A 1QF8A 1VQ91 3CMEZ 3CCU1 3S16I 2F4OA 4BY7I 3D2LA 1YJ91 2E2JI 2J6AA 4NBFA 3J81f 2GTHA 4MH4A 3JAMf 4TNUA 1YIJZ 2JIOA 3J7A4 1VQ6Z 2V8IA 5IP9I 3CCV1 1KQSY 2QEX1 2JA7I 1ZB8A 2JIMA 2HU9A 4E31A 3FQMA 2LFUA 3G711 4NBCA 2K5RA 1R9TI 3NH8A 3CXCY 3CC4Z 1Y1VI 1YUKA 1Q861 1JJ2Z 1VQ4Z 4MD7A 3GCFA 1KRLA 3GTMI 3HOZI 4E2XA 4RVHA 1KC81 3VTNA 1ZH1A 2IZ4A 3CCLZ 1ZB9A 1YHQZ 2EGTA 1NJI1 3OW2Z 3NH4A 4RVDA 2P28A 2IZ3A 2O4HA 2RBLA 4NFRA 4QTUA 1DL6A 3IFUA 3HOXI 1KD11 3F3FC 3HOYI 3CME1 1QVFZ 1N8R2 2R93I 2PMZA 2NVTI 4E2YA 3I561 3IX0A 3S14I 5IT9b 1NUIA 3I551 1RQFA 3NDJA 4E32A 2M6NA 3CC41 4NB9A 5LL6f 3CD6Z 3HOWI 1RO2A 1X0TA 1L1OC 1VQ41 1VQ5Z 1Q822 2JA8I 1TWAI 3CMA1 1K9M1 3PO3S 1YJWZ 1NP6A 4A3JI 2AYDA 3K7AI 1Z03A 2DE5A 1I3QI 3S1MI 3T4NB 4HH4A 4E33A 3J80f 4MRIA 1WJ2A 2JNYA 2AKLA 1KD12 4CL1A 1VQPZ 4A3EI 3S2HI 2V3VA 1VQ7Z 2V8JA 1M1K1 1VQOZ 4NBEA 5C4XI 2W04A 1QYPA 2HF1A 1VQLZ 2KI7B 3CC2Z 2I3CA 1TWHI 3VMHA 4E2WA 4A3CI 4A3KI 2E9HA 1JWHC 1RLYA 4RV9A 3CCQ1 1VQ8Z 3BG0B 4NH1C 4RVFA 3TDHB 1RO4A 5AN9F 2DE7A 1K83I 2RIQA 2ZAEB 1N8R1
chains in the Genus database with same CATH topology
1VLAA 4BXXI 1K9M2 4MONA 4A3MI 2Y0SA 1YJW1 2VUMI 3S1NI 2E2HI 4NBHA 1YI21 3GTPI 1K8A2 3CC7Z 2OOYB 3Q87A 3I4MI 2OTJ1 1Q7Y2 1M1K2 1YITZ 3S2DI 3CCR1 2JUBA 4NBBA 1Q821 4NB8A 3G6EZ 1Q811 1VQ71 2Q51A 4NBDA 1RO0A 1VQM1 2VF1A 2OTL1 2RHBA 4A3BI 1JJ2Y 1M901 4NOZA 3NDIA 3H3VJ 3CPWZ 2GTIA 3RZOI 1VQ81 3GKQA 2JR6A 2QREB 3F3PC 1QVGZ 5T64A 4MD8A 3VMGA 3OW2Y 5T67A 3CCSZ 3S15I 3G4SZ 4RS4A 2P3YA 2RT9A 1TFIA 4E30A 5IT9f 1YIJ1 5D1OB 1VQ61 3MONA 3VMIA 1QVFY 3RZDI 4DQYB 2QA4Z 2O53A 2PK7A 1Z02A 4EWCA 3QWUA 1VQNZ 3CC71 5D1PA 1Q812 4E2ZA 1VQKZ 2JS4A 1VQ9Z 1YIT1 2LIYA 1W2BZ 2YADA 2WB1A 1YJ9Z 3CCEZ 3CCL1 1M902 3M4OI 1RNIA 4MXUA 1YHQ1 1LQLA 3H0GI 1K8A1 3CCMZ 1K731 4A3LI 2R92I 5IP7I 2QRCB 3P5JB 3PO3I 2QEXZ 3MZKB 1Q7Y1 1W2BY 3G71Z 3VB9A 3CCJZ 2VUGA 2OZKA 3NH5A 1I50I 2G2KA 3S1QI 3HOVI 1PFTA 3D9XA 3IF8A 4HGZA 4QTTA 5CM2M 3G4S1 4S1TA 4DGLA 2E2II 3TE5B 1SFOI 5A2Qf 5A2Qb 3MZLB 1ML8A 1N2FA 2NVQI 3PO2I 3GTLI 4AYBA 2QA41 4HGYA 3GTOI 2W03A 3CD61 1VQN1 1WIIA 4NBGA 1VQ51 3EEDA 1YJNZ 1KQSZ 1VQK1 5C3EI 3GTQI 2QR1B 2QKDA 2F4MA 1X3ZA 3CCE1 3CXCZ 1K732 2JA6I 3FQQA 3HKZA 3J81b 3I56Z 1Y1VS 3CCM1 2KPIA 3JAMb 3I55Z 1VQP1 3GTMS 2QLVB 1VQO1 3S17I 3CCJ1 1VQL1 3CC21 2PM9A 4A3DI 1X3WA 2B63I 2Q4ZA 1TWCI 3CMAZ 4A3GI 3EERA 2R6MA 2YU9I 2K3RA 4Y52I 2M48A 5C44I 3KIHA 3I4NI 1WW9A 2OOXB 3CPWY 4BY1I 5FLXf 2RPRA 5FLXb 2JA5I 1YJN1 2DE6A 4XX2A 1S72Z 4A3II 3HOUI 3GTGI 4RVGA 1QVGY 3CQZI 3D6WA 4NBAA 3FKII 1TWFI 3GTKI 4MD9A 1TWGI 1Y1WI 3NFZA 3CCQZ 2WAQA 3CCUZ 5D1OA 3S1RI 1I6HI 3GTJI 3G6E1 4BBRI 3LUSA 2V8KA 1Z01A 1YUAA 1Q862 1WCMI 3M3YI 3BG1B 3CCVZ 4X6AI 2QRDB 1KC82 1YI2Z 1NJI2 3ESWA 5FLMI 5C4JI 2JMOA 1USPB 3CCS1 4A93I 2OTJZ 3KIFA 3J80b 3CCRZ 2R7ZI 4A3FI 4DK1A 5T6BA 3U50C 1VQMZ 1S721 2OTLZ 2BJOA 4BBSI 1P9NA 2H85A 4Y7NI 2NVXI 1S7MA 1USPA 3I07A 2NVYI 2GU2A 1QF8A 1VQ91 3CMEZ 3CCU1 3S16I 2F4OA 4BY7I 1YJ91 2E2JI 2J6AA 4NBFA 3J81f 2GTHA 4MH4A 3JAMf 4TNUA 1YIJZ 3J7A4 1VQ6Z 2V8IA 5IP9I 3CCV1 1KQSY 2QEX1 2JA7I 1ZB8A 2HU9A 4E31A 3FQMA 2LFUA 3G711 4NBCA 2K5RA 1R9TI 3NH8A 3CXCY 3CC4Z 1Y1VI 1YUKA 1Q861 1JJ2Z 1VQ4Z 4MD7A 3GCFA 1KRLA 3GTMI 3HOZI 4E2XA 4RVHA 1KC81 3VTNA 1ZH1A 2IZ4A 3CCLZ 1ZB9A 1YHQZ 2EGTA 1NJI1 3OW2Z 3NH4A 4RVDA 2P28A 2IZ3A 2O4HA 2RBLA 4NFRA 4QTUA 1DL6A 3IFUA 3HOXI 1KD11 3F3FC 3HOYI 3CME1 1QVFZ 1N8R2 2R93I 2PMZA 2NVTI 4E2YA 3I561 3IX0A 3S14I 5IT9b 1NUIA 3I551 1RQFA 3NDJA 4E32A 2M6NA 3CC41 4NB9A 5LL6f 3CD6Z 3HOWI 1RO2A 1X0TA 1L1OC 1VQ41 1VQ5Z 1Q822 2JA8I 1TWAI 3CMA1 1K9M1 3PO3S 1YJWZ 1NP6A 4A3JI 3K7AI 1Z03A 2DE5A 1I3QI 3S1MI 3T4NB 4HH4A 4E33A 3J80f 4MRIA 2JNYA 2AKLA 1KD12 4CL1A 1VQPZ 4A3EI 3S2HI 1VQ7Z 2V8JA 1M1K1 1VQOZ 4NBEA 5C4XI 2W04A 1QYPA 2HF1A 1VQLZ 2KI7B 3CC2Z 2I3CA 1TWHI 3VMHA 4E2WA 4A3CI 4A3KI 2E9HA 1JWHC 1RLYA 4RV9A 3CCQ1 1VQ8Z 3BG0B 4NH1C 4RVFA 3TDHB 1RO4A 5AN9F 2DE7A 1K83I 2RIQA 2ZAEB 1N8R1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y 1;  1W2B Y;  3G71 Z;  3CCJ Z;  1KC8 1;  3CCQ Z;  1K9M 2;  3CCL Z;  3CCU Z;  1YHQ Z;  1NJI 1;  3OW2 Z;  3G6E 1;  1YJW 1;  3G4S 1;  1YI2 1;  1K8A 2;  1Q86 2;  1KD1 1;  3CC7 Z;  3CME 1;  1QVF Z;  3CCV Z;  1N8R 2;  2OTJ 1;  1Q7Y 2;  1M1K 2;  1YIT Z;  3CCR 1;  1KC8 2;  1Q82 1;  2QA4 1;  3G6E Z;  1Q81 1;  1VQ7 1;  3CD6 1;  3I56 1;  1VQM 1;  1YI2 Z;  1VQN 1;  1NJI 2;  2OTL 1;  1YJN Z;  1VQ5 1;  1KQS Z;  3I55 1;  1VQK 1;  1JJ2 Y;  3CCS 1;  1M90 1;  2OTJ Z;  3CPW Z;  3CCR Z;  3CCE 1;  3CXC Z;  1K73 2;  1VQ8 1;  3CC4 1;  3CD6 Z;  3I56 Z;  1VQM Z;  3CCM 1;  1S72 1;  2OTL Z;  1QVG Z;  1VQ4 1;  1VQ5 Z;  1Q82 2;  3I55 Z;  3OW2 Y;  3CMA 1;  1VQP 1;  1K9M 1;  3CCS Z;  1YJW Z;  3G4S Z;  1VQO 1;  3CCJ 1;  1YIJ 1;  1VQL 1;  3CC2 1;  1VQ6 1;  1VQ9 1;  3CME Z;  3CCU 1;  1QVF Y;  1YJ9 1;  1KD1 2;  3CMA Z;  1VQP Z;  2QA4 Z;  1VQ7 Z;  1M1K 1;  1VQO Z;  1VQN Z;  1YIJ Z;  3CC7 1;  1VQL Z;  3CC2 Z;  1VQ6 Z;  1Q81 2;  3CCV 1;  1KQS Y;  1VQK Z;  2QEX 1;  1VQ9 Z;  1YIT 1;  1W2B Z;  1YJ9 Z;  3G71 1;  3CPW Y;  3CCE Z;  3CXC Y;  3CCQ 1;  1VQ8 Z;  3CC4 Z;  3CCL 1;  1M90 2;  1YHQ 1;  1YJN 1;  1K8A 1;  3CCM Z;  1K73 1;  1S72 Z;  1Q86 1;  1JJ2 Z;  1VQ4 Z;  1QVG Y;  2QEX Z;  1N8R 1; 
#chains in the Genus database with same CATH topology
 1VLA A;  4BXX I;  1K9M 2;  4MON A;  1FDO A;  4A3M I;  2Y0S A;  1YJW 1;  2VUM I;  3S1N I;  2E2H I;  4NBH A;  1YI2 1;  3GTP I;  1K8A 2;  3CC7 Z;  2IV2 X;  2NAP A;  2OOY B;  3Q87 A;  2JIR A;  3I4M I;  1Q7Y 2;  1M1K 2;  1YIT Z;  2OTJ 1;  3S2D I;  3CCR 1;  2JUB A;  4NBB A;  1Q82 1;  4NB8 A;  3G6E Z;  1Q81 1;  1VQ7 1;  2Q51 A;  4NBD A;  1RO0 A;  1VQM 1;  2VF1 A;  2OTL 1;  2LEX A;  2VPX A;  2RHB A;  4A3B I;  1JJ2 Y;  1M90 1;  4NOZ A;  3NDI A;  3H3V J;  3CPW Z;  2GTI A;  3RZO I;  1VQ8 1;  3GKQ A;  2JR6 A;  2QRE B;  3F3P C;  1QVG Z;  5T64 A;  4MD8 A;  3VMG A;  3OW2 Y;  5T67 A;  3CCS Z;  3S15 I;  3G4S Z;  4RS4 A;  2P3Y A;  2RT9 A;  1TFI A;  4E30 A;  5IT9 f;  1YIJ 1;  2JIQ A;  5D1O B;  1VQ6 1;  3MON A;  3VMI A;  1QVF Y;  3RZD I;  4DQY B;  2QA4 Z;  2O53 A;  2PK7 A;  1Z02 A;  4EWC A;  3QWU A;  1VQN Z;  3CC7 1;  5D1P A;  1Q81 2;  4E2Z A;  1VQK Z;  2JS4 A;  1VQ9 Z;  1YIT 1;  2LIY A;  1W2B Z;  2YAD A;  2WB1 A;  1YJ9 Z;  3CCE Z;  1WZN A;  3CCL 1;  1M90 2;  3M4O I;  1RNI A;  4MXU A;  1YHQ 1;  1LQL A;  3H0G I;  1K8A 1;  3CCM Z;  1K73 1;  4A3L I;  2R92 I;  5IP7 I;  2QRC B;  3P5J B;  3PO3 I;  2QEX Z;  3MZK B;  1Q7Y 1;  1W2B Y;  2E7Z A;  3G71 Z;  3VB9 A;  3CCJ Z;  2VUG A;  2OZK A;  3NH5 A;  1I50 I;  2G2K A;  3S1Q I;  3HOV I;  1PFT A;  1FDI A;  3D9X A;  3IF8 A;  4HGZ A;  4QTT A;  2VPZ A;  5CM2 M;  3G4S 1;  4S1T A;  4DGL A;  2E2I I;  3TE5 B;  1SFO I;  5A2Q f;  1SIW A;  5A2Q b;  3MZL B;  1Q16 A;  1ML8 A;  1N2F A;  2NVQ I;  3PO2 I;  3GTL I;  4AYB A;  2QA4 1;  4HGY A;  3GTO I;  3IR7 A;  2JIP A;  2W03 A;  3CD6 1;  1VQN 1;  1WII A;  4NBG A;  1VQ5 1;  3EED A;  1YJN Z;  1KQS Z;  1VQK 1;  5C3E I;  3GTQ I;  2QR1 B;  2QKD A;  2F4M A;  1X3Z A;  3CCE 1;  3CXC Z;  1K73 2;  2JA6 I;  3FQQ A;  3HKZ A;  3J81 b;  3I56 Z;  1Y1V S;  3CCM 1;  2KPI A;  3JAM b;  3I55 Z;  1VQP 1;  3GTM S;  2QLV B;  1VQO 1;  3S17 I;  3CCJ 1;  1VQL 1;  3CC2 1;  2PM9 A;  4A3D I;  1X3W A;  2B63 I;  2Q4Z A;  1TWC I;  3CMA Z;  4A3G I;  2VPW A;  3EER A;  2R6M A;  2YU9 I;  2K3R A;  4Y52 I;  2M48 A;  5C44 I;  3KIH A;  3I4N I;  1WW9 A;  2OOX B;  3CPW Y;  4BY1 I;  5FLX f;  2RPR A;  5FLX b;  2JA5 I;  1YJN 1;  2DE6 A;  4XX2 A;  1S72 Z;  4A3I I;  3HOU I;  3GTG I;  4RVG A;  1QVG Y;  3CQZ I;  3D6W A;  4NBA A;  3FKI I;  1TWF I;  3GTK I;  4MD9 A;  1TWG I;  1Y1W I;  3NFZ A;  3CCQ Z;  2WAQ A;  3CCU Z;  5D1O A;  2V45 A;  3S1R I;  1I6H I;  3GTJ I;  3G6E 1;  4BBR I;  3LUS A;  1AA6 A;  2V8K A;  1Z01 A;  2VPY A;  1YUA A;  1Q86 2;  1WCM I;  3M3Y I;  3BG1 B;  3CCV Z;  4X6A I;  2QRD B;  1KC8 2;  1Y8C A;  1YI2 Z;  1NJI 2;  3ESW A;  5FLM I;  5C4J I;  2JMO A;  1USP B;  3CCS 1;  4A93 I;  2OTJ Z;  3KIF A;  3J80 b;  3CCR Z;  2R7Z I;  4A3F I;  4DK1 A;  5T6B A;  1QXF A;  3U50 C;  1VQM Z;  1S72 1;  2OTL Z;  2BJO A;  4BBS I;  1P9N A;  2H85 A;  4Y7N I;  2NVX I;  1S7M A;  1USP A;  3I07 A;  2NVY I;  2GU2 A;  1QF8 A;  1VQ9 1;  3CME Z;  3CCU 1;  3S16 I;  2F4O A;  4BY7 I;  3D2L A;  1YJ9 1;  2E2J I;  2J6A A;  4NBF A;  3J81 f;  2GTH A;  4MH4 A;  3JAM f;  4TNU A;  1YIJ Z;  2JIO A;  3J7A 4;  1VQ6 Z;  2V8I A;  5IP9 I;  3CCV 1;  1KQS Y;  2QEX 1;  2JA7 I;  1ZB8 A;  2JIM A;  2HU9 A;  4E31 A;  3FQM A;  2LFU A;  3G71 1;  4NBC A;  2K5R A;  1R9T I;  3NH8 A;  3CXC Y;  3CC4 Z;  1Y1V I;  1YUK A;  1Q86 1;  1JJ2 Z;  1VQ4 Z;  4MD7 A;  3GCF A;  1KRL A;  3GTM I;  3HOZ I;  4E2X A;  4RVH A;  1KC8 1;  3VTN A;  1ZH1 A;  2IZ4 A;  3CCL Z;  1ZB9 A;  1YHQ Z;  2EGT A;  1NJI 1;  3OW2 Z;  3NH4 A;  4RVD A;  2P28 A;  2IZ3 A;  2O4H A;  2RBL A;  4NFR A;  4QTU A;  1DL6 A;  3IFU A;  3HOX I;  1KD1 1;  3F3F C;  3HOY I;  3CME 1;  1QVF Z;  1N8R 2;  2R93 I;  2PMZ A;  2NVT I;  4E2Y A;  3I56 1;  3IX0 A;  3S14 I;  5IT9 b;  1NUI A;  3I55 1;  1RQF A;  3NDJ A;  4E32 A;  2M6N A;  3CC4 1;  4NB9 A;  5LL6 f;  3CD6 Z;  3HOW I;  1RO2 A;  1X0T A;  1L1O C;  1VQ4 1;  1VQ5 Z;  1Q82 2;  2JA8 I;  1TWA I;  3CMA 1;  1K9M 1;  3PO3 S;  1YJW Z;  1NP6 A;  4A3J I;  2AYD A;  3K7A I;  1Z03 A;  2DE5 A;  1I3Q I;  3S1M I;  3T4N B;  4HH4 A;  4E33 A;  3J80 f;  4MRI A;  1WJ2 A;  2JNY A;  2AKL A;  1KD1 2;  4CL1 A;  1VQP Z;  4A3E I;  3S2H I;  2V3V A;  1VQ7 Z;  2V8J A;  1M1K 1;  1VQO Z;  4NBE A;  5C4X I;  2W04 A;  1QYP A;  2HF1 A;  1VQL Z;  2KI7 B;  3CC2 Z;  2I3C A;  1TWH I;  3VMH A;  4E2W A;  4A3C I;  4A3K I;  2E9H A;  1JWH C;  1RLY A;  4RV9 A;  3CCQ 1;  1VQ8 Z;  3BG0 B;  4NH1 C;  4RVF A;  3TDH B;  1RO4 A;  5AN9 F;  2DE7 A;  1K83 I;  2RIQ A;  2ZAE B;  1N8R 1; 
#chains in the Genus database with same CATH homology
 1VLA A;  4BXX I;  1K9M 2;  4MON A;  4A3M I;  2Y0S A;  1YJW 1;  2VUM I;  3S1N I;  2E2H I;  4NBH A;  1YI2 1;  3GTP I;  1K8A 2;  3CC7 Z;  2OOY B;  3Q87 A;  3I4M I;  2OTJ 1;  1Q7Y 2;  1M1K 2;  1YIT Z;  3S2D I;  3CCR 1;  2JUB A;  4NBB A;  1Q82 1;  4NB8 A;  3G6E Z;  1Q81 1;  1VQ7 1;  2Q51 A;  4NBD A;  1RO0 A;  1VQM 1;  2VF1 A;  2OTL 1;  2RHB A;  4A3B I;  1JJ2 Y;  1M90 1;  4NOZ A;  3NDI A;  3H3V J;  3CPW Z;  2GTI A;  3RZO I;  1VQ8 1;  3GKQ A;  2JR6 A;  2QRE B;  3F3P C;  1QVG Z;  5T64 A;  4MD8 A;  3VMG A;  3OW2 Y;  5T67 A;  3CCS Z;  3S15 I;  3G4S Z;  4RS4 A;  2P3Y A;  2RT9 A;  1TFI A;  4E30 A;  5IT9 f;  1YIJ 1;  5D1O B;  1VQ6 1;  3MON A;  3VMI A;  1QVF Y;  3RZD I;  4DQY B;  2QA4 Z;  2O53 A;  2PK7 A;  1Z02 A;  4EWC A;  3QWU A;  1VQN Z;  3CC7 1;  5D1P A;  1Q81 2;  4E2Z A;  1VQK Z;  2JS4 A;  1VQ9 Z;  1YIT 1;  2LIY A;  1W2B Z;  2YAD A;  2WB1 A;  1YJ9 Z;  3CCE Z;  3CCL 1;  1M90 2;  3M4O I;  1RNI A;  4MXU A;  1YHQ 1;  1LQL A;  3H0G I;  1K8A 1;  3CCM Z;  1K73 1;  4A3L I;  2R92 I;  5IP7 I;  2QRC B;  3P5J B;  3PO3 I;  2QEX Z;  3MZK B;  1Q7Y 1;  1W2B Y;  3G71 Z;  3VB9 A;  3CCJ Z;  2VUG A;  2OZK A;  3NH5 A;  1I50 I;  2G2K A;  3S1Q I;  3HOV I;  1PFT A;  3D9X A;  3IF8 A;  4HGZ A;  4QTT A;  5CM2 M;  3G4S 1;  4S1T A;  4DGL A;  2E2I I;  3TE5 B;  1SFO I;  5A2Q f;  5A2Q b;  3MZL B;  1ML8 A;  1N2F A;  2NVQ I;  3PO2 I;  3GTL I;  4AYB A;  2QA4 1;  4HGY A;  3GTO I;  2W03 A;  3CD6 1;  1VQN 1;  1WII A;  4NBG A;  1VQ5 1;  3EED A;  1YJN Z;  1KQS Z;  1VQK 1;  5C3E I;  3GTQ I;  2QR1 B;  2QKD A;  2F4M A;  1X3Z A;  3CCE 1;  3CXC Z;  1K73 2;  2JA6 I;  3FQQ A;  3HKZ A;  3J81 b;  3I56 Z;  1Y1V S;  3CCM 1;  2KPI A;  3JAM b;  3I55 Z;  1VQP 1;  3GTM S;  2QLV B;  1VQO 1;  3S17 I;  3CCJ 1;  1VQL 1;  3CC2 1;  2PM9 A;  4A3D I;  1X3W A;  2B63 I;  2Q4Z A;  1TWC I;  3CMA Z;  4A3G I;  3EER A;  2R6M A;  2YU9 I;  2K3R A;  4Y52 I;  2M48 A;  5C44 I;  3KIH A;  3I4N I;  1WW9 A;  2OOX B;  3CPW Y;  4BY1 I;  5FLX f;  2RPR A;  5FLX b;  2JA5 I;  1YJN 1;  2DE6 A;  4XX2 A;  1S72 Z;  4A3I I;  3HOU I;  3GTG I;  4RVG A;  1QVG Y;  3CQZ I;  3D6W A;  4NBA A;  3FKI I;  1TWF I;  3GTK I;  4MD9 A;  1TWG I;  1Y1W I;  3NFZ A;  3CCQ Z;  2WAQ A;  3CCU Z;  5D1O A;  3S1R I;  1I6H I;  3GTJ I;  3G6E 1;  4BBR I;  3LUS A;  2V8K A;  1Z01 A;  1YUA A;  1Q86 2;  1WCM I;  3M3Y I;  3BG1 B;  3CCV Z;  4X6A I;  2QRD B;  1KC8 2;  1YI2 Z;  1NJI 2;  3ESW A;  5FLM I;  5C4J I;  2JMO A;  1USP B;  3CCS 1;  4A93 I;  2OTJ Z;  3KIF A;  3J80 b;  3CCR Z;  2R7Z I;  4A3F I;  4DK1 A;  5T6B A;  3U50 C;  1VQM Z;  1S72 1;  2OTL Z;  2BJO A;  4BBS I;  1P9N A;  2H85 A;  4Y7N I;  2NVX I;  1S7M A;  1USP A;  3I07 A;  2NVY I;  2GU2 A;  1QF8 A;  1VQ9 1;  3CME Z;  3CCU 1;  3S16 I;  2F4O A;  4BY7 I;  1YJ9 1;  2E2J I;  2J6A A;  4NBF A;  3J81 f;  2GTH A;  4MH4 A;  3JAM f;  4TNU A;  1YIJ Z;  3J7A 4;  1VQ6 Z;  2V8I A;  5IP9 I;  3CCV 1;  1KQS Y;  2QEX 1;  2JA7 I;  1ZB8 A;  2HU9 A;  4E31 A;  3FQM A;  2LFU A;  3G71 1;  4NBC A;  2K5R A;  1R9T I;  3NH8 A;  3CXC Y;  3CC4 Z;  1Y1V I;  1YUK A;  1Q86 1;  1JJ2 Z;  1VQ4 Z;  4MD7 A;  3GCF A;  1KRL A;  3GTM I;  3HOZ I;  4E2X A;  4RVH A;  1KC8 1;  3VTN A;  1ZH1 A;  2IZ4 A;  3CCL Z;  1ZB9 A;  1YHQ Z;  2EGT A;  1NJI 1;  3OW2 Z;  3NH4 A;  4RVD A;  2P28 A;  2IZ3 A;  2O4H A;  2RBL A;  4NFR A;  4QTU A;  1DL6 A;  3IFU A;  3HOX I;  1KD1 1;  3F3F C;  3HOY I;  3CME 1;  1QVF Z;  1N8R 2;  2R93 I;  2PMZ A;  2NVT I;  4E2Y A;  3I56 1;  3IX0 A;  3S14 I;  5IT9 b;  1NUI A;  3I55 1;  1RQF A;  3NDJ A;  4E32 A;  2M6N A;  3CC4 1;  4NB9 A;  5LL6 f;  3CD6 Z;  3HOW I;  1RO2 A;  1X0T A;  1L1O C;  1VQ4 1;  1VQ5 Z;  1Q82 2;  2JA8 I;  1TWA I;  3CMA 1;  1K9M 1;  3PO3 S;  1YJW Z;  1NP6 A;  4A3J I;  3K7A I;  1Z03 A;  2DE5 A;  1I3Q I;  3S1M I;  3T4N B;  4HH4 A;  4E33 A;  3J80 f;  4MRI A;  2JNY A;  2AKL A;  1KD1 2;  4CL1 A;  1VQP Z;  4A3E I;  3S2H I;  1VQ7 Z;  2V8J A;  1M1K 1;  1VQO Z;  4NBE A;  5C4X I;  2W04 A;  1QYP A;  2HF1 A;  1VQL Z;  2KI7 B;  3CC2 Z;  2I3C A;  1TWH I;  3VMH A;  4E2W A;  4A3C I;  4A3K I;  2E9H A;  1JWH C;  1RLY A;  4RV9 A;  3CCQ 1;  1VQ8 Z;  3BG0 B;  4NH1 C;  4RVF A;  3TDH B;  1RO4 A;  5AN9 F;  2DE7 A;  1K83 I;  2RIQ A;  2ZAE B;  1N8R 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...