3S1NI

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1nI02
3VMGA 2JS4A 2P3YA 2DE7A 1TWHI 3RZDI 3HOWI 3S1NI 1N2FA 1K83I 3U50C 4MH4A 3HOZI 3VMHA 4A3DI 4NBBA 3GTQI 3GTMI 1TFIA 5FLMI 1X3ZA 2E2HI 5IP9I 3GTKI 3GTGI 3S1RI 3S17I 2NVXI 2VUMI 2JA8I 3ESWA 3FKII 2E2JI 2JR6A 1R9TI 3GTJI 3M4OI 3Q87A 4NOZA 4NBDA 3GTPI 1PFTA 1NUIA 1YUAA 2K5RA 1ML8A 3EERA 4QTTA 3HOVI 3VMIA 2JA6I 3I4NI 1TWGI 4BBRI 4A3CI 3H0GI 1Y1VS 3S2HI 2R92I 3PO2I 1WW9A 2F4OA 4A3II 4BBSI 1SFOI 2DE6A 5CM2M 5C4JI 2HF1A 3GCFA 4A3JI 1Y1VI 4XX2A 2YU9I 2PK7A 3S2DI 2J6AA 3PO3I 3K7AI 1QYPA 2B63I 3M3YI 1USPA 1VLAA 4A3LI 4A3KI 3RZOI 4A3MI 3S16I 2JA5I 1RO4A 1TWAI 3S14I 2NVYI 4NBAA 1L1OC 2KPIA 3D6WA 1Y1WI 1WCMI 4Y7NI 1I50I 3H3VJ 1DL6A 2JA7I 4A3GI 1USPB 3CQZI 1I3QI 3LUSA 3GTMS 2RBLA 3GTLI 4A93I 3I4MI 4NB8A 4BY7I 4BXXI 4NBGA 3S15I 3GTOI 3S1MI 1ZB9A 2JNYA 2R93I 2DE5A 1TWFI 3PO3S 1LQLA 4X6AI 4QTUA 3S1QI 5C3EI 2NVQI 4A3BI 3I07A 2E2II 1TWCI 2BJOA 3VB9A 2AKLA 4NB9A 5C44I 1X3WA 5IP7I 5C4XI 4NBFA 3HOYI 4NBCA 1I6HI 4Y52I 4BY1I 3HOUI 4A3FI 1ZB8A 1RLYA 4A3EI 3HOXI 4NBEA 3GKQA 4NBHA 2R7ZI 2NVTI 2F4MA
chains in the Genus database with same CATH superfamily
2QRDB 1P9NA 2HU9A 4MD9A 2JS4A 4E2YA 1K8A2 3CCS1 5D1PA 1K83I 2W04A 3CXCZ 3GTQI 1TFIA 3CC7Z 1VQ7Z 3IFUA 3S1RI 3KIFA 2NVXI 1YJN1 1VQ9Z 3CCQZ 2JA8I 4MRIA 5IT9f 2JR6A 1R9TI 2P28A 2JIRA 5T64A 1QVGZ 4NOZA 1QXFA 3D9XA 3CCMZ 5D1OB 1NUIA 2K5RA 4QTTA 3NDJA 2I3CA 1Q7Y2 4MD8A 3I55Z 4HH4A 3CCRZ 2G2KA 1NJI2 1ZH1A 3G71Z 1S7MA 4BBSI 3TDHB 4A3JI 3CC4Z 1VQ91 3IR7A 1YUKA 1WZNA 2YU9I 2OTJ1 1VQPZ 1VQM1 1YJNZ 3S2DI 3K7AI 2JUBA 2RHBA 3MZLB 3IX0A 3CCEZ 3G4SZ 2IZ4A 1RO4A 1QVGY 3CC21 1FDOA 1RO2A 3CD6Z 2YADA 1USPB 1KRLA 1I3QI 2M48A 1Q821 4A93I 1N8R1 2DE5A 1TWFI 4RVDA 1LQLA 2WB1A 1K732 3S1QI 2NVQI 1N8R2 3J80f 3G6EZ 3I561 3I07A 1TWCI 2OTJZ 2RIQA 4E2ZA 1JWHC 1YITZ 3CC41 3HKZA 3HOYI 2H85A 4HGZA 1YI2Z 1RLYA 2V8IA 1VQOZ 2PM9A 2QRCB 1K9M1 1RO0A 3CCVZ 3VMGA 2JIQA 1TWHI 2GU2A 2LIYA 1Z01A 3J81b 4MH4A 1Q822 2GTHA 3VTNA 1YHQ1 3VMHA 5FLMI 5IP9I 3MONA 3OW2Z 1KD12 1VQ8Z 1VQ81 2OTLZ 5T6BA 1VQ4Z 3GTPI 1Y8CA 4E32A 1YHQZ 1TWGI 3D2LA 4BBRI 2OOYB 4A3CI 2IV2X 3H0GI 5FLXf 1WW9A 3OW2Y 2EGTA 4A3II 1NJI1 3G6E1 2DE6A 5CM2M 3GCFA 2OZKA 4XX2A 2PK7A 2NAPA 3EEDA 4NH1C 2PMZA 2B63I 3M3YI 1VLAA 1Q861 3RZOI 1VQLZ 2JA5I 2GTIA 1TWAI 3S14I 1WIIA 1JJ2Z 1L1OC 3D6WA 1WCMI 4Y7NI 3H3VJ 1M902 3LUSA 4RV9A 2RPRA 3GTLI 3I4MI 1FDIA 4E2WA 2QR1B 3S15I 2V8KA 3GTOI 3S1MI 2ZAEB 2JNYA 2R93I 1VQP1 4DGLA 4X6AI 3VB9A 1Q812 3CCV1 3CCR1 3I551 1X3WA 2IZ3A 5A2Qf 5IP7I 5C4XI 1YI21 4Y52I 4A3FI 4S1TA 4A3EI 3CCE1 1YIJZ 4MXUA 2O4HA 1Q862 1AA6A 4A3LI 1Z02A 2P3YA 1JJ2Y 1VQK1 2VPZA 5A2Qb 3S1NI 1K9M2 3CCUZ 3U50C 3MZKB 2E9HA 3HOZI 4EWCA 2E7ZA 1VQ51 3TE5B 4A3DI 4NBBA 3JAMf 3J81f 1M901 3GTMI 1KQSZ 4E31A 3CD61 3S17I 3P5JB 2VUMI 2RT9A 1KQSY 4HGYA 3GTJI 1S72Z 3CC2Z 3Q87A 1VQN1 3G4S1 2V8JA 1KD11 3I56Z 4E33A 3EERA 3VMIA 2JA6I 3JAMb 4RS4A 3I4NI 1SIWA 1M1K1 3F3PC 3NH8A 1Y1VS 2R92I 5IT9b 2HF1A 4TNUA 3CMA1 2J6AA 1KC81 3PO3I 2V45A 3BG0B 1YJW1 1QYPA 3J7A4 1USPA 1X0TA 3CCJ1 1VQ5Z 3CCM1 2KI7B 3NH5A 4DK1A 4A3MI 3S16I 3CCU1 2Q51A 3QWUA 4MD7A 2NVYI 3BG1B 4NBAA 1Y1WI 1QF8A 1VQMZ 1DL6A 2JA7I 1VQKZ 4A3GI 3CMEZ 1M1K2 1YJ9Z 3CC71 3GTMS 1W2BZ 4BY7I 4BXXI 4NBGA 2V3VA 1ZB9A 1K731 3PO3S 4QTUA 4DQYB 3CCSZ 2E2II 2BJOA 5FLXb 3IF8A 2JIPA 5D1OA 3F3FC 2AKLA 4NB9A 3NH4A 4NBCA 1WJ2A 4BY1I 1QVFY 3HOUI 1ZB8A 1VQ71 2W03A 4NBHA 2R7ZI 2LEXA 2LFUA 2JIOA 3NDIA 1VQNZ 2DE7A 2VPXA 4AYBA 3RZDI 3HOWI 3T4NB 1N2FA 1VQL1 2Q4ZA 4RVHA 2QLVB 1VQ6Z 2Y0SA 4E2XA 1X3ZA 2E2HI 3GTKI 3GTGI 2QEX1 1Q7Y1 4E30A 3CXCY 1YIT1 3ESWA 3FKII 2E2JI 3M4OI 1QVFZ 3FQMA 4NBDA 1PFTA 1YUAA 5T67A 1ML8A 1NP6A 1KC82 3HOVI 1RNIA 1YIJ1 2K3RA 1VQ41 3S2HI 2QREB 3CCL1 3PO2I 2F4OA 1W2BY 2OTL1 1SFOI 2QA4Z 2VPYA 5C4JI 3CCLZ 2M6NA 1Y1VI 2OOXB 2QKDA 3CPWZ 3FQQA 2JMOA 4A3KI 4RVFA 2O53A 3CME1 3NFZA 2VUGA 2KPIA 1I50I 2WAQA 3G711 2QEXZ 3CQZI 2JIMA 2VF1A 2R6MA 2QA41 3CCJZ 2RBLA 4NFRA 1Z03A 4NB8A 3KIHA 5LL6f 1VQO1 3J80b 3CMAZ 2AYDA 1K8A1 5C3EI 4A3BI 4MONA 1YJ91 3CCQ1 5C44I 4NBFA 1I6HI 3CPWY 1RQFA 1Q16A 3HOXI 2VPWA 4NBEA 3GKQA 4RVGA 5AN9F 1Q811 4CL1A 2NVTI 1VQ61 1S721 2F4MA 1YJWZ
chains in the Genus database with same CATH topology
2QRDB 1P9NA 2HU9A 4MD9A 2JS4A 4E2YA 1K8A2 3CCS1 5D1PA 1K83I 2W04A 3CXCZ 3GTQI 1TFIA 3CC7Z 1VQ7Z 3IFUA 3S1RI 3KIFA 2NVXI 1YJN1 1VQ9Z 3CCQZ 2JA8I 4MRIA 5IT9f 2JR6A 1R9TI 2P28A 5T64A 1QVGZ 4NOZA 3D9XA 3CCMZ 5D1OB 1NUIA 2K5RA 4QTTA 3NDJA 2I3CA 1Q7Y2 4MD8A 3I55Z 4HH4A 3CCRZ 2G2KA 1NJI2 1ZH1A 3G71Z 1S7MA 4BBSI 3TDHB 4A3JI 3CC4Z 1VQ91 1YUKA 2YU9I 2OTJ1 1VQPZ 1VQM1 1YJNZ 3S2DI 3K7AI 2JUBA 2RHBA 3MZLB 3IX0A 3CCEZ 3G4SZ 2IZ4A 1RO4A 1QVGY 3CC21 1RO2A 3CD6Z 2YADA 1USPB 1KRLA 1I3QI 2M48A 1Q821 4A93I 1N8R1 2DE5A 1TWFI 4RVDA 1LQLA 2WB1A 1K732 3S1QI 2NVQI 1N8R2 3J80f 3G6EZ 3I561 3I07A 1TWCI 2OTJZ 2RIQA 4E2ZA 1JWHC 1YITZ 3CC41 3HKZA 3HOYI 2H85A 4HGZA 1YI2Z 1RLYA 2V8IA 1VQOZ 2PM9A 2QRCB 1K9M1 1RO0A 3CCVZ 3VMGA 1TWHI 2GU2A 2LIYA 1Z01A 3J81b 4MH4A 1Q822 2GTHA 3VTNA 1YHQ1 3VMHA 5FLMI 5IP9I 3MONA 3OW2Z 1KD12 1VQ8Z 1VQ81 2OTLZ 5T6BA 1VQ4Z 3GTPI 4E32A 1YHQZ 1TWGI 4BBRI 2OOYB 4A3CI 3H0GI 5FLXf 1WW9A 3OW2Y 2EGTA 4A3II 1NJI1 3G6E1 2DE6A 5CM2M 3GCFA 2OZKA 4XX2A 2PK7A 3EEDA 4NH1C 2PMZA 2B63I 3M3YI 1VLAA 1Q861 3RZOI 1VQLZ 2JA5I 2GTIA 1TWAI 3S14I 1WIIA 1JJ2Z 1L1OC 3D6WA 1WCMI 4Y7NI 3H3VJ 1M902 3LUSA 4RV9A 2RPRA 3GTLI 3I4MI 4E2WA 2QR1B 3S15I 2V8KA 3GTOI 3S1MI 2ZAEB 2JNYA 2R93I 1VQP1 4DGLA 4X6AI 3VB9A 1Q812 3CCV1 3CCR1 3I551 1X3WA 2IZ3A 5A2Qf 5IP7I 5C4XI 1YI21 4Y52I 4A3FI 4S1TA 4A3EI 3CCE1 1YIJZ 4MXUA 2O4HA 1Q862 4A3LI 1Z02A 2P3YA 1JJ2Y 1VQK1 5A2Qb 3S1NI 1K9M2 3CCUZ 3U50C 3MZKB 2E9HA 3HOZI 4EWCA 1VQ51 4A3DI 3TE5B 4NBBA 3JAMf 3J81f 1M901 3GTMI 1KQSZ 4E31A 3CD61 3S17I 3P5JB 2VUMI 2RT9A 1KQSY 4HGYA 3GTJI 1S72Z 3CC2Z 3Q87A 1VQN1 3G4S1 2V8JA 1KD11 3I56Z 4E33A 3EERA 3VMIA 2JA6I 3JAMb 4RS4A 3I4NI 1M1K1 3F3PC 3NH8A 1Y1VS 2R92I 5IT9b 2HF1A 4TNUA 3CMA1 2J6AA 1KC81 3PO3I 3BG0B 1YJW1 1QYPA 3J7A4 1USPA 1X0TA 3CCJ1 1VQ5Z 3CCM1 2KI7B 3NH5A 4DK1A 4A3MI 3S16I 3CCU1 2Q51A 3QWUA 4MD7A 2NVYI 3BG1B 4NBAA 1Y1WI 1QF8A 1VQMZ 1DL6A 2JA7I 1VQKZ 4A3GI 3CMEZ 1M1K2 1YJ9Z 3CC71 3GTMS 1W2BZ 4BY7I 4BXXI 4NBGA 1ZB9A 1K731 3PO3S 4QTUA 4DQYB 3CCSZ 2E2II 2BJOA 5FLXb 3IF8A 5D1OA 3F3FC 2AKLA 4NB9A 3NH4A 4NBCA 4BY1I 1QVFY 3HOUI 1ZB8A 1VQ71 2W03A 4NBHA 2R7ZI 2LFUA 3NDIA 1VQNZ 2DE7A 4AYBA 3RZDI 3HOWI 3T4NB 1N2FA 1VQL1 2Q4ZA 4RVHA 2QLVB 1VQ6Z 2Y0SA 4E2XA 1X3ZA 2E2HI 3GTKI 3GTGI 2QEX1 1Q7Y1 4E30A 3CXCY 1YIT1 3ESWA 3FKII 2E2JI 3M4OI 1QVFZ 3FQMA 4NBDA 1PFTA 1YUAA 5T67A 1ML8A 1NP6A 1KC82 3HOVI 1RNIA 1YIJ1 2K3RA 1VQ41 3S2HI 2QREB 3CCL1 3PO2I 2F4OA 1W2BY 2OTL1 1SFOI 2QA4Z 5C4JI 3CCLZ 2M6NA 1Y1VI 2OOXB 2QKDA 3CPWZ 3FQQA 2JMOA 4A3KI 4RVFA 2O53A 3CME1 3NFZA 2VUGA 2KPIA 1I50I 2WAQA 3G711 2QEXZ 3CQZI 2VF1A 2R6MA 2QA41 3CCJZ 2RBLA 4NFRA 1Z03A 4NB8A 3KIHA 5LL6f 1VQO1 3J80b 3CMAZ 1K8A1 5C3EI 4A3BI 4MONA 1YJ91 3CCQ1 5C44I 4NBFA 1I6HI 3CPWY 1RQFA 3HOXI 4NBEA 4RVGA 3GKQA 5AN9F 1Q811 4CL1A 2NVTI 1VQ61 1S721 2F4MA 1YJWZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMG A;  2JS4 A;  2P3Y A;  2DE7 A;  1TWH I;  3RZD I;  3HOW I;  3S1N I;  1N2F A;  1K83 I;  3U50 C;  4MH4 A;  3HOZ I;  3VMH A;  4A3D I;  4NBB A;  3GTQ I;  3GTM I;  1TFI A;  5FLM I;  1X3Z A;  2E2H I;  5IP9 I;  3GTK I;  3GTG I;  3S1R I;  3S17 I;  2NVX I;  2VUM I;  2JA8 I;  3ESW A;  3FKI I;  2E2J I;  2JR6 A;  1R9T I;  3GTJ I;  3M4O I;  3Q87 A;  4NOZ A;  4NBD A;  3GTP I;  1PFT A;  1NUI A;  1YUA A;  2K5R A;  1ML8 A;  3EER A;  4QTT A;  3HOV I;  3VMI A;  2JA6 I;  3I4N I;  1TWG I;  4BBR I;  4A3C I;  3H0G I;  1Y1V S;  3S2H I;  2R92 I;  3PO2 I;  1WW9 A;  2F4O A;  4A3I I;  4BBS I;  1SFO I;  2DE6 A;  5CM2 M;  5C4J I;  2HF1 A;  3GCF A;  4A3J I;  1Y1V I;  4XX2 A;  2YU9 I;  2PK7 A;  3S2D I;  2J6A A;  3PO3 I;  3K7A I;  1QYP A;  2B63 I;  3M3Y I;  1USP A;  1VLA A;  4A3L I;  4A3K I;  3RZO I;  4A3M I;  3S16 I;  2JA5 I;  1RO4 A;  1TWA I;  3S14 I;  2NVY I;  4NBA A;  1L1O C;  2KPI A;  3D6W A;  1Y1W I;  1WCM I;  4Y7N I;  1I50 I;  3H3V J;  1DL6 A;  2JA7 I;  4A3G I;  1USP B;  3CQZ I;  1I3Q I;  3LUS A;  3GTM S;  2RBL A;  3GTL I;  4A93 I;  3I4M I;  4NB8 A;  4BY7 I;  4BXX I;  4NBG A;  3S15 I;  3GTO I;  3S1M I;  1ZB9 A;  2JNY A;  2R93 I;  2DE5 A;  1TWF I;  3PO3 S;  1LQL A;  4X6A I;  4QTU A;  3S1Q I;  5C3E I;  2NVQ I;  4A3B I;  3I07 A;  2E2I I;  1TWC I;  2BJO A;  3VB9 A;  2AKL A;  4NB9 A;  5C44 I;  1X3W A;  5IP7 I;  5C4X I;  4NBF A;  3HOY I;  4NBC A;  1I6H I;  4Y52 I;  4BY1 I;  3HOU I;  4A3F I;  1ZB8 A;  1RLY A;  4A3E I;  3HOX I;  4NBE A;  3GKQ A;  4NBH A;  2R7Z I;  2NVT I;  2F4M A; 
#chains in the Genus database with same CATH topology
 2QRD B;  1P9N A;  2HU9 A;  4MD9 A;  2JS4 A;  4E2Y A;  1K8A 2;  3CCS 1;  5D1P A;  1K83 I;  2W04 A;  3CXC Z;  3GTQ I;  1TFI A;  3CC7 Z;  1VQ7 Z;  3IFU A;  3S1R I;  3KIF A;  2NVX I;  1YJN 1;  1VQ9 Z;  3CCQ Z;  2JA8 I;  4MRI A;  5IT9 f;  2JR6 A;  1R9T I;  2P28 A;  2JIR A;  5T64 A;  1QVG Z;  4NOZ A;  1QXF A;  3D9X A;  3CCM Z;  5D1O B;  1NUI A;  2K5R A;  4QTT A;  3NDJ A;  2I3C A;  1Q7Y 2;  4MD8 A;  3I55 Z;  4HH4 A;  3CCR Z;  2G2K A;  1NJI 2;  1ZH1 A;  3G71 Z;  1S7M A;  4BBS I;  3TDH B;  4A3J I;  3CC4 Z;  1VQ9 1;  3IR7 A;  1YUK A;  1WZN A;  2YU9 I;  2OTJ 1;  1VQP Z;  1VQM 1;  1YJN Z;  3S2D I;  3K7A I;  2JUB A;  2RHB A;  3MZL B;  3IX0 A;  3CCE Z;  3G4S Z;  2IZ4 A;  1RO4 A;  1QVG Y;  3CC2 1;  1FDO A;  1RO2 A;  3CD6 Z;  2YAD A;  1USP B;  1KRL A;  1I3Q I;  2M48 A;  1Q82 1;  4A93 I;  1N8R 1;  2DE5 A;  1TWF I;  4RVD A;  1LQL A;  2WB1 A;  1K73 2;  3S1Q I;  2NVQ I;  1N8R 2;  3J80 f;  3G6E Z;  3I56 1;  3I07 A;  1TWC I;  2OTJ Z;  2RIQ A;  4E2Z A;  1JWH C;  1YIT Z;  3CC4 1;  3HKZ A;  3HOY I;  2H85 A;  4HGZ A;  1YI2 Z;  1RLY A;  2V8I A;  1VQO Z;  2PM9 A;  2QRC B;  1K9M 1;  1RO0 A;  3CCV Z;  3VMG A;  2JIQ A;  1TWH I;  2GU2 A;  2LIY A;  1Z01 A;  3J81 b;  4MH4 A;  1Q82 2;  2GTH A;  3VTN A;  1YHQ 1;  3VMH A;  5FLM I;  5IP9 I;  3MON A;  3OW2 Z;  1KD1 2;  1VQ8 Z;  1VQ8 1;  2OTL Z;  5T6B A;  1VQ4 Z;  3GTP I;  1Y8C A;  4E32 A;  1YHQ Z;  1TWG I;  3D2L A;  4BBR I;  2OOY B;  4A3C I;  2IV2 X;  3H0G I;  5FLX f;  1WW9 A;  3OW2 Y;  2EGT A;  4A3I I;  1NJI 1;  3G6E 1;  2DE6 A;  5CM2 M;  3GCF A;  2OZK A;  4XX2 A;  2PK7 A;  2NAP A;  3EED A;  4NH1 C;  2PMZ A;  2B63 I;  3M3Y I;  1VLA A;  1Q86 1;  3RZO I;  1VQL Z;  2JA5 I;  2GTI A;  1TWA I;  3S14 I;  1WII A;  1JJ2 Z;  1L1O C;  3D6W A;  1WCM I;  4Y7N I;  3H3V J;  1M90 2;  3LUS A;  4RV9 A;  2RPR A;  3GTL I;  3I4M I;  1FDI A;  4E2W A;  2QR1 B;  3S15 I;  2V8K A;  3GTO I;  3S1M I;  2ZAE B;  2JNY A;  2R93 I;  1VQP 1;  4DGL A;  4X6A I;  3VB9 A;  1Q81 2;  3CCV 1;  3CCR 1;  3I55 1;  1X3W A;  2IZ3 A;  5A2Q f;  5IP7 I;  5C4X I;  1YI2 1;  4Y52 I;  4A3F I;  4S1T A;  4A3E I;  3CCE 1;  1YIJ Z;  4MXU A;  2O4H A;  1Q86 2;  1AA6 A;  4A3L I;  1Z02 A;  2P3Y A;  1JJ2 Y;  1VQK 1;  2VPZ A;  5A2Q b;  3S1N I;  1K9M 2;  3CCU Z;  3U50 C;  3MZK B;  2E9H A;  3HOZ I;  4EWC A;  2E7Z A;  1VQ5 1;  3TE5 B;  4A3D I;  4NBB A;  3JAM f;  3J81 f;  1M90 1;  3GTM I;  1KQS Z;  4E31 A;  3CD6 1;  3S17 I;  3P5J B;  2VUM I;  2RT9 A;  1KQS Y;  4HGY A;  3GTJ I;  1S72 Z;  3CC2 Z;  3Q87 A;  1VQN 1;  3G4S 1;  2V8J A;  1KD1 1;  3I56 Z;  4E33 A;  3EER A;  3VMI A;  2JA6 I;  3JAM b;  4RS4 A;  3I4N I;  1SIW A;  1M1K 1;  3F3P C;  3NH8 A;  1Y1V S;  2R92 I;  5IT9 b;  2HF1 A;  4TNU A;  3CMA 1;  2J6A A;  1KC8 1;  3PO3 I;  2V45 A;  3BG0 B;  1YJW 1;  1QYP A;  3J7A 4;  1USP A;  1X0T A;  3CCJ 1;  1VQ5 Z;  3CCM 1;  2KI7 B;  3NH5 A;  4DK1 A;  4A3M I;  3S16 I;  3CCU 1;  2Q51 A;  3QWU A;  4MD7 A;  2NVY I;  3BG1 B;  4NBA A;  1Y1W I;  1QF8 A;  1VQM Z;  1DL6 A;  2JA7 I;  1VQK Z;  4A3G I;  3CME Z;  1M1K 2;  1YJ9 Z;  3CC7 1;  3GTM S;  1W2B Z;  4BY7 I;  4BXX I;  4NBG A;  2V3V A;  1ZB9 A;  1K73 1;  3PO3 S;  4QTU A;  4DQY B;  3CCS Z;  2E2I I;  2BJO A;  5FLX b;  3IF8 A;  2JIP A;  5D1O A;  3F3F C;  2AKL A;  4NB9 A;  3NH4 A;  4NBC A;  1WJ2 A;  4BY1 I;  1QVF Y;  3HOU I;  1ZB8 A;  1VQ7 1;  2W03 A;  4NBH A;  2R7Z I;  2LEX A;  2LFU A;  2JIO A;  3NDI A;  1VQN Z;  2DE7 A;  2VPX A;  4AYB A;  3RZD I;  3HOW I;  3T4N B;  1N2F A;  1VQL 1;  2Q4Z A;  4RVH A;  2QLV B;  1VQ6 Z;  2Y0S A;  4E2X A;  1X3Z A;  2E2H I;  3GTK I;  3GTG I;  2QEX 1;  1Q7Y 1;  4E30 A;  3CXC Y;  1YIT 1;  3ESW A;  3FKI I;  2E2J I;  3M4O I;  1QVF Z;  3FQM A;  4NBD A;  1PFT A;  1YUA A;  5T67 A;  1ML8 A;  1NP6 A;  1KC8 2;  3HOV I;  1RNI A;  1YIJ 1;  2K3R A;  1VQ4 1;  3S2H I;  2QRE B;  3CCL 1;  3PO2 I;  2F4O A;  1W2B Y;  2OTL 1;  1SFO I;  2QA4 Z;  2VPY A;  5C4J I;  3CCL Z;  2M6N A;  1Y1V I;  2OOX B;  2QKD A;  3CPW Z;  3FQQ A;  2JMO A;  4A3K I;  4RVF A;  2O53 A;  3CME 1;  3NFZ A;  2VUG A;  2KPI A;  1I50 I;  2WAQ A;  3G71 1;  2QEX Z;  3CQZ I;  2JIM A;  2VF1 A;  2R6M A;  2QA4 1;  3CCJ Z;  2RBL A;  4NFR A;  1Z03 A;  4NB8 A;  3KIH A;  5LL6 f;  1VQO 1;  3J80 b;  3CMA Z;  2AYD A;  1K8A 1;  5C3E I;  4A3B I;  4MON A;  1YJ9 1;  3CCQ 1;  5C44 I;  4NBF A;  1I6H I;  3CPW Y;  1RQF A;  1Q16 A;  3HOX I;  2VPW A;  4NBE A;  3GKQ A;  4RVG A;  5AN9 F;  1Q81 1;  4CL1 A;  2NVT I;  1VQ6 1;  1S72 1;  2F4M A;  1YJW Z; 
#chains in the Genus database with same CATH homology
 2QRD B;  1P9N A;  2HU9 A;  4MD9 A;  2JS4 A;  4E2Y A;  1K8A 2;  3CCS 1;  5D1P A;  1K83 I;  2W04 A;  3CXC Z;  3GTQ I;  1TFI A;  3CC7 Z;  1VQ7 Z;  3IFU A;  3S1R I;  3KIF A;  2NVX I;  1YJN 1;  1VQ9 Z;  3CCQ Z;  2JA8 I;  4MRI A;  5IT9 f;  2JR6 A;  1R9T I;  2P28 A;  5T64 A;  1QVG Z;  4NOZ A;  3D9X A;  3CCM Z;  5D1O B;  1NUI A;  2K5R A;  4QTT A;  3NDJ A;  2I3C A;  1Q7Y 2;  4MD8 A;  3I55 Z;  4HH4 A;  3CCR Z;  2G2K A;  1NJI 2;  1ZH1 A;  3G71 Z;  1S7M A;  4BBS I;  3TDH B;  4A3J I;  3CC4 Z;  1VQ9 1;  1YUK A;  2YU9 I;  2OTJ 1;  1VQP Z;  1VQM 1;  1YJN Z;  3S2D I;  3K7A I;  2JUB A;  2RHB A;  3MZL B;  3IX0 A;  3CCE Z;  3G4S Z;  2IZ4 A;  1RO4 A;  1QVG Y;  3CC2 1;  1RO2 A;  3CD6 Z;  2YAD A;  1USP B;  1KRL A;  1I3Q I;  2M48 A;  1Q82 1;  4A93 I;  1N8R 1;  2DE5 A;  1TWF I;  4RVD A;  1LQL A;  2WB1 A;  1K73 2;  3S1Q I;  2NVQ I;  1N8R 2;  3J80 f;  3G6E Z;  3I56 1;  3I07 A;  1TWC I;  2OTJ Z;  2RIQ A;  4E2Z A;  1JWH C;  1YIT Z;  3CC4 1;  3HKZ A;  3HOY I;  2H85 A;  4HGZ A;  1YI2 Z;  1RLY A;  2V8I A;  1VQO Z;  2PM9 A;  2QRC B;  1K9M 1;  1RO0 A;  3CCV Z;  3VMG A;  1TWH I;  2GU2 A;  2LIY A;  1Z01 A;  3J81 b;  4MH4 A;  1Q82 2;  2GTH A;  3VTN A;  1YHQ 1;  3VMH A;  5FLM I;  5IP9 I;  3MON A;  3OW2 Z;  1KD1 2;  1VQ8 Z;  1VQ8 1;  2OTL Z;  5T6B A;  1VQ4 Z;  3GTP I;  4E32 A;  1YHQ Z;  1TWG I;  4BBR I;  2OOY B;  4A3C I;  3H0G I;  5FLX f;  1WW9 A;  3OW2 Y;  2EGT A;  4A3I I;  1NJI 1;  3G6E 1;  2DE6 A;  5CM2 M;  3GCF A;  2OZK A;  4XX2 A;  2PK7 A;  3EED A;  4NH1 C;  2PMZ A;  2B63 I;  3M3Y I;  1VLA A;  1Q86 1;  3RZO I;  1VQL Z;  2JA5 I;  2GTI A;  1TWA I;  3S14 I;  1WII A;  1JJ2 Z;  1L1O C;  3D6W A;  1WCM I;  4Y7N I;  3H3V J;  1M90 2;  3LUS A;  4RV9 A;  2RPR A;  3GTL I;  3I4M I;  4E2W A;  2QR1 B;  3S15 I;  2V8K A;  3GTO I;  3S1M I;  2ZAE B;  2JNY A;  2R93 I;  1VQP 1;  4DGL A;  4X6A I;  3VB9 A;  1Q81 2;  3CCV 1;  3CCR 1;  3I55 1;  1X3W A;  2IZ3 A;  5A2Q f;  5IP7 I;  5C4X I;  1YI2 1;  4Y52 I;  4A3F I;  4S1T A;  4A3E I;  3CCE 1;  1YIJ Z;  4MXU A;  2O4H A;  1Q86 2;  4A3L I;  1Z02 A;  2P3Y A;  1JJ2 Y;  1VQK 1;  5A2Q b;  3S1N I;  1K9M 2;  3CCU Z;  3U50 C;  3MZK B;  2E9H A;  3HOZ I;  4EWC A;  1VQ5 1;  4A3D I;  3TE5 B;  4NBB A;  3JAM f;  3J81 f;  1M90 1;  3GTM I;  1KQS Z;  4E31 A;  3CD6 1;  3S17 I;  3P5J B;  2VUM I;  2RT9 A;  1KQS Y;  4HGY A;  3GTJ I;  1S72 Z;  3CC2 Z;  3Q87 A;  1VQN 1;  3G4S 1;  2V8J A;  1KD1 1;  3I56 Z;  4E33 A;  3EER A;  3VMI A;  2JA6 I;  3JAM b;  4RS4 A;  3I4N I;  1M1K 1;  3F3P C;  3NH8 A;  1Y1V S;  2R92 I;  5IT9 b;  2HF1 A;  4TNU A;  3CMA 1;  2J6A A;  1KC8 1;  3PO3 I;  3BG0 B;  1YJW 1;  1QYP A;  3J7A 4;  1USP A;  1X0T A;  3CCJ 1;  1VQ5 Z;  3CCM 1;  2KI7 B;  3NH5 A;  4DK1 A;  4A3M I;  3S16 I;  3CCU 1;  2Q51 A;  3QWU A;  4MD7 A;  2NVY I;  3BG1 B;  4NBA A;  1Y1W I;  1QF8 A;  1VQM Z;  1DL6 A;  2JA7 I;  1VQK Z;  4A3G I;  3CME Z;  1M1K 2;  1YJ9 Z;  3CC7 1;  3GTM S;  1W2B Z;  4BY7 I;  4BXX I;  4NBG A;  1ZB9 A;  1K73 1;  3PO3 S;  4QTU A;  4DQY B;  3CCS Z;  2E2I I;  2BJO A;  5FLX b;  3IF8 A;  5D1O A;  3F3F C;  2AKL A;  4NB9 A;  3NH4 A;  4NBC A;  4BY1 I;  1QVF Y;  3HOU I;  1ZB8 A;  1VQ7 1;  2W03 A;  4NBH A;  2R7Z I;  2LFU A;  3NDI A;  1VQN Z;  2DE7 A;  4AYB A;  3RZD I;  3HOW I;  3T4N B;  1N2F A;  1VQL 1;  2Q4Z A;  4RVH A;  2QLV B;  1VQ6 Z;  2Y0S A;  4E2X A;  1X3Z A;  2E2H I;  3GTK I;  3GTG I;  2QEX 1;  1Q7Y 1;  4E30 A;  3CXC Y;  1YIT 1;  3ESW A;  3FKI I;  2E2J I;  3M4O I;  1QVF Z;  3FQM A;  4NBD A;  1PFT A;  1YUA A;  5T67 A;  1ML8 A;  1NP6 A;  1KC8 2;  3HOV I;  1RNI A;  1YIJ 1;  2K3R A;  1VQ4 1;  3S2H I;  2QRE B;  3CCL 1;  3PO2 I;  2F4O A;  1W2B Y;  2OTL 1;  1SFO I;  2QA4 Z;  5C4J I;  3CCL Z;  2M6N A;  1Y1V I;  2OOX B;  2QKD A;  3CPW Z;  3FQQ A;  2JMO A;  4A3K I;  4RVF A;  2O53 A;  3CME 1;  3NFZ A;  2VUG A;  2KPI A;  1I50 I;  2WAQ A;  3G71 1;  2QEX Z;  3CQZ I;  2VF1 A;  2R6M A;  2QA4 1;  3CCJ Z;  2RBL A;  4NFR A;  1Z03 A;  4NB8 A;  3KIH A;  5LL6 f;  1VQO 1;  3J80 b;  3CMA Z;  1K8A 1;  5C3E I;  4A3B I;  4MON A;  1YJ9 1;  3CCQ 1;  5C44 I;  4NBF A;  1I6H I;  3CPW Y;  1RQF A;  3HOX I;  4NBE A;  4RVG A;  3GKQ A;  5AN9 F;  1Q81 1;  4CL1 A;  2NVT I;  1VQ6 1;  1S72 1;  2F4M A;  1YJW Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...