3S1NI

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1nI02
3HOZI 2JA6I 3GTPI 2NVXI 3VMGA 5FLMI 2BJOA 4NOZA 4NB8A 3S1RI 3HOYI 1Y1WI 1TFIA 1R9TI 4A3FI 3VMHA 4BBSI 5C4JI 1X3WA 2R93I 2P3YA 2JNYA 3S2DI 3GTQI 2HF1A 4XX2A 1TWFI 3I4MI 1WCMI 1SFOI 3ESWA 3M3YI 2JR6A 3I4NI 2F4MA 1X3ZA 2RBLA 5CM2M 3S15I 4X6AI 1Y1VI 4Y7NI 3LUSA 4A3MI 4BXXI 5IP7I 3GTKI 2R7ZI 2YU9I 2F4OA 2E2JI 2JS4A 3H3VJ 3PO3I 1USPA 2VUMI 1TWGI 3K7AI 2J6AA 1L1OC 2B63I 2KPIA 3GCFA 4NB9A 1PFTA 3M4OI 5IP9I 3I07A 1USPB 3GTOI 3RZOI 3GTGI 4NBGA 4BY7I 2E2HI 4NBEA 4NBAA 4A3BI 1ML8A 1I3QI 4A3LI 3PO2I 3U50C 2AKLA 1VLAA 4QTUA 2K5RA 3D6WA 3HOVI 4NBBA 3RZDI 3Q87A 4NBHA 1Y1VS 1TWAI 4A93I 1RO4A 2E2II 1TWCI 5C44I 1LQLA 1TWHI 2NVTI 1DL6A 3S14I 3HOWI 3GTMI 4Y52I 3PO3S 2NVYI 4MH4A 1I6HI 3GTMS 1K83I 1NUIA 1WW9A 1ZB8A 2DE5A 3S1NI 2JA8I 4BBRI 2DE7A 2PK7A 3S1QI 2JA5I 5C4XI 3HOXI 5C3EI 4A3CI 4A3KI 3HOUI 3GTJI 1YUAA 4QTTA 1I50I 1N2FA 3GKQA 1ZB9A 4NBFA 4BY1I 4A3II 3S16I 3S1MI 1RLYA 3GTLI 3S2HI 1QYPA 2NVQI 3S17I 2DE6A 3EERA 3FKII 4NBDA 3VB9A 3VMIA 2R92I 4A3GI 4A3DI 4A3EI 2JA7I 4NBCA 4A3JI 3H0GI 3CQZI
chains in the Genus database with same CATH superfamily
3NDJA 3CCR1 2NVXI 3GTPI 3MZLB 1N8R2 4HGZA 1KD11 3S1RI 4BBSI 2P3YA 1VQ71 4XX2A 3I4MI 1WCMI 1Q7Y1 1Q862 3ESWA 1Q861 3I4NI 2RBLA 1S72Z 3S15I 4X6AI 2VUGA 5A2Qf 3CC2Z 5T6BA 3CC21 1VQNZ 1YIJ1 2KPIA 1PFTA 2O53A 2JIPA 3GTOI 2W03A 3GTGI 3CCE1 2Q51A 4NBEA 1AA6A 4NBAA 1ML8A 4HGYA 3PO2I 2K5RA 2RT9A 3D6WA 1FDOA 1YJN1 1QXFA 2R6MA 1Q812 4A93I 2E2II 3CCQZ 3EEDA 5C44I 2GU2A 3BG0B 1DL6A 3T4NB 3GTMI 1I6HI 2K3RA 1NUIA 1Z02A 1VQ61 3CD6Z 2OTJZ 3S1NI 2JA8I 2OTJ1 2DE7A 2VPXA 3F3PC 1RNIA 1QVFY 3HOXI 1RQFA 2QR1B 1I50I 3G711 1WZNA 3GKQA 5LL6f 2G2KA 4BY1I 2WB1A 2QRDB 2OOXB 1VQ41 2V8JA 1QYPA 2JMOA 2E9HA 3S17I 1YITZ 2DE6A 3EERA 3VB9A 3VMIA 4E33A 1YIT1 4A3DI 1P9NA 3IR7A 4A3JI 4RVGA 1VQMZ 1K8A1 3CCS1 2BJOA 2LFUA 3IFUA 3J81b 2OTL1 1M1K2 1VQ5Z 4DGLA 4A3FI 3VMHA 1QVGY 2JIOA 2R93I 2JNYA 5FLXf 2OOYB 1KC81 3CC4Z 4MD9A 2PM9A 3CC41 3CCV1 3M3YI 2M48A 1YHQZ 3KIHA 1KD12 5IP7I 1VQ9Z 2R7ZI 2VPZA 2F4OA 2E2JI 1RO2A 3H3VJ 1USPA 2OZKA 3IX0A 1Q7Y2 1QVFZ 2B63I 3CCMZ 3CXCY 3CCM1 1USPB 4RVHA 3MZKB 3CCUZ 4BY7I 3CCU1 2E2HI 4CL1A 4A3LI 3U50C 2AKLA 1S721 3CMEZ 4RVDA 1Y1VS 3CME1 1TWAI 1RO4A 4AYBA 1TWCI 3JAMb 2RPRA 4EWCA 3J80f 1JJ2Y 5IT9b 1VQN1 2NVYI 4RV9A 4E31A 1WW9A 1ZB8A 2YADA 1Z03A 2JA5I 1VQLZ 5T64A 4A3KI 3HOUI 4QTTA 1QVGZ 1K9M1 2KI7B 1YUKA 1ZB9A 3P5JB 2JIQA 2Y0SA 3S16I 2GTIA 3CCQ1 2RIQA 1KQSY 2Q4ZA 1Q821 3FKII 4A3GI 4A3EI 3CD61 4NBCA 4NH1C 1FDIA 4MXUA 3HOZI 2JA6I 3VMGA 1YI2Z 5FLMI 1YI21 4TNUA 4HH4A 4NB8A 2QREB 1KRLA 2E7ZA 3CXCZ 3F3FC 3S2DI 3GTQI 2HF1A 1TWFI 1WIIA 1SFOI 4MD8A 5D1OA 2JR6A 3I56Z 1X3ZA 1K8A2 4E30A 5D1OB 1Y1VI 2P28A 4Y7NI 3LUSA 1VQM1 1JJ2Z 4A3MI 4RS4A 4BXXI 3GTKI 1VQOZ 1Y8CA 2V8KA 4S1TA 3CCJZ 3CC7Z 1VQ51 2VF1A 3K7AI 2ZAEB 4MRIA 3IF8A 3CMAZ 3CCJ1 3CC71 1W2BY 1KC82 4DQYB 4NB9A 3M4OI 3I07A 4NBGA 3JAMf 3NDIA 5IT9f 1SIWA 3TDHB 3NH5A 4QTUA 1VLAA 1YHQ1 3HOVI 4NBBA 3RZDI 1Q16A 4NBHA 2QKDA 1VQKZ 1X0TA 1KQSZ 3NH4A 1LQLA 3CPWY 1TWHI 1VQ91 2NVTI 1VQPZ 1NJI2 1ZH1A 1VQP1 3D9XA 3PO3S 4MH4A 1NJI1 1VQ8Z 3GTMS 1K83I 2JIMA 2I3CA 3G4SZ 1M901 5D1PA 3S1QI 2IV2X 2LEXA 5C4XI 1Z01A 4A3CI 4DK1A 1YUAA 2NAPA 1N2FA 3MONA 4NBFA 5AN9F 1N8R1 1YJ9Z 3FQMA 1YJ91 2W04A 4A3II 1VQ7Z 3G6EZ 1RLYA 4NFRA 3G6E1 3S2HI 2NVQI 4E2YA 3HKZA 1RO0A 3NH8A 1K732 2R92I 3TE5B 2JA7I 1K731 1K9M2 5T67A 2RHBA 5FLXb 2IZ3A 1VQL1 2V8IA 2QRCB 1S7MA 1W2BZ 3KIFA 4NOZA 3HOYI 4E2ZA 1Y1WI 1TFIA 1R9TI 2JUBA 3BG1B 5C4JI 1YIJZ 1X3WA 4E2XA 4MD7A 2V3VA 1Q822 2AYDA 2WAQA 3CCEZ 3J81f 2F4MA 2IZ4A 2V45A 5CM2M 3I55Z 3I551 3CPWZ 1YJNZ 3OW2Z 4E2WA 2VPWA 1Q811 2YU9I 3NFZA 2JS4A 3PO3I 4MONA 2VUMI 1TWGI 1VQ6Z 2J6AA 1L1OC 3GCFA 5IP9I 5A2Qb 3RZOI 3J80b 1WJ2A 4A3BI 3QWUA 1I3QI 3G71Z 2QEXZ 1JWHC 3I561 3CCLZ 2QEX1 1YJWZ 1QF8A 3CCL1 3Q87A 1YJW1 1VQ4Z 3FQQA 3VTNA 1VQO1 3S14I 3J7A4 2VPYA 3HOWI 2O4HA 2GTHA 4Y52I 2H85A 3CMA1 2QA4Z 2DE5A 2QA41 4BBRI 2HU9A 2PMZA 2PK7A 1NP6A 5C3EI 3CCSZ 3GTJI 2M6NA 2OTLZ 4E32A 1VQK1 1M1K1 3S1MI 2EGTA 3GTLI 3OW2Y 3CCVZ 2LIYA 1M902 4NBDA 3D2LA 1VQ81 2QLVB 3G4S1 3H0GI 3CQZI 2JIRA 4RVFA 3CCRZ
chains in the Genus database with same CATH topology
3NDJA 3CCR1 2NVXI 3GTPI 3MZLB 1N8R2 4HGZA 1KD11 3S1RI 4BBSI 2P3YA 1VQ71 4XX2A 3I4MI 1WCMI 1Q7Y1 1Q862 3ESWA 1Q861 3I4NI 2RBLA 1S72Z 3S15I 4X6AI 2VUGA 5A2Qf 3CC2Z 5T6BA 3CC21 1VQNZ 1YIJ1 2KPIA 1PFTA 2O53A 3GTOI 2W03A 3GTGI 3CCE1 2Q51A 4NBEA 4NBAA 1ML8A 4HGYA 3PO2I 2K5RA 2RT9A 3D6WA 1YJN1 4A93I 2R6MA 1Q812 2E2II 3CCQZ 3EEDA 5C44I 2GU2A 3BG0B 1DL6A 3T4NB 3GTMI 1I6HI 2K3RA 1NUIA 1Z02A 1VQ61 3CD6Z 2OTJZ 3S1NI 2JA8I 2OTJ1 2DE7A 3F3PC 1RNIA 1QVFY 3HOXI 1RQFA 2QR1B 1I50I 3G711 3GKQA 5LL6f 2G2KA 4BY1I 2WB1A 2QRDB 2OOXB 1VQ41 2V8JA 1QYPA 2JMOA 2E9HA 3S17I 1YITZ 2DE6A 3EERA 3VB9A 3VMIA 4E33A 1YIT1 4A3DI 1P9NA 4A3JI 4RVGA 1VQMZ 1K8A1 3CCS1 2BJOA 2LFUA 3IFUA 3J81b 2OTL1 1M1K2 1VQ5Z 4DGLA 4A3FI 3VMHA 1QVGY 2R93I 2JNYA 5FLXf 2OOYB 1KC81 3CC4Z 4MD9A 2PM9A 3CC41 3CCV1 3M3YI 2M48A 1YHQZ 3KIHA 1KD12 5IP7I 1VQ9Z 2R7ZI 2F4OA 2E2JI 1RO2A 3H3VJ 1USPA 2OZKA 3IX0A 1Q7Y2 1QVFZ 2B63I 3CCMZ 3CXCY 3CCM1 1USPB 4RVHA 3MZKB 3CCUZ 4BY7I 3CCU1 2E2HI 4CL1A 4A3LI 3U50C 2AKLA 1S721 3CMEZ 4RVDA 1Y1VS 3CME1 1TWAI 1RO4A 4AYBA 1TWCI 3JAMb 2RPRA 4EWCA 3J80f 1JJ2Y 5IT9b 1VQN1 2NVYI 4RV9A 4E31A 1WW9A 1ZB8A 2YADA 1Z03A 2JA5I 1VQLZ 5T64A 4A3KI 3HOUI 4QTTA 1QVGZ 1K9M1 2KI7B 1YUKA 1ZB9A 3P5JB 2Y0SA 3S16I 2GTIA 3CCQ1 2RIQA 1KQSY 2Q4ZA 1Q821 3FKII 4A3GI 4A3EI 3CD61 4NBCA 4NH1C 4MXUA 3HOZI 2JA6I 3VMGA 1YI2Z 5FLMI 1YI21 4TNUA 4HH4A 4NB8A 2QREB 1KRLA 3CXCZ 3F3FC 3S2DI 3GTQI 2HF1A 1TWFI 1WIIA 1SFOI 4MD8A 5D1OA 2JR6A 3I56Z 1X3ZA 1K8A2 4E30A 5D1OB 1Y1VI 2P28A 4Y7NI 3LUSA 1VQM1 1JJ2Z 4A3MI 4RS4A 4BXXI 3GTKI 1VQOZ 2V8KA 4S1TA 3CCJZ 3CC7Z 1VQ51 2VF1A 3K7AI 2ZAEB 4MRIA 3IF8A 3CMAZ 3CC71 3CCJ1 1W2BY 1KC82 4DQYB 4NB9A 3M4OI 3I07A 4NBGA 3JAMf 3NDIA 5IT9f 3TDHB 3NH5A 4QTUA 1YHQ1 1VLAA 3HOVI 4NBBA 3RZDI 4NBHA 2QKDA 1VQKZ 1X0TA 1KQSZ 3NH4A 1LQLA 3CPWY 1TWHI 1VQ91 2NVTI 1VQPZ 1NJI2 1ZH1A 1VQP1 3D9XA 3PO3S 4MH4A 1NJI1 1VQ8Z 3GTMS 1K83I 2I3CA 3G4SZ 1M901 5D1PA 3S1QI 5C4XI 1Z01A 4A3CI 4DK1A 1YUAA 1N2FA 3MONA 4NBFA 5AN9F 1N8R1 1YJ9Z 3FQMA 1YJ91 2W04A 4A3II 1VQ7Z 3G6EZ 1RLYA 4NFRA 3G6E1 3S2HI 2NVQI 4E2YA 3HKZA 1RO0A 3NH8A 1K732 2R92I 3TE5B 2JA7I 1K731 1K9M2 5T67A 2RHBA 5FLXb 2IZ3A 1VQL1 2V8IA 2QRCB 1S7MA 1W2BZ 3KIFA 4NOZA 3HOYI 4E2ZA 1Y1WI 1TFIA 1R9TI 2JUBA 3BG1B 5C4JI 1YIJZ 1X3WA 4E2XA 4MD7A 1Q822 2WAQA 3CCEZ 3J81f 2F4MA 2IZ4A 5CM2M 3I55Z 3I551 3CPWZ 1YJNZ 3OW2Z 4E2WA 1Q811 2YU9I 3NFZA 2JS4A 3PO3I 4MONA 2VUMI 1TWGI 1VQ6Z 2J6AA 1L1OC 3GCFA 5IP9I 5A2Qb 3RZOI 3J80b 4A3BI 3QWUA 1I3QI 3G71Z 2QEXZ 1JWHC 3I561 3CCLZ 2QEX1 1YJWZ 1QF8A 3CCL1 3Q87A 1YJW1 1VQ4Z 3FQQA 3VTNA 1VQO1 3S14I 3J7A4 3HOWI 2O4HA 2GTHA 4Y52I 2H85A 3CMA1 2QA4Z 2DE5A 2QA41 4BBRI 2HU9A 2PMZA 2PK7A 1NP6A 5C3EI 3CCSZ 3GTJI 2M6NA 2OTLZ 4E32A 1VQK1 1M1K1 3S1MI 2EGTA 3GTLI 3OW2Y 3CCVZ 2LIYA 1M902 4NBDA 1VQ81 2QLVB 3G4S1 3H0GI 3CQZI 4RVFA 3CCRZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ I;  2JA6 I;  3GTP I;  2NVX I;  3VMG A;  5FLM I;  2BJO A;  4NOZ A;  4NB8 A;  3S1R I;  3HOY I;  1Y1W I;  1TFI A;  1R9T I;  4A3F I;  3VMH A;  4BBS I;  5C4J I;  1X3W A;  2R93 I;  2P3Y A;  2JNY A;  3S2D I;  3GTQ I;  2HF1 A;  4XX2 A;  1TWF I;  3I4M I;  1WCM I;  1SFO I;  3ESW A;  3M3Y I;  2JR6 A;  3I4N I;  2F4M A;  1X3Z A;  2RBL A;  5CM2 M;  3S15 I;  4X6A I;  1Y1V I;  4Y7N I;  3LUS A;  4A3M I;  4BXX I;  5IP7 I;  3GTK I;  2R7Z I;  2YU9 I;  2F4O A;  2E2J I;  2JS4 A;  3H3V J;  3PO3 I;  1USP A;  2VUM I;  1TWG I;  3K7A I;  2J6A A;  1L1O C;  2B63 I;  2KPI A;  3GCF A;  4NB9 A;  1PFT A;  3M4O I;  5IP9 I;  3I07 A;  1USP B;  3GTO I;  3RZO I;  3GTG I;  4NBG A;  4BY7 I;  2E2H I;  4NBE A;  4NBA A;  4A3B I;  1ML8 A;  1I3Q I;  4A3L I;  3PO2 I;  3U50 C;  2AKL A;  1VLA A;  4QTU A;  2K5R A;  3D6W A;  3HOV I;  4NBB A;  3RZD I;  3Q87 A;  4NBH A;  1Y1V S;  1TWA I;  4A93 I;  1RO4 A;  2E2I I;  1TWC I;  5C44 I;  1LQL A;  1TWH I;  2NVT I;  1DL6 A;  3S14 I;  3HOW I;  3GTM I;  4Y52 I;  3PO3 S;  2NVY I;  4MH4 A;  1I6H I;  3GTM S;  1K83 I;  1NUI A;  1WW9 A;  1ZB8 A;  2DE5 A;  3S1N I;  2JA8 I;  4BBR I;  2DE7 A;  2PK7 A;  3S1Q I;  2JA5 I;  5C4X I;  3HOX I;  5C3E I;  4A3C I;  4A3K I;  3HOU I;  3GTJ I;  1YUA A;  4QTT A;  1I50 I;  1N2F A;  3GKQ A;  1ZB9 A;  4NBF A;  4BY1 I;  4A3I I;  3S16 I;  3S1M I;  1RLY A;  3GTL I;  3S2H I;  1QYP A;  2NVQ I;  3S17 I;  2DE6 A;  3EER A;  3FKI I;  4NBD A;  3VB9 A;  3VMI A;  2R92 I;  4A3G I;  4A3D I;  4A3E I;  2JA7 I;  4NBC A;  4A3J I;  3H0G I;  3CQZ I; 
#chains in the Genus database with same CATH topology
 3NDJ A;  3CCR 1;  2NVX I;  3GTP I;  3MZL B;  1N8R 2;  4HGZ A;  1KD1 1;  3S1R I;  4BBS I;  2P3Y A;  1VQ7 1;  4XX2 A;  3I4M I;  1WCM I;  1Q7Y 1;  1Q86 2;  3ESW A;  1Q86 1;  3I4N I;  2RBL A;  1S72 Z;  3S15 I;  4X6A I;  2VUG A;  5A2Q f;  3CC2 Z;  5T6B A;  3CC2 1;  1VQN Z;  1YIJ 1;  2KPI A;  1PFT A;  2O53 A;  2JIP A;  3GTO I;  2W03 A;  3GTG I;  3CCE 1;  2Q51 A;  4NBE A;  1AA6 A;  4NBA A;  1ML8 A;  4HGY A;  3PO2 I;  2K5R A;  2RT9 A;  3D6W A;  1FDO A;  1YJN 1;  1QXF A;  2R6M A;  1Q81 2;  4A93 I;  2E2I I;  3CCQ Z;  3EED A;  5C44 I;  2GU2 A;  3BG0 B;  1DL6 A;  3T4N B;  3GTM I;  1I6H I;  2K3R A;  1NUI A;  1Z02 A;  1VQ6 1;  3CD6 Z;  2OTJ Z;  3S1N I;  2JA8 I;  2OTJ 1;  2DE7 A;  2VPX A;  3F3P C;  1RNI A;  1QVF Y;  3HOX I;  1RQF A;  2QR1 B;  1I50 I;  3G71 1;  1WZN A;  3GKQ A;  5LL6 f;  2G2K A;  4BY1 I;  2WB1 A;  2QRD B;  2OOX B;  1VQ4 1;  2V8J A;  1QYP A;  2JMO A;  2E9H A;  3S17 I;  1YIT Z;  2DE6 A;  3EER A;  3VB9 A;  3VMI A;  4E33 A;  1YIT 1;  4A3D I;  1P9N A;  3IR7 A;  4A3J I;  4RVG A;  1VQM Z;  1K8A 1;  3CCS 1;  2BJO A;  2LFU A;  3IFU A;  3J81 b;  2OTL 1;  1M1K 2;  1VQ5 Z;  4DGL A;  4A3F I;  3VMH A;  1QVG Y;  2JIO A;  2R93 I;  2JNY A;  5FLX f;  2OOY B;  1KC8 1;  3CC4 Z;  4MD9 A;  2PM9 A;  3CC4 1;  3CCV 1;  3M3Y I;  2M48 A;  1YHQ Z;  3KIH A;  1KD1 2;  5IP7 I;  1VQ9 Z;  2R7Z I;  2VPZ A;  2F4O A;  2E2J I;  1RO2 A;  3H3V J;  1USP A;  2OZK A;  3IX0 A;  1Q7Y 2;  1QVF Z;  2B63 I;  3CCM Z;  3CXC Y;  3CCM 1;  1USP B;  4RVH A;  3MZK B;  3CCU Z;  4BY7 I;  3CCU 1;  2E2H I;  4CL1 A;  4A3L I;  3U50 C;  2AKL A;  1S72 1;  3CME Z;  4RVD A;  1Y1V S;  3CME 1;  1TWA I;  1RO4 A;  4AYB A;  1TWC I;  3JAM b;  2RPR A;  4EWC A;  3J80 f;  1JJ2 Y;  5IT9 b;  1VQN 1;  2NVY I;  4RV9 A;  4E31 A;  1WW9 A;  1ZB8 A;  2YAD A;  1Z03 A;  2JA5 I;  1VQL Z;  5T64 A;  4A3K I;  3HOU I;  4QTT A;  1QVG Z;  1K9M 1;  2KI7 B;  1YUK A;  1ZB9 A;  3P5J B;  2JIQ A;  2Y0S A;  3S16 I;  2GTI A;  3CCQ 1;  2RIQ A;  1KQS Y;  2Q4Z A;  1Q82 1;  3FKI I;  4A3G I;  4A3E I;  3CD6 1;  4NBC A;  4NH1 C;  1FDI A;  4MXU A;  3HOZ I;  2JA6 I;  3VMG A;  1YI2 Z;  5FLM I;  1YI2 1;  4TNU A;  4HH4 A;  4NB8 A;  2QRE B;  1KRL A;  2E7Z A;  3CXC Z;  3F3F C;  3S2D I;  3GTQ I;  2HF1 A;  1TWF I;  1WII A;  1SFO I;  4MD8 A;  5D1O A;  2JR6 A;  3I56 Z;  1X3Z A;  1K8A 2;  4E30 A;  5D1O B;  1Y1V I;  2P28 A;  4Y7N I;  3LUS A;  1VQM 1;  1JJ2 Z;  4A3M I;  4RS4 A;  4BXX I;  3GTK I;  1VQO Z;  1Y8C A;  2V8K A;  4S1T A;  3CCJ Z;  3CC7 Z;  1VQ5 1;  2VF1 A;  3K7A I;  2ZAE B;  4MRI A;  3IF8 A;  3CMA Z;  3CCJ 1;  3CC7 1;  1W2B Y;  1KC8 2;  4DQY B;  4NB9 A;  3M4O I;  3I07 A;  4NBG A;  3JAM f;  3NDI A;  5IT9 f;  1SIW A;  3TDH B;  3NH5 A;  4QTU A;  1VLA A;  1YHQ 1;  3HOV I;  4NBB A;  3RZD I;  1Q16 A;  4NBH A;  2QKD A;  1VQK Z;  1X0T A;  1KQS Z;  3NH4 A;  1LQL A;  3CPW Y;  1TWH I;  1VQ9 1;  2NVT I;  1VQP Z;  1NJI 2;  1ZH1 A;  1VQP 1;  3D9X A;  3PO3 S;  4MH4 A;  1NJI 1;  1VQ8 Z;  3GTM S;  1K83 I;  2JIM A;  2I3C A;  3G4S Z;  1M90 1;  5D1P A;  3S1Q I;  2IV2 X;  2LEX A;  5C4X I;  1Z01 A;  4A3C I;  4DK1 A;  1YUA A;  2NAP A;  1N2F A;  3MON A;  4NBF A;  5AN9 F;  1N8R 1;  1YJ9 Z;  3FQM A;  1YJ9 1;  2W04 A;  4A3I I;  1VQ7 Z;  3G6E Z;  1RLY A;  4NFR A;  3G6E 1;  3S2H I;  2NVQ I;  4E2Y A;  3HKZ A;  1RO0 A;  3NH8 A;  1K73 2;  2R92 I;  3TE5 B;  2JA7 I;  1K73 1;  1K9M 2;  5T67 A;  2RHB A;  5FLX b;  2IZ3 A;  1VQL 1;  2V8I A;  2QRC B;  1S7M A;  1W2B Z;  3KIF A;  4NOZ A;  3HOY I;  4E2Z A;  1Y1W I;  1TFI A;  1R9T I;  2JUB A;  3BG1 B;  5C4J I;  1YIJ Z;  1X3W A;  4E2X A;  4MD7 A;  2V3V A;  1Q82 2;  2AYD A;  2WAQ A;  3CCE Z;  3J81 f;  2F4M A;  2IZ4 A;  2V45 A;  5CM2 M;  3I55 Z;  3I55 1;  3CPW Z;  1YJN Z;  3OW2 Z;  4E2W A;  2VPW A;  1Q81 1;  2YU9 I;  3NFZ A;  2JS4 A;  3PO3 I;  4MON A;  2VUM I;  1TWG I;  1VQ6 Z;  2J6A A;  1L1O C;  3GCF A;  5IP9 I;  5A2Q b;  3RZO I;  3J80 b;  1WJ2 A;  4A3B I;  3QWU A;  1I3Q I;  3G71 Z;  2QEX Z;  1JWH C;  3I56 1;  3CCL Z;  2QEX 1;  1YJW Z;  1QF8 A;  3CCL 1;  3Q87 A;  1YJW 1;  1VQ4 Z;  3FQQ A;  3VTN A;  1VQO 1;  3S14 I;  3J7A 4;  2VPY A;  3HOW I;  2O4H A;  2GTH A;  4Y52 I;  2H85 A;  3CMA 1;  2QA4 Z;  2DE5 A;  2QA4 1;  4BBR I;  2HU9 A;  2PMZ A;  2PK7 A;  1NP6 A;  5C3E I;  3CCS Z;  3GTJ I;  2M6N A;  2OTL Z;  4E32 A;  1VQK 1;  1M1K 1;  3S1M I;  2EGT A;  3GTL I;  3OW2 Y;  3CCV Z;  2LIY A;  1M90 2;  4NBD A;  3D2L A;  1VQ8 1;  2QLV B;  3G4S 1;  3H0G I;  3CQZ I;  2JIR A;  4RVF A;  3CCR Z; 
#chains in the Genus database with same CATH homology
 3NDJ A;  3CCR 1;  2NVX I;  3GTP I;  3MZL B;  1N8R 2;  4HGZ A;  1KD1 1;  3S1R I;  4BBS I;  2P3Y A;  1VQ7 1;  4XX2 A;  3I4M I;  1WCM I;  1Q7Y 1;  1Q86 2;  3ESW A;  1Q86 1;  3I4N I;  2RBL A;  1S72 Z;  3S15 I;  4X6A I;  2VUG A;  5A2Q f;  3CC2 Z;  5T6B A;  3CC2 1;  1VQN Z;  1YIJ 1;  2KPI A;  1PFT A;  2O53 A;  3GTO I;  2W03 A;  3GTG I;  3CCE 1;  2Q51 A;  4NBE A;  4NBA A;  1ML8 A;  4HGY A;  3PO2 I;  2K5R A;  2RT9 A;  3D6W A;  1YJN 1;  4A93 I;  2R6M A;  1Q81 2;  2E2I I;  3CCQ Z;  3EED A;  5C44 I;  2GU2 A;  3BG0 B;  1DL6 A;  3T4N B;  3GTM I;  1I6H I;  2K3R A;  1NUI A;  1Z02 A;  1VQ6 1;  3CD6 Z;  2OTJ Z;  3S1N I;  2JA8 I;  2OTJ 1;  2DE7 A;  3F3P C;  1RNI A;  1QVF Y;  3HOX I;  1RQF A;  2QR1 B;  1I50 I;  3G71 1;  3GKQ A;  5LL6 f;  2G2K A;  4BY1 I;  2WB1 A;  2QRD B;  2OOX B;  1VQ4 1;  2V8J A;  1QYP A;  2JMO A;  2E9H A;  3S17 I;  1YIT Z;  2DE6 A;  3EER A;  3VB9 A;  3VMI A;  4E33 A;  1YIT 1;  4A3D I;  1P9N A;  4A3J I;  4RVG A;  1VQM Z;  1K8A 1;  3CCS 1;  2BJO A;  2LFU A;  3IFU A;  3J81 b;  2OTL 1;  1M1K 2;  1VQ5 Z;  4DGL A;  4A3F I;  3VMH A;  1QVG Y;  2R93 I;  2JNY A;  5FLX f;  2OOY B;  1KC8 1;  3CC4 Z;  4MD9 A;  2PM9 A;  3CC4 1;  3CCV 1;  3M3Y I;  2M48 A;  1YHQ Z;  3KIH A;  1KD1 2;  5IP7 I;  1VQ9 Z;  2R7Z I;  2F4O A;  2E2J I;  1RO2 A;  3H3V J;  1USP A;  2OZK A;  3IX0 A;  1Q7Y 2;  1QVF Z;  2B63 I;  3CCM Z;  3CXC Y;  3CCM 1;  1USP B;  4RVH A;  3MZK B;  3CCU Z;  4BY7 I;  3CCU 1;  2E2H I;  4CL1 A;  4A3L I;  3U50 C;  2AKL A;  1S72 1;  3CME Z;  4RVD A;  1Y1V S;  3CME 1;  1TWA I;  1RO4 A;  4AYB A;  1TWC I;  3JAM b;  2RPR A;  4EWC A;  3J80 f;  1JJ2 Y;  5IT9 b;  1VQN 1;  2NVY I;  4RV9 A;  4E31 A;  1WW9 A;  1ZB8 A;  2YAD A;  1Z03 A;  2JA5 I;  1VQL Z;  5T64 A;  4A3K I;  3HOU I;  4QTT A;  1QVG Z;  1K9M 1;  2KI7 B;  1YUK A;  1ZB9 A;  3P5J B;  2Y0S A;  3S16 I;  2GTI A;  3CCQ 1;  2RIQ A;  1KQS Y;  2Q4Z A;  1Q82 1;  3FKI I;  4A3G I;  4A3E I;  3CD6 1;  4NBC A;  4NH1 C;  4MXU A;  3HOZ I;  2JA6 I;  3VMG A;  1YI2 Z;  5FLM I;  1YI2 1;  4TNU A;  4HH4 A;  4NB8 A;  2QRE B;  1KRL A;  3CXC Z;  3F3F C;  3S2D I;  3GTQ I;  2HF1 A;  1TWF I;  1WII A;  1SFO I;  4MD8 A;  5D1O A;  2JR6 A;  3I56 Z;  1X3Z A;  1K8A 2;  4E30 A;  5D1O B;  1Y1V I;  2P28 A;  4Y7N I;  3LUS A;  1VQM 1;  1JJ2 Z;  4A3M I;  4RS4 A;  4BXX I;  3GTK I;  1VQO Z;  2V8K A;  4S1T A;  3CCJ Z;  3CC7 Z;  1VQ5 1;  2VF1 A;  3K7A I;  2ZAE B;  4MRI A;  3IF8 A;  3CMA Z;  3CC7 1;  3CCJ 1;  1W2B Y;  1KC8 2;  4DQY B;  4NB9 A;  3M4O I;  3I07 A;  4NBG A;  3JAM f;  3NDI A;  5IT9 f;  3TDH B;  3NH5 A;  4QTU A;  1YHQ 1;  1VLA A;  3HOV I;  4NBB A;  3RZD I;  4NBH A;  2QKD A;  1VQK Z;  1X0T A;  1KQS Z;  3NH4 A;  1LQL A;  3CPW Y;  1TWH I;  1VQ9 1;  2NVT I;  1VQP Z;  1NJI 2;  1ZH1 A;  1VQP 1;  3D9X A;  3PO3 S;  4MH4 A;  1NJI 1;  1VQ8 Z;  3GTM S;  1K83 I;  2I3C A;  3G4S Z;  1M90 1;  5D1P A;  3S1Q I;  5C4X I;  1Z01 A;  4A3C I;  4DK1 A;  1YUA A;  1N2F A;  3MON A;  4NBF A;  5AN9 F;  1N8R 1;  1YJ9 Z;  3FQM A;  1YJ9 1;  2W04 A;  4A3I I;  1VQ7 Z;  3G6E Z;  1RLY A;  4NFR A;  3G6E 1;  3S2H I;  2NVQ I;  4E2Y A;  3HKZ A;  1RO0 A;  3NH8 A;  1K73 2;  2R92 I;  3TE5 B;  2JA7 I;  1K73 1;  1K9M 2;  5T67 A;  2RHB A;  5FLX b;  2IZ3 A;  1VQL 1;  2V8I A;  2QRC B;  1S7M A;  1W2B Z;  3KIF A;  4NOZ A;  3HOY I;  4E2Z A;  1Y1W I;  1TFI A;  1R9T I;  2JUB A;  3BG1 B;  5C4J I;  1YIJ Z;  1X3W A;  4E2X A;  4MD7 A;  1Q82 2;  2WAQ A;  3CCE Z;  3J81 f;  2F4M A;  2IZ4 A;  5CM2 M;  3I55 Z;  3I55 1;  3CPW Z;  1YJN Z;  3OW2 Z;  4E2W A;  1Q81 1;  2YU9 I;  3NFZ A;  2JS4 A;  3PO3 I;  4MON A;  2VUM I;  1TWG I;  1VQ6 Z;  2J6A A;  1L1O C;  3GCF A;  5IP9 I;  5A2Q b;  3RZO I;  3J80 b;  4A3B I;  3QWU A;  1I3Q I;  3G71 Z;  2QEX Z;  1JWH C;  3I56 1;  3CCL Z;  2QEX 1;  1YJW Z;  1QF8 A;  3CCL 1;  3Q87 A;  1YJW 1;  1VQ4 Z;  3FQQ A;  3VTN A;  1VQO 1;  3S14 I;  3J7A 4;  3HOW I;  2O4H A;  2GTH A;  4Y52 I;  2H85 A;  3CMA 1;  2QA4 Z;  2DE5 A;  2QA4 1;  4BBR I;  2HU9 A;  2PMZ A;  2PK7 A;  1NP6 A;  5C3E I;  3CCS Z;  3GTJ I;  2M6N A;  2OTL Z;  4E32 A;  1VQK 1;  1M1K 1;  3S1M I;  2EGT A;  3GTL I;  3OW2 Y;  3CCV Z;  2LIY A;  1M90 2;  4NBD A;  1VQ8 1;  2QLV B;  3G4S 1;  3H0G I;  3CQZ I;  4RVF A;  3CCR Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...