1YJ9Z

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yj9Z00
1KC81 3I561 1VQ4Z 1M1K2 1YJ91 3CC4Z 3CCJ1 1VQO1 1VQ6Z 3CC7Z 3OW2Y 3CCEZ 1VQNZ 1VQ8Z 1KQSZ 2QEX1 1K9M1 1Q862 3CXCY 2OTLZ 1JJ2Z 3CC2Z 1Q861 1VQ7Z 1QVGZ 1VQM1 1YITZ 3G711 1K732 1YIJ1 3CCMZ 2QA4Z 1KD12 1M1K1 1KD11 3G6EZ 3CMA1 3CD6Z 3CCE1 1VQN1 3CCSZ 1VQ81 3G4SZ 1VQP1 1JJ2Y 3CCLZ 2OTJ1 3CCQZ 3CCUZ 1QVGY 1VQ71 1VQK1 1YHQZ 3CCV1 1YIT1 1Q822 1VQ41 1VQ5Z 1Q821 1W2BZ 1YJNZ 1N8R2 3CMEZ 1N8R1 3CD61 1QVFZ 3CC41 1YI2Z 1K731 3G4S1 1VQ61 3CC71 1YJ9Z 1M902 3CCL1 1M901 3CCJZ 1VQOZ 1KQSY 3I55Z 1YJWZ 1K8A2 1YHQ1 2OTL1 1VQLZ 3CC21 1W2BY 2QEXZ 1Q812 1S72Z 1YJN1 3CME1 3CCRZ 3CXCZ 1YI21 3CCM1 2QA41 1Q7Y2 1Q7Y1 1VQMZ 1VQ9Z 3G6E1 3G71Z 3I56Z 1YIJZ 3CPWZ 3CCS1 3I551 1YJW1 3CMAZ 3CCQ1 3CCU1 1VQL1 1VQPZ 1K9M2 1K8A1 2OTJZ 3OW2Z 1S721 3CCR1 1NJI2 1VQKZ 1NJI1 1VQ51 3CCVZ 1QVFY 1KC82 1Q811 1VQ91 3CPWY
chains in the Genus database with same CATH superfamily
1KC81 2RBLA 1I6HI 3I561 3VMIA 2AYDA 3GTJI 1RLYA 1M1K2 1YJ91 2P3YA 3CC4Z 2OOXB 2GTHA 3CC7Z 2HF1A 1TFIA 1Y1VS 4A3BI 2HU9A 1WIIA 2E7ZA 1Q862 1JWHC 3CC2Z 2QKDA 4HH4A 2R92I 2JS4A 2F4MA 2JIOA 3S2HI 1K83I 2JR6A 4NBAA 2OOYB 3IF8A 1KD12 1QF8A 4E2WA 5CM2M 3CD6Z 1VQN1 4DGLA 1VQ81 5FLMI 3S16I 1VQP1 1FDIA 3CCUZ 2JNYA 3GKQA 2Y0SA 2NAPA 2K5RA 3IX0A 3GTGI 5D1OA 1VQ41 4X6AI 4E32A 2O4HA 5FLXf 2VPYA 3PO3S 5IT9f 1QVFZ 3KIFA 1K731 2V8JA 3ESWA 3G4S1 1VQ61 3D2LA 1YJ9Z 2YU9I 1M902 3CCL1 1KQSY 2JA7I 1YHQ1 1VQLZ 1TWFI 2Q4ZA 4A3MI 3VB9A 1Q812 1S72Z 1YJN1 2BJOA 1ZB8A 3RZOI 3CME1 2PK7A 4NBBA 1YI21 3CCM1 2DE5A 2DE6A 2QA41 1Q7Y2 1SFOI 4A3DI 3BG0B 1RQFA 2R7ZI 3K7AI 2IZ3A 3NDIA 4MRIA 4NBHA 2M6NA 4E2ZA 2VPWA 1VQPZ 4HGZA 5T64A 4A3KI 3OW2Z 1L1OC 4QTUA 1ML8A 1QXFA 4QTTA 1VQ51 3I4MI 5AN9F 1Y8CA 2QRCB 1VQ4Z 3JAMf 2GU2A 2KI7B 1WZNA 3CCJ1 1VQO1 2IV2X 3FKII 1VQ6Z 3OW2Y 3MONA 3NH8A 4NBFA 2AKLA 2KPIA 2QEX1 4E30A 2RIQA 1ZB9A 3CXCY 4MD9A 1JJ2Z 2JA8I 1VQ7Z 5LL6f 5FLXb 1YITZ 1TWHI 2LIYA 1K732 3CCMZ 4MD7A 2QA4Z 2NVXI 3HOYI 3EEDA 3T4NB 3CCE1 1QYPA 1S7MA 2V3VA 2QLVB 3H0GI 3QWUA 3VMGA 1JJ2Y 1TWCI 3M3YI 3S15I 4BY1I 5T67A 3CCV1 1RO4A 1Y1WI 3GTMS 1Q822 1KRLA 1VQ5Z 3J7A4 3BG1B 1N8R1 5C44I 1ZH1A 4NFRA 3J80f 2GTIA 3H3VJ 2E2JI 1FDOA 2V8KA 3PO3I 3CCJZ 1VQOZ 3CQZI 3I55Z 1YJWZ 2Q51A 2M48A 3S1RI 1RO2A 2PMZA 2QRDB 2JUBA 3HOZI 2QEXZ 4RVDA 4NB9A 1Q811 4BBSI 3CCRZ 2JMOA 2PM9A 3JAMb 3I56Z 2JIPA 3CCS1 3PO2I 1Z02A 1VLAA 1Z01A 2R6MA 3CCQ1 2W03A 3KIHA 5C3EI 3NDJA 1K8A1 1YUKA 4E2XA 4DQYB 4Y52I 1Q16A 2VUMI 2NVYI 3D6WA 2I3CA 1NJI1 2QREB 3CCVZ 2H85A 1QVFY 1KC82 1VQ91 4BY7I 2VPZA 4EWCA 4S1TA 3S1MI 3D9XA 3NH5A 3GTLI 1X3WA 1AA6A 1VQNZ 1VQ8Z 1DL6A 3GTOI 2V45A 4NBCA 4XX2A 1K9M1 2LFUA 1Q861 1WW9A 2VPXA 2O53A 4RVFA 2DE7A 4A3II 1QVGZ 4RV9A 4A3EI 1VQM1 3S17I 1P9NA 3Q87A 2LEXA 1PFTA 2E9HA 2EGTA 3HOUI 1KD11 4MXUA 3GTKI 3CCSZ 3G4SZ 4A3CI 4DK1A 3CCLZ 4MH4A 3CCQZ 1Z03A 2JIRA 1QVGY 4NBGA 4MD8A 1VQK1 3NFZA 1YHQZ 3HOWI 2P28A 2WAQA 4CL1A 3S1QI 1YJNZ 1I50I 3CMEZ 5IT9b 3CD61 1YI2Z 3GTMI 2E2II 1NUIA 5A2Qf 4RS4A 2JA6I 3S14I 2J6AA 1M901 2OZKA 4TNUA 2QR1B 1K8A2 4NB8A 2OTL1 4BBRI 5C4JI 3LUSA 1NP6A 2VUGA 5D1OB 1Q7Y1 1VQMZ 3G6E1 5T6BA 4E2YA 5C4XI 4NOZA 3RZDI 4A3FI 5IP9I 3HOVI 1VQL1 4MONA 3GTQI 1WCMI 3J81f 1K9M2 2V8IA 4A3GI 1S721 2YADA 4NH1C 1VQKZ 1USPA 3IFUA 1I3QI 3I4NI 3F3FC 3FQMA 4RVGA 1RO0A 3HKZA 4A93I 3GTPI 3M4OI 1X0TA 2K3RA 3U50C 3CCEZ 1YUAA 3TE5B 1KQSZ 2OTLZ 2NVQI 2JIQA 3G711 2ZAEB 1YIJ1 3S1NI 1M1K1 1N2FA 3G6EZ 3CMA1 5A2Qb 2W04A 1TWGI 1R9TI 2RHBA 4RVHA 2OTJ1 1VQ71 4NBEA 1RNIA 4E33A 2WB1A 1YIT1 3MZKB 3S2DI 3P5JB 3EERA 1LQLA 1Q821 1W2BZ 1N8R2 3GCFA 5IP7I 3CC41 3J80b 2VF1A 3CC71 2E2HI 2G2KA 3MZLB 5D1PA 4NBDA 3J81b 3CC21 2JIMA 1WJ2A 1W2BY 2IZ4A 3IR7A 4HGYA 3VMHA 3CXCZ 2NVTI 4A3JI 1VQ9Z 3G71Z 1X3ZA 1YIJZ 4E31A 3CPWZ 3I551 1YJW1 3VTNA 2F4OA 3CMAZ 3I07A 2JA5I 3NH4A 4A3LI 3CCU1 4Y7NI 4BXXI 3HOXI 2R93I 1SIWA 2B63I 2OTJZ 2RPRA 3CCR1 3F3PC 1NJI2 1USPB 4AYBA 3FQQA 1Y1VI 1TWAI 3TDHB 2RT9A 3CPWY
chains in the Genus database with same CATH topology
1KC81 2RBLA 1I6HI 3I561 3VMIA 3GTJI 1RLYA 1M1K2 1YJ91 2P3YA 3CC4Z 2OOXB 2GTHA 3CC7Z 2HF1A 1TFIA 1Y1VS 4A3BI 2HU9A 1WIIA 1Q862 1JWHC 3CC2Z 2QKDA 4HH4A 2R92I 2JS4A 2F4MA 3S2HI 1K83I 2JR6A 4NBAA 2OOYB 3IF8A 1KD12 1QF8A 4E2WA 5CM2M 3CD6Z 1VQN1 4DGLA 1VQ81 5FLMI 3S16I 1VQP1 3CCUZ 2JNYA 3GKQA 2Y0SA 2K5RA 3IX0A 3GTGI 5D1OA 1VQ41 4X6AI 4E32A 2O4HA 5FLXf 3PO3S 5IT9f 1QVFZ 3KIFA 1K731 2V8JA 3ESWA 3G4S1 1VQ61 1YJ9Z 2YU9I 1M902 3CCL1 1KQSY 2JA7I 1YHQ1 1VQLZ 1TWFI 2Q4ZA 4A3MI 3VB9A 1Q812 1S72Z 1YJN1 2BJOA 1ZB8A 3RZOI 3CME1 2PK7A 4NBBA 1YI21 3CCM1 2DE5A 2DE6A 2QA41 1Q7Y2 1SFOI 4A3DI 3BG0B 1RQFA 2R7ZI 3K7AI 2IZ3A 3NDIA 4MRIA 4NBHA 2M6NA 4E2ZA 1VQPZ 4HGZA 5T64A 4A3KI 3OW2Z 1L1OC 1ML8A 4QTTA 4QTUA 1VQ51 3I4MI 5AN9F 2QRCB 1VQ4Z 3JAMf 2GU2A 2KI7B 3CCJ1 1VQO1 3FKII 1VQ6Z 3OW2Y 3MONA 3NH8A 4NBFA 2AKLA 2KPIA 2QEX1 4E30A 2RIQA 1ZB9A 3CXCY 4MD9A 1JJ2Z 2JA8I 1VQ7Z 5LL6f 5FLXb 1YITZ 1TWHI 2LIYA 1K732 3CCMZ 4MD7A 2QA4Z 2NVXI 3HOYI 3EEDA 3T4NB 3CCE1 1QYPA 1S7MA 2QLVB 3H0GI 3QWUA 3VMGA 1JJ2Y 1TWCI 3M3YI 3S15I 4BY1I 5T67A 3CCV1 1RO4A 1Y1WI 3GTMS 1Q822 1KRLA 1VQ5Z 3J7A4 3BG1B 1N8R1 5C44I 1ZH1A 4NFRA 3J80f 2GTIA 3H3VJ 2E2JI 2V8KA 3PO3I 3CCJZ 1VQOZ 3CQZI 3I55Z 1YJWZ 2Q51A 2M48A 3S1RI 1RO2A 2PMZA 2QRDB 2JUBA 3HOZI 2QEXZ 4RVDA 4NB9A 1Q811 4BBSI 3CCRZ 2JMOA 2PM9A 3JAMb 3I56Z 3CCS1 3PO2I 1Z02A 1VLAA 1Z01A 2R6MA 3CCQ1 2W03A 3KIHA 5C3EI 3NDJA 1K8A1 1YUKA 4E2XA 4DQYB 4Y52I 2VUMI 2NVYI 3D6WA 2I3CA 1NJI1 2QREB 3CCVZ 2H85A 1QVFY 1KC82 1VQ91 4BY7I 4EWCA 4S1TA 3S1MI 3D9XA 3NH5A 3GTLI 1X3WA 1VQNZ 1VQ8Z 1DL6A 3GTOI 4NBCA 4XX2A 1K9M1 2LFUA 1Q861 1WW9A 2O53A 4RVFA 2DE7A 4A3II 1QVGZ 4RV9A 4A3EI 1VQM1 3S17I 1P9NA 3Q87A 1PFTA 2E9HA 2EGTA 3HOUI 1KD11 4MXUA 3GTKI 3CCSZ 3G4SZ 4A3CI 4DK1A 3CCLZ 4MH4A 3CCQZ 1Z03A 1QVGY 4NBGA 4MD8A 1VQK1 3NFZA 1YHQZ 3HOWI 2P28A 2WAQA 4CL1A 3S1QI 1YJNZ 1I50I 3CMEZ 5IT9b 3CD61 1YI2Z 3GTMI 2E2II 1NUIA 5A2Qf 4RS4A 2JA6I 3S14I 2J6AA 1M901 2OZKA 4TNUA 2QR1B 1K8A2 4NB8A 2OTL1 4BBRI 5C4JI 3LUSA 1NP6A 2VUGA 5D1OB 1Q7Y1 1VQMZ 3G6E1 5T6BA 4E2YA 5C4XI 4NOZA 3RZDI 4A3FI 5IP9I 3HOVI 1VQL1 4MONA 3GTQI 1WCMI 3J81f 1K9M2 2V8IA 4A3GI 1S721 2YADA 4NH1C 1VQKZ 1USPA 3IFUA 1I3QI 3I4NI 3F3FC 3FQMA 4RVGA 1RO0A 3HKZA 4A93I 3GTPI 3M4OI 1X0TA 2K3RA 3U50C 3CCEZ 1YUAA 3TE5B 1KQSZ 2OTLZ 2NVQI 3G711 2ZAEB 1YIJ1 3S1NI 1M1K1 1N2FA 3G6EZ 3CMA1 5A2Qb 2W04A 1TWGI 1R9TI 2RHBA 4RVHA 2OTJ1 1VQ71 4NBEA 1RNIA 4E33A 2WB1A 1YIT1 3MZKB 3S2DI 3P5JB 3EERA 1LQLA 1Q821 1W2BZ 1N8R2 3GCFA 5IP7I 3CC41 3J80b 2VF1A 3CC71 2E2HI 2G2KA 3MZLB 5D1PA 4NBDA 3J81b 3CC21 1W2BY 2IZ4A 4HGYA 3VMHA 3CXCZ 2NVTI 4A3JI 1VQ9Z 3G71Z 1X3ZA 1YIJZ 4E31A 3CPWZ 3I551 1YJW1 3VTNA 2F4OA 3CMAZ 3I07A 2JA5I 3NH4A 4A3LI 3CCU1 4Y7NI 4BXXI 3HOXI 2R93I 2B63I 2OTJZ 2RPRA 3CCR1 3F3PC 1NJI2 1USPB 4AYBA 3FQQA 1Y1VI 1TWAI 3TDHB 2RT9A 3CPWY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 1;  3I56 1;  1VQ4 Z;  1M1K 2;  1YJ9 1;  3CC4 Z;  3CCJ 1;  1VQO 1;  1VQ6 Z;  3CC7 Z;  3OW2 Y;  3CCE Z;  1VQN Z;  1VQ8 Z;  1KQS Z;  2QEX 1;  1K9M 1;  1Q86 2;  3CXC Y;  2OTL Z;  1JJ2 Z;  3CC2 Z;  1Q86 1;  1VQ7 Z;  1QVG Z;  1VQM 1;  1YIT Z;  3G71 1;  1K73 2;  1YIJ 1;  3CCM Z;  2QA4 Z;  1KD1 2;  1M1K 1;  1KD1 1;  3G6E Z;  3CMA 1;  3CD6 Z;  3CCE 1;  1VQN 1;  3CCS Z;  1VQ8 1;  3G4S Z;  1VQP 1;  1JJ2 Y;  3CCL Z;  2OTJ 1;  3CCQ Z;  3CCU Z;  1QVG Y;  1VQ7 1;  1VQK 1;  1YHQ Z;  3CCV 1;  1YIT 1;  1Q82 2;  1VQ4 1;  1VQ5 Z;  1Q82 1;  1W2B Z;  1YJN Z;  1N8R 2;  3CME Z;  1N8R 1;  3CD6 1;  1QVF Z;  3CC4 1;  1YI2 Z;  1K73 1;  3G4S 1;  1VQ6 1;  3CC7 1;  1YJ9 Z;  1M90 2;  3CCL 1;  1M90 1;  3CCJ Z;  1VQO Z;  1KQS Y;  3I55 Z;  1YJW Z;  1K8A 2;  1YHQ 1;  2OTL 1;  1VQL Z;  3CC2 1;  1W2B Y;  2QEX Z;  1Q81 2;  1S72 Z;  1YJN 1;  3CME 1;  3CCR Z;  3CXC Z;  1YI2 1;  3CCM 1;  2QA4 1;  1Q7Y 2;  1Q7Y 1;  1VQM Z;  1VQ9 Z;  3G6E 1;  3G71 Z;  3I56 Z;  1YIJ Z;  3CPW Z;  3CCS 1;  3I55 1;  1YJW 1;  3CMA Z;  3CCQ 1;  3CCU 1;  1VQL 1;  1VQP Z;  1K9M 2;  1K8A 1;  2OTJ Z;  3OW2 Z;  1S72 1;  3CCR 1;  1NJI 2;  1VQK Z;  1NJI 1;  1VQ5 1;  3CCV Z;  1QVF Y;  1KC8 2;  1Q81 1;  1VQ9 1;  3CPW Y; 
#chains in the Genus database with same CATH topology
 1KC8 1;  2RBL A;  1I6H I;  3I56 1;  3VMI A;  2AYD A;  3GTJ I;  1RLY A;  1M1K 2;  1YJ9 1;  2P3Y A;  3CC4 Z;  2OOX B;  2GTH A;  3CC7 Z;  2HF1 A;  1TFI A;  1Y1V S;  4A3B I;  2HU9 A;  1WII A;  2E7Z A;  1Q86 2;  1JWH C;  3CC2 Z;  2QKD A;  4HH4 A;  2R92 I;  2JS4 A;  2F4M A;  2JIO A;  3S2H I;  1K83 I;  2JR6 A;  4NBA A;  2OOY B;  3IF8 A;  1KD1 2;  1QF8 A;  4E2W A;  5CM2 M;  3CD6 Z;  1VQN 1;  4DGL A;  1VQ8 1;  5FLM I;  3S16 I;  1VQP 1;  1FDI A;  3CCU Z;  2JNY A;  3GKQ A;  2Y0S A;  2NAP A;  2K5R A;  3IX0 A;  3GTG I;  5D1O A;  1VQ4 1;  4X6A I;  4E32 A;  2O4H A;  5FLX f;  2VPY A;  3PO3 S;  5IT9 f;  1QVF Z;  3KIF A;  1K73 1;  2V8J A;  3ESW A;  3G4S 1;  1VQ6 1;  3D2L A;  1YJ9 Z;  2YU9 I;  1M90 2;  3CCL 1;  1KQS Y;  2JA7 I;  1YHQ 1;  1VQL Z;  1TWF I;  2Q4Z A;  4A3M I;  3VB9 A;  1Q81 2;  1S72 Z;  1YJN 1;  2BJO A;  1ZB8 A;  3RZO I;  3CME 1;  2PK7 A;  4NBB A;  1YI2 1;  3CCM 1;  2DE5 A;  2DE6 A;  2QA4 1;  1Q7Y 2;  1SFO I;  4A3D I;  3BG0 B;  1RQF A;  2R7Z I;  3K7A I;  2IZ3 A;  3NDI A;  4MRI A;  4NBH A;  2M6N A;  4E2Z A;  2VPW A;  1VQP Z;  4HGZ A;  5T64 A;  4A3K I;  3OW2 Z;  1L1O C;  4QTU A;  1ML8 A;  1QXF A;  4QTT A;  1VQ5 1;  3I4M I;  5AN9 F;  1Y8C A;  2QRC B;  1VQ4 Z;  3JAM f;  2GU2 A;  2KI7 B;  1WZN A;  3CCJ 1;  1VQO 1;  2IV2 X;  3FKI I;  1VQ6 Z;  3OW2 Y;  3MON A;  3NH8 A;  4NBF A;  2AKL A;  2KPI A;  2QEX 1;  4E30 A;  2RIQ A;  1ZB9 A;  3CXC Y;  4MD9 A;  1JJ2 Z;  2JA8 I;  1VQ7 Z;  5LL6 f;  5FLX b;  1YIT Z;  1TWH I;  2LIY A;  1K73 2;  3CCM Z;  4MD7 A;  2QA4 Z;  2NVX I;  3HOY I;  3EED A;  3T4N B;  3CCE 1;  1QYP A;  1S7M A;  2V3V A;  2QLV B;  3H0G I;  3QWU A;  3VMG A;  1JJ2 Y;  1TWC I;  3M3Y I;  3S15 I;  4BY1 I;  5T67 A;  3CCV 1;  1RO4 A;  1Y1W I;  3GTM S;  1Q82 2;  1KRL A;  1VQ5 Z;  3J7A 4;  3BG1 B;  1N8R 1;  5C44 I;  1ZH1 A;  4NFR A;  3J80 f;  2GTI A;  3H3V J;  2E2J I;  1FDO A;  2V8K A;  3PO3 I;  3CCJ Z;  1VQO Z;  3CQZ I;  3I55 Z;  1YJW Z;  2Q51 A;  2M48 A;  3S1R I;  1RO2 A;  2PMZ A;  2QRD B;  2JUB A;  3HOZ I;  2QEX Z;  4RVD A;  4NB9 A;  1Q81 1;  4BBS I;  3CCR Z;  2JMO A;  2PM9 A;  3JAM b;  3I56 Z;  2JIP A;  3CCS 1;  3PO2 I;  1Z02 A;  1VLA A;  1Z01 A;  2R6M A;  3CCQ 1;  2W03 A;  3KIH A;  5C3E I;  3NDJ A;  1K8A 1;  1YUK A;  4E2X A;  4DQY B;  4Y52 I;  1Q16 A;  2VUM I;  2NVY I;  3D6W A;  2I3C A;  1NJI 1;  2QRE B;  3CCV Z;  2H85 A;  1QVF Y;  1KC8 2;  1VQ9 1;  4BY7 I;  2VPZ A;  4EWC A;  4S1T A;  3S1M I;  3D9X A;  3NH5 A;  3GTL I;  1X3W A;  1AA6 A;  1VQN Z;  1VQ8 Z;  1DL6 A;  3GTO I;  2V45 A;  4NBC A;  4XX2 A;  1K9M 1;  2LFU A;  1Q86 1;  1WW9 A;  2VPX A;  2O53 A;  4RVF A;  2DE7 A;  4A3I I;  1QVG Z;  4RV9 A;  4A3E I;  1VQM 1;  3S17 I;  1P9N A;  3Q87 A;  2LEX A;  1PFT A;  2E9H A;  2EGT A;  3HOU I;  1KD1 1;  4MXU A;  3GTK I;  3CCS Z;  3G4S Z;  4A3C I;  4DK1 A;  3CCL Z;  4MH4 A;  3CCQ Z;  1Z03 A;  2JIR A;  1QVG Y;  4NBG A;  4MD8 A;  1VQK 1;  3NFZ A;  1YHQ Z;  3HOW I;  2P28 A;  2WAQ A;  4CL1 A;  3S1Q I;  1YJN Z;  1I50 I;  3CME Z;  5IT9 b;  3CD6 1;  1YI2 Z;  3GTM I;  2E2I I;  1NUI A;  5A2Q f;  4RS4 A;  2JA6 I;  3S14 I;  2J6A A;  1M90 1;  2OZK A;  4TNU A;  2QR1 B;  1K8A 2;  4NB8 A;  2OTL 1;  4BBR I;  5C4J I;  3LUS A;  1NP6 A;  2VUG A;  5D1O B;  1Q7Y 1;  1VQM Z;  3G6E 1;  5T6B A;  4E2Y A;  5C4X I;  4NOZ A;  3RZD I;  4A3F I;  5IP9 I;  3HOV I;  1VQL 1;  4MON A;  3GTQ I;  1WCM I;  3J81 f;  1K9M 2;  2V8I A;  4A3G I;  1S72 1;  2YAD A;  4NH1 C;  1VQK Z;  1USP A;  3IFU A;  1I3Q I;  3I4N I;  3F3F C;  3FQM A;  4RVG A;  1RO0 A;  3HKZ A;  4A93 I;  3GTP I;  3M4O I;  1X0T A;  2K3R A;  3U50 C;  3CCE Z;  1YUA A;  3TE5 B;  1KQS Z;  2OTL Z;  2NVQ I;  2JIQ A;  3G71 1;  2ZAE B;  1YIJ 1;  3S1N I;  1M1K 1;  1N2F A;  3G6E Z;  3CMA 1;  5A2Q b;  2W04 A;  1TWG I;  1R9T I;  2RHB A;  4RVH A;  2OTJ 1;  1VQ7 1;  4NBE A;  1RNI A;  4E33 A;  2WB1 A;  1YIT 1;  3MZK B;  3S2D I;  3P5J B;  3EER A;  1LQL A;  1Q82 1;  1W2B Z;  1N8R 2;  3GCF A;  5IP7 I;  3CC4 1;  3J80 b;  2VF1 A;  3CC7 1;  2E2H I;  2G2K A;  3MZL B;  5D1P A;  4NBD A;  3J81 b;  3CC2 1;  2JIM A;  1WJ2 A;  1W2B Y;  2IZ4 A;  3IR7 A;  4HGY A;  3VMH A;  3CXC Z;  2NVT I;  4A3J I;  1VQ9 Z;  3G71 Z;  1X3Z A;  1YIJ Z;  4E31 A;  3CPW Z;  3I55 1;  1YJW 1;  3VTN A;  2F4O A;  3CMA Z;  3I07 A;  2JA5 I;  3NH4 A;  4A3L I;  3CCU 1;  4Y7N I;  4BXX I;  3HOX I;  2R93 I;  1SIW A;  2B63 I;  2OTJ Z;  2RPR A;  3CCR 1;  3F3P C;  1NJI 2;  1USP B;  4AYB A;  3FQQ A;  1Y1V I;  1TWA I;  3TDH B;  2RT9 A;  3CPW Y; 
#chains in the Genus database with same CATH homology
 1KC8 1;  2RBL A;  1I6H I;  3I56 1;  3VMI A;  3GTJ I;  1RLY A;  1M1K 2;  1YJ9 1;  2P3Y A;  3CC4 Z;  2OOX B;  2GTH A;  3CC7 Z;  2HF1 A;  1TFI A;  1Y1V S;  4A3B I;  2HU9 A;  1WII A;  1Q86 2;  1JWH C;  3CC2 Z;  2QKD A;  4HH4 A;  2R92 I;  2JS4 A;  2F4M A;  3S2H I;  1K83 I;  2JR6 A;  4NBA A;  2OOY B;  3IF8 A;  1KD1 2;  1QF8 A;  4E2W A;  5CM2 M;  3CD6 Z;  1VQN 1;  4DGL A;  1VQ8 1;  5FLM I;  3S16 I;  1VQP 1;  3CCU Z;  2JNY A;  3GKQ A;  2Y0S A;  2K5R A;  3IX0 A;  3GTG I;  5D1O A;  1VQ4 1;  4X6A I;  4E32 A;  2O4H A;  5FLX f;  3PO3 S;  5IT9 f;  1QVF Z;  3KIF A;  1K73 1;  2V8J A;  3ESW A;  3G4S 1;  1VQ6 1;  1YJ9 Z;  2YU9 I;  1M90 2;  3CCL 1;  1KQS Y;  2JA7 I;  1YHQ 1;  1VQL Z;  1TWF I;  2Q4Z A;  4A3M I;  3VB9 A;  1Q81 2;  1S72 Z;  1YJN 1;  2BJO A;  1ZB8 A;  3RZO I;  3CME 1;  2PK7 A;  4NBB A;  1YI2 1;  3CCM 1;  2DE5 A;  2DE6 A;  2QA4 1;  1Q7Y 2;  1SFO I;  4A3D I;  3BG0 B;  1RQF A;  2R7Z I;  3K7A I;  2IZ3 A;  3NDI A;  4MRI A;  4NBH A;  2M6N A;  4E2Z A;  1VQP Z;  4HGZ A;  5T64 A;  4A3K I;  3OW2 Z;  1L1O C;  1ML8 A;  4QTT A;  4QTU A;  1VQ5 1;  3I4M I;  5AN9 F;  2QRC B;  1VQ4 Z;  3JAM f;  2GU2 A;  2KI7 B;  3CCJ 1;  1VQO 1;  3FKI I;  1VQ6 Z;  3OW2 Y;  3MON A;  3NH8 A;  4NBF A;  2AKL A;  2KPI A;  2QEX 1;  4E30 A;  2RIQ A;  1ZB9 A;  3CXC Y;  4MD9 A;  1JJ2 Z;  2JA8 I;  1VQ7 Z;  5LL6 f;  5FLX b;  1YIT Z;  1TWH I;  2LIY A;  1K73 2;  3CCM Z;  4MD7 A;  2QA4 Z;  2NVX I;  3HOY I;  3EED A;  3T4N B;  3CCE 1;  1QYP A;  1S7M A;  2QLV B;  3H0G I;  3QWU A;  3VMG A;  1JJ2 Y;  1TWC I;  3M3Y I;  3S15 I;  4BY1 I;  5T67 A;  3CCV 1;  1RO4 A;  1Y1W I;  3GTM S;  1Q82 2;  1KRL A;  1VQ5 Z;  3J7A 4;  3BG1 B;  1N8R 1;  5C44 I;  1ZH1 A;  4NFR A;  3J80 f;  2GTI A;  3H3V J;  2E2J I;  2V8K A;  3PO3 I;  3CCJ Z;  1VQO Z;  3CQZ I;  3I55 Z;  1YJW Z;  2Q51 A;  2M48 A;  3S1R I;  1RO2 A;  2PMZ A;  2QRD B;  2JUB A;  3HOZ I;  2QEX Z;  4RVD A;  4NB9 A;  1Q81 1;  4BBS I;  3CCR Z;  2JMO A;  2PM9 A;  3JAM b;  3I56 Z;  3CCS 1;  3PO2 I;  1Z02 A;  1VLA A;  1Z01 A;  2R6M A;  3CCQ 1;  2W03 A;  3KIH A;  5C3E I;  3NDJ A;  1K8A 1;  1YUK A;  4E2X A;  4DQY B;  4Y52 I;  2VUM I;  2NVY I;  3D6W A;  2I3C A;  1NJI 1;  2QRE B;  3CCV Z;  2H85 A;  1QVF Y;  1KC8 2;  1VQ9 1;  4BY7 I;  4EWC A;  4S1T A;  3S1M I;  3D9X A;  3NH5 A;  3GTL I;  1X3W A;  1VQN Z;  1VQ8 Z;  1DL6 A;  3GTO I;  4NBC A;  4XX2 A;  1K9M 1;  2LFU A;  1Q86 1;  1WW9 A;  2O53 A;  4RVF A;  2DE7 A;  4A3I I;  1QVG Z;  4RV9 A;  4A3E I;  1VQM 1;  3S17 I;  1P9N A;  3Q87 A;  1PFT A;  2E9H A;  2EGT A;  3HOU I;  1KD1 1;  4MXU A;  3GTK I;  3CCS Z;  3G4S Z;  4A3C I;  4DK1 A;  3CCL Z;  4MH4 A;  3CCQ Z;  1Z03 A;  1QVG Y;  4NBG A;  4MD8 A;  1VQK 1;  3NFZ A;  1YHQ Z;  3HOW I;  2P28 A;  2WAQ A;  4CL1 A;  3S1Q I;  1YJN Z;  1I50 I;  3CME Z;  5IT9 b;  3CD6 1;  1YI2 Z;  3GTM I;  2E2I I;  1NUI A;  5A2Q f;  4RS4 A;  2JA6 I;  3S14 I;  2J6A A;  1M90 1;  2OZK A;  4TNU A;  2QR1 B;  1K8A 2;  4NB8 A;  2OTL 1;  4BBR I;  5C4J I;  3LUS A;  1NP6 A;  2VUG A;  5D1O B;  1Q7Y 1;  1VQM Z;  3G6E 1;  5T6B A;  4E2Y A;  5C4X I;  4NOZ A;  3RZD I;  4A3F I;  5IP9 I;  3HOV I;  1VQL 1;  4MON A;  3GTQ I;  1WCM I;  3J81 f;  1K9M 2;  2V8I A;  4A3G I;  1S72 1;  2YAD A;  4NH1 C;  1VQK Z;  1USP A;  3IFU A;  1I3Q I;  3I4N I;  3F3F C;  3FQM A;  4RVG A;  1RO0 A;  3HKZ A;  4A93 I;  3GTP I;  3M4O I;  1X0T A;  2K3R A;  3U50 C;  3CCE Z;  1YUA A;  3TE5 B;  1KQS Z;  2OTL Z;  2NVQ I;  3G71 1;  2ZAE B;  1YIJ 1;  3S1N I;  1M1K 1;  1N2F A;  3G6E Z;  3CMA 1;  5A2Q b;  2W04 A;  1TWG I;  1R9T I;  2RHB A;  4RVH A;  2OTJ 1;  1VQ7 1;  4NBE A;  1RNI A;  4E33 A;  2WB1 A;  1YIT 1;  3MZK B;  3S2D I;  3P5J B;  3EER A;  1LQL A;  1Q82 1;  1W2B Z;  1N8R 2;  3GCF A;  5IP7 I;  3CC4 1;  3J80 b;  2VF1 A;  3CC7 1;  2E2H I;  2G2K A;  3MZL B;  5D1P A;  4NBD A;  3J81 b;  3CC2 1;  1W2B Y;  2IZ4 A;  4HGY A;  3VMH A;  3CXC Z;  2NVT I;  4A3J I;  1VQ9 Z;  3G71 Z;  1X3Z A;  1YIJ Z;  4E31 A;  3CPW Z;  3I55 1;  1YJW 1;  3VTN A;  2F4O A;  3CMA Z;  3I07 A;  2JA5 I;  3NH4 A;  4A3L I;  3CCU 1;  4Y7N I;  4BXX I;  3HOX I;  2R93 I;  2B63 I;  2OTJ Z;  2RPR A;  3CCR 1;  3F3P C;  1NJI 2;  1USP B;  4AYB A;  3FQQ A;  1Y1V I;  1TWA I;  3TDH B;  2RT9 A;  3CPW Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...