3FQQA

Crystal structure of a novel dimeric form of hcv ns5a domain i protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
160
structure length
160
Chain Sequence
LGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFLVGLNQYLVGSQLPCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel dimeric form of NS5A domain I protein from hepatitis C virus
pubmed doi rcsb
source organism Hepatitis c virus (isolate con1)
molecule tags Metal binding protein
molecule keywords Non-structural protein 5A
total genus 30
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08300 HCV_NS5a_1a Hepatitis C virus non-structural 5a zinc finger domain
A PF08301 HCV_NS5a_1b Hepatitis C virus non-structural 5a domain 1b
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.210 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3fqqA01
2.20.25.220 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3fqqA02
3FQQA 3FQMA 4CL1A 1ZH1A
chains in the Genus database with same CATH superfamily
1TWFI 3EEDA 3D6WA 2HF1A 3CD6Z 1YI2Z 2H85A 3CC71 4S1TA 1W2BY 1RQFA 2WB1A 4MH4A 2YU9I 1WZNA 2E2HI 1K9M1 1Q16A 1YJN1 1Y1VI 1TWAI 2QA4Z 2B63I 2M48A 4MONA 4NFRA 1S72Z 2KPIA 3RZOI 4NBBA 5A2Qb 3G6E1 2R92I 3VMGA 3HOZI 4RS4A 2JS4A 3I07A 3D9XA 1WCMI 2RT9A 4MD8A 1YIJZ 2ZAEB 1I6HI 1NUIA 1JWHC 2E2II 4BBSI 1VQMZ 1RO4A 3CCV1 2JIQA 3MZLB 1KQSZ 1NJI2 2J6AA 3KIHA 1SFOI 5C4JI 4A3DI 1FDOA 2VUMI 4Y7NI 3G4S1 4BY1I 2OZKA 3F3PC 3MONA 3CCU1 2V8IA 3G711 3OW2Y 3TE5B 2E9HA 4NBEA 3HKZA 1YI21 3NFZA 3CC7Z 1YJW1 3CCE1 1YITZ 1YJ9Z 2PM9A 3J7A4 1Q812 4HH4A 3MZKB 3CQZI 2KI7B 3M3YI 3JAMb 2VPXA 3HOVI 1VQLZ 2QA41 1YHQZ 3J81f 1Z02A 1M1K2 1SIWA 3QWUA 3FQMA 3KIFA 2GTIA 1VQ61 2OTJZ 3JAMf 1KD12 3S15I 4RVGA 1KC82 3GTJI 5IP7I 4DK1A 1X3ZA 4A3MI 2RIQA 1QVGZ 3S16I 4RVHA 1YIJ1 2R7ZI 1KRLA 1RNIA 1K8A1 3GTMS 1VQM1 3CCVZ 5T67A 4E2ZA 3CXCZ 1PFTA 4NBHA 3S1MI 3NH8A 2LIYA 4RV9A 4XX2A 4A3LI 4NOZA 1NP6A 2JIMA 1WIIA 3G71Z 4A93I 1TWCI 1YJWZ 1QXFA 1YUAA 1YIT1 1YJ91 2BJOA 2RBLA 4E30A 2P3YA 2AYDA 2F4MA 2I3CA 3CCL1 4NH1C 1N8R2 1Q862 2IZ4A 2IV2X 1Q811 3CC41 3BG1B 3NDJA 1TWHI 3CMEZ 3GTPI 2V8JA 3TDHB 3CC21 3F3FC 5D1PA 2F4OA 1K731 1Y8CA 2JNYA 2V45A 4A3CI 2JA8I 1DL6A 4NB8A 1LQLA 3CCRZ 3GTKI 1ML8A 3CCEZ 4BBRI 2G2KA 1QYPA 4MXUA 1WJ2A 3IFUA 2Y0SA 1JJ2Z 4BY7I 2JA6I 1VQL1 2V8KA 3CCQZ 3HOYI 5D1OA 2OOYB 1ZH1A 1YUKA 5IT9f 4A3GI 1QVFZ 1VQ6Z 2JA5I 1VQ51 5C3EI 4A3BI 3GTLI 4NB9A 4RVFA 3CCLZ 3S2HI 2RHBA 2VPYA 5FLMI 4A3FI 2NVYI 3CCMZ 4CL1A 3S14I 1TWGI 3CC4Z 3T4NB 1VQ91 4QTTA 3S2DI 4X6AI 5FLXb 5C44I 2GU2A 1RO2A 4NBFA 4A3KI 2E7ZA 1ZB9A 3GTMI 3VB9A 2VPZA 5LL6f 1R9TI 2Q4ZA 2JIPA 5A2Qf 3PO2I 3I551 2QLVB 2V3VA 3H0GI 1Z03A 3J81b 2E2JI 3I4MI 2QR1B 3GCFA 1VQ81 4E2WA 2K5RA 3CCQ1 3GTOI 1K8A2 2NAPA 1I50I 5T64A 1VQ71 4E31A 2JIOA 2JUBA 2JA7I 3CPWZ 1USPA 2QEX1 4NBCA 3FKII 3CME1 1JJ2Y 1VQKZ 3CC2Z 1QF8A 1RO0A 1VLAA 4E32A 1Q7Y2 2DE6A 3IX0A 4E33A 1L1OC 4MD7A 1N2FA 4RVDA 1Y1VS 3CCM1 5IP9I 1KC81 2IZ3A 3CCR1 2VUGA 1FDIA 3VMHA 3CCS1 3U50C 4A3EI 3GKQA 2R93I 5CM2M 1TFIA 1ZB8A 1M901 3K7AI 2NVXI 1VQNZ 3NH5A 4TNUA 4NBGA 4HGZA 3BG0B 1P9NA 3IF8A 1VQO1 2QRDB 2YADA 3I56Z 1VQ5Z 1I3QI 5AN9F 3PO3I 3S1QI 1KQSY 2WAQA 2P28A 2W03A 1QVFY 4MRIA 4HGYA 2K3RA 1VQ9Z 2JIRA 5T6BA 3CMA1 2R6MA 1K83I 2Q51A 1S7MA 1M902 2JMOA 1VQK1 3PO3S 2QKDA 2QRCB 3J80f 5C4XI 3HOWI 1VQPZ 2JR6A 3I55Z 3CPWY 3CCSZ 1Q7Y1 3FQQA 1VQ8Z 1X0TA 4QTUA 3Q87A 2OTL1 5IT9b 3CCJ1 2VPWA 4BXXI 1VQN1 2NVQI 2PMZA 1YJNZ 3GTGI 1VQ7Z 1K9M2 2HU9A 3S1RI 3GTQI 3P5JB 2DE5A 2QEXZ 1VQ4Z 1Q821 4AYBA 1X3WA 3G6EZ 3HOUI 5FLXf 3LUSA 3IR7A 3NDIA 2LEXA 2AKLA 4MD9A 2RPRA 4NBDA 3CD61 1Q822 4E2YA 1Z01A 3D2LA 1USPB 2VF1A 1VQP1 3J80b 2LFUA 1N8R1 2GTHA 2PK7A 3VTNA 4E2XA 3CCUZ 4Y52I 3EERA 4NBAA 3S1NI 2NVTI 4A3JI 1VQOZ 3I561 3ESWA 1S721 1NJI1 1M1K1 2W04A 2OTLZ 3S17I 3CCJZ 4DQYB 1Y1WI 1RLYA 3VMIA 2QREB 1WW9A 3RZDI 3I4NI 4A3II 2DE7A 1YHQ1 3CMAZ 3OW2Z 1VQ41 3NH4A 2EGTA 2OOXB 1QVGY 4EWCA 2M6NA 1Q861 1KD11 1K732 1W2BZ 3HOXI 2OTJ1 3G4SZ 3M4OI 2O4HA 3CXCY 1AA6A 4DGLA 2O53A 5D1OB 3H3VJ
chains in the Genus database with same CATH topology
1TWFI 3EEDA 3D6WA 2HF1A 3CD6Z 1YI2Z 2H85A 3CC71 4S1TA 1W2BY 1RQFA 2WB1A 4MH4A 2YU9I 2E2HI 1K9M1 1YJN1 1Y1VI 1TWAI 2QA4Z 2B63I 2M48A 4MONA 4NFRA 1S72Z 2KPIA 3RZOI 4NBBA 5A2Qb 3G6E1 2R92I 3VMGA 3HOZI 4RS4A 2JS4A 3I07A 3D9XA 1WCMI 2RT9A 4MD8A 1YIJZ 2ZAEB 1I6HI 1NUIA 1JWHC 2E2II 4BBSI 1VQMZ 1RO4A 3CCV1 3MZLB 1KQSZ 1NJI2 2J6AA 3KIHA 1SFOI 5C4JI 4A3DI 2VUMI 4Y7NI 3G4S1 4BY1I 2OZKA 3F3PC 3MONA 3CCU1 2V8IA 3G711 3OW2Y 3TE5B 2E9HA 4NBEA 3HKZA 1YI21 3NFZA 3CC7Z 1YJW1 3CCE1 1YITZ 1YJ9Z 2PM9A 3J7A4 1Q812 4HH4A 3MZKB 3CQZI 2KI7B 3M3YI 3JAMb 3HOVI 1VQLZ 2QA41 1YHQZ 3J81f 1Z02A 1M1K2 3QWUA 3FQMA 3KIFA 2GTIA 1VQ61 2OTJZ 3JAMf 1KD12 3S15I 4RVGA 1KC82 3GTJI 5IP7I 4DK1A 1X3ZA 4A3MI 2RIQA 1QVGZ 3S16I 4RVHA 1YIJ1 2R7ZI 1KRLA 1RNIA 1K8A1 3GTMS 1VQM1 3CCVZ 5T67A 4E2ZA 3CXCZ 1PFTA 4NBHA 3S1MI 3NH8A 2LIYA 4RV9A 4XX2A 4A3LI 4NOZA 1NP6A 1WIIA 3G71Z 4A93I 1TWCI 1YJWZ 1YUAA 1YIT1 1YJ91 2BJOA 2RBLA 4E30A 2P3YA 2F4MA 2I3CA 3CCL1 4NH1C 1N8R2 1Q862 2IZ4A 1Q811 3CC41 3BG1B 3NDJA 1TWHI 3CMEZ 3GTPI 2V8JA 3TDHB 3CC21 3F3FC 5D1PA 2F4OA 1K731 2JNYA 4A3CI 2JA8I 1DL6A 4NB8A 1LQLA 3CCRZ 3GTKI 1ML8A 3CCEZ 4BBRI 2G2KA 1QYPA 4MXUA 3IFUA 2Y0SA 1JJ2Z 4BY7I 2JA6I 1VQL1 2V8KA 3CCQZ 3HOYI 5D1OA 2OOYB 1ZH1A 1YUKA 5IT9f 4A3GI 1QVFZ 1VQ6Z 2JA5I 1VQ51 5C3EI 4A3BI 3GTLI 4NB9A 4RVFA 3CCLZ 3S2HI 2RHBA 5FLMI 4A3FI 2NVYI 3CCMZ 4CL1A 3S14I 1TWGI 3CC4Z 3T4NB 1VQ91 4QTTA 3S2DI 4X6AI 5FLXb 5C44I 2GU2A 1RO2A 4NBFA 4A3KI 1ZB9A 3GTMI 3VB9A 5LL6f 1R9TI 2Q4ZA 5A2Qf 3PO2I 3I551 2QLVB 3H0GI 1Z03A 3J81b 2E2JI 3I4MI 2QR1B 3GCFA 1VQ81 4E2WA 2K5RA 3CCQ1 3GTOI 1K8A2 1I50I 5T64A 1VQ71 4E31A 2JUBA 2JA7I 3CPWZ 1USPA 2QEX1 4NBCA 3FKII 3CME1 1JJ2Y 1VQKZ 3CC2Z 1QF8A 1RO0A 1VLAA 4E32A 1Q7Y2 2DE6A 3IX0A 4E33A 1L1OC 4MD7A 1N2FA 4RVDA 1Y1VS 3CCM1 5IP9I 1KC81 2IZ3A 3CCR1 2VUGA 3VMHA 3CCS1 3U50C 4A3EI 3GKQA 2R93I 5CM2M 1TFIA 1ZB8A 1M901 3K7AI 2NVXI 1VQNZ 3NH5A 4TNUA 4NBGA 4HGZA 3BG0B 1P9NA 3IF8A 1VQO1 2QRDB 2YADA 3I56Z 1VQ5Z 1I3QI 5AN9F 3PO3I 3S1QI 1KQSY 2WAQA 2P28A 2W03A 1QVFY 4MRIA 4HGYA 2K3RA 1VQ9Z 5T6BA 3CMA1 2R6MA 1K83I 2Q51A 1S7MA 1M902 2JMOA 1VQK1 3PO3S 2QKDA 2QRCB 3J80f 5C4XI 3HOWI 1VQPZ 2JR6A 3I55Z 3CPWY 3CCSZ 1Q7Y1 3FQQA 1VQ8Z 1X0TA 4QTUA 3Q87A 2OTL1 5IT9b 3CCJ1 4BXXI 1VQN1 2NVQI 2PMZA 1YJNZ 3GTGI 1VQ7Z 1K9M2 2HU9A 3S1RI 3GTQI 3P5JB 2DE5A 2QEXZ 1VQ4Z 1Q821 4AYBA 1X3WA 3G6EZ 3HOUI 5FLXf 3LUSA 3NDIA 2AKLA 4MD9A 2RPRA 4NBDA 3CD61 1Q822 4E2YA 1Z01A 1USPB 2VF1A 1VQP1 3J80b 2LFUA 1N8R1 2GTHA 2PK7A 3VTNA 4E2XA 3CCUZ 4Y52I 3EERA 4NBAA 3S1NI 2NVTI 4A3JI 1VQOZ 3I561 3ESWA 1S721 1NJI1 1M1K1 2W04A 2OTLZ 3S17I 3CCJZ 4DQYB 1Y1WI 1RLYA 3VMIA 2QREB 1WW9A 3RZDI 3I4NI 4A3II 2DE7A 1YHQ1 3CMAZ 3OW2Z 1VQ41 3NH4A 2EGTA 2OOXB 1QVGY 4EWCA 2M6NA 1Q861 1KD11 1K732 1W2BZ 3HOXI 2OTJ1 3G4SZ 3M4OI 2O4HA 3CXCY 4DGLA 2O53A 5D1OB 3H3VJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FQQ A;  3FQM A;  4CL1 A;  1ZH1 A; 
#chains in the Genus database with same CATH topology
 1TWF I;  3EED A;  3D6W A;  2HF1 A;  3CD6 Z;  1YI2 Z;  2H85 A;  3CC7 1;  4S1T A;  1W2B Y;  1RQF A;  2WB1 A;  4MH4 A;  2YU9 I;  1WZN A;  2E2H I;  1K9M 1;  1Q16 A;  1YJN 1;  1Y1V I;  1TWA I;  2QA4 Z;  2B63 I;  2M48 A;  4MON A;  4NFR A;  1S72 Z;  2KPI A;  3RZO I;  4NBB A;  5A2Q b;  3G6E 1;  2R92 I;  3VMG A;  3HOZ I;  4RS4 A;  2JS4 A;  3I07 A;  3D9X A;  1WCM I;  2RT9 A;  4MD8 A;  1YIJ Z;  2ZAE B;  1I6H I;  1NUI A;  1JWH C;  2E2I I;  4BBS I;  1VQM Z;  1RO4 A;  3CCV 1;  2JIQ A;  3MZL B;  1KQS Z;  1NJI 2;  2J6A A;  3KIH A;  1SFO I;  5C4J I;  4A3D I;  1FDO A;  2VUM I;  4Y7N I;  3G4S 1;  4BY1 I;  2OZK A;  3F3P C;  3MON A;  3CCU 1;  2V8I A;  3G71 1;  3OW2 Y;  3TE5 B;  2E9H A;  4NBE A;  3HKZ A;  1YI2 1;  3NFZ A;  3CC7 Z;  1YJW 1;  3CCE 1;  1YIT Z;  1YJ9 Z;  2PM9 A;  3J7A 4;  1Q81 2;  4HH4 A;  3MZK B;  3CQZ I;  2KI7 B;  3M3Y I;  3JAM b;  2VPX A;  3HOV I;  1VQL Z;  2QA4 1;  1YHQ Z;  3J81 f;  1Z02 A;  1M1K 2;  1SIW A;  3QWU A;  3FQM A;  3KIF A;  2GTI A;  1VQ6 1;  2OTJ Z;  3JAM f;  1KD1 2;  3S15 I;  4RVG A;  1KC8 2;  3GTJ I;  5IP7 I;  4DK1 A;  1X3Z A;  4A3M I;  2RIQ A;  1QVG Z;  3S16 I;  4RVH A;  1YIJ 1;  2R7Z I;  1KRL A;  1RNI A;  1K8A 1;  3GTM S;  1VQM 1;  3CCV Z;  5T67 A;  4E2Z A;  3CXC Z;  1PFT A;  4NBH A;  3S1M I;  3NH8 A;  2LIY A;  4RV9 A;  4XX2 A;  4A3L I;  4NOZ A;  1NP6 A;  2JIM A;  1WII A;  3G71 Z;  4A93 I;  1TWC I;  1YJW Z;  1QXF A;  1YUA A;  1YIT 1;  1YJ9 1;  2BJO A;  2RBL A;  4E30 A;  2P3Y A;  2AYD A;  2F4M A;  2I3C A;  3CCL 1;  4NH1 C;  1N8R 2;  1Q86 2;  2IZ4 A;  2IV2 X;  1Q81 1;  3CC4 1;  3BG1 B;  3NDJ A;  1TWH I;  3CME Z;  3GTP I;  2V8J A;  3TDH B;  3CC2 1;  3F3F C;  5D1P A;  2F4O A;  1K73 1;  1Y8C A;  2JNY A;  2V45 A;  4A3C I;  2JA8 I;  1DL6 A;  4NB8 A;  1LQL A;  3CCR Z;  3GTK I;  1ML8 A;  3CCE Z;  4BBR I;  2G2K A;  1QYP A;  4MXU A;  1WJ2 A;  3IFU A;  2Y0S A;  1JJ2 Z;  4BY7 I;  2JA6 I;  1VQL 1;  2V8K A;  3CCQ Z;  3HOY I;  5D1O A;  2OOY B;  1ZH1 A;  1YUK A;  5IT9 f;  4A3G I;  1QVF Z;  1VQ6 Z;  2JA5 I;  1VQ5 1;  5C3E I;  4A3B I;  3GTL I;  4NB9 A;  4RVF A;  3CCL Z;  3S2H I;  2RHB A;  2VPY A;  5FLM I;  4A3F I;  2NVY I;  3CCM Z;  4CL1 A;  3S14 I;  1TWG I;  3CC4 Z;  3T4N B;  1VQ9 1;  4QTT A;  3S2D I;  4X6A I;  5FLX b;  5C44 I;  2GU2 A;  1RO2 A;  4NBF A;  4A3K I;  2E7Z A;  1ZB9 A;  3GTM I;  3VB9 A;  2VPZ A;  5LL6 f;  1R9T I;  2Q4Z A;  2JIP A;  5A2Q f;  3PO2 I;  3I55 1;  2QLV B;  2V3V A;  3H0G I;  1Z03 A;  3J81 b;  2E2J I;  3I4M I;  2QR1 B;  3GCF A;  1VQ8 1;  4E2W A;  2K5R A;  3CCQ 1;  3GTO I;  1K8A 2;  2NAP A;  1I50 I;  5T64 A;  1VQ7 1;  4E31 A;  2JIO A;  2JUB A;  2JA7 I;  3CPW Z;  1USP A;  2QEX 1;  4NBC A;  3FKI I;  3CME 1;  1JJ2 Y;  1VQK Z;  3CC2 Z;  1QF8 A;  1RO0 A;  1VLA A;  4E32 A;  1Q7Y 2;  2DE6 A;  3IX0 A;  4E33 A;  1L1O C;  4MD7 A;  1N2F A;  4RVD A;  1Y1V S;  3CCM 1;  5IP9 I;  1KC8 1;  2IZ3 A;  3CCR 1;  2VUG A;  1FDI A;  3VMH A;  3CCS 1;  3U50 C;  4A3E I;  3GKQ A;  2R93 I;  5CM2 M;  1TFI A;  1ZB8 A;  1M90 1;  3K7A I;  2NVX I;  1VQN Z;  3NH5 A;  4TNU A;  4NBG A;  4HGZ A;  3BG0 B;  1P9N A;  3IF8 A;  1VQO 1;  2QRD B;  2YAD A;  3I56 Z;  1VQ5 Z;  1I3Q I;  5AN9 F;  3PO3 I;  3S1Q I;  1KQS Y;  2WAQ A;  2P28 A;  2W03 A;  1QVF Y;  4MRI A;  4HGY A;  2K3R A;  1VQ9 Z;  2JIR A;  5T6B A;  3CMA 1;  2R6M A;  1K83 I;  2Q51 A;  1S7M A;  1M90 2;  2JMO A;  1VQK 1;  3PO3 S;  2QKD A;  2QRC B;  3J80 f;  5C4X I;  3HOW I;  1VQP Z;  2JR6 A;  3I55 Z;  3CPW Y;  3CCS Z;  1Q7Y 1;  3FQQ A;  1VQ8 Z;  1X0T A;  4QTU A;  3Q87 A;  2OTL 1;  5IT9 b;  3CCJ 1;  2VPW A;  4BXX I;  1VQN 1;  2NVQ I;  2PMZ A;  1YJN Z;  3GTG I;  1VQ7 Z;  1K9M 2;  2HU9 A;  3S1R I;  3GTQ I;  3P5J B;  2DE5 A;  2QEX Z;  1VQ4 Z;  1Q82 1;  4AYB A;  1X3W A;  3G6E Z;  3HOU I;  5FLX f;  3LUS A;  3IR7 A;  3NDI A;  2LEX A;  2AKL A;  4MD9 A;  2RPR A;  4NBD A;  3CD6 1;  1Q82 2;  4E2Y A;  1Z01 A;  3D2L A;  1USP B;  2VF1 A;  1VQP 1;  3J80 b;  2LFU A;  1N8R 1;  2GTH A;  2PK7 A;  3VTN A;  4E2X A;  3CCU Z;  4Y52 I;  3EER A;  4NBA A;  3S1N I;  2NVT I;  4A3J I;  1VQO Z;  3I56 1;  3ESW A;  1S72 1;  1NJI 1;  1M1K 1;  2W04 A;  2OTL Z;  3S17 I;  3CCJ Z;  4DQY B;  1Y1W I;  1RLY A;  3VMI A;  2QRE B;  1WW9 A;  3RZD I;  3I4N I;  4A3I I;  2DE7 A;  1YHQ 1;  3CMA Z;  3OW2 Z;  1VQ4 1;  3NH4 A;  2EGT A;  2OOX B;  1QVG Y;  4EWC A;  2M6N A;  1Q86 1;  1KD1 1;  1K73 2;  1W2B Z;  3HOX I;  2OTJ 1;  3G4S Z;  3M4O I;  2O4H A;  3CXC Y;  1AA6 A;  4DGL A;  2O53 A;  5D1O B;  3H3V J; 
#chains in the Genus database with same CATH homology
 1TWF I;  3EED A;  3D6W A;  2HF1 A;  3CD6 Z;  1YI2 Z;  2H85 A;  3CC7 1;  4S1T A;  1W2B Y;  1RQF A;  2WB1 A;  4MH4 A;  2YU9 I;  2E2H I;  1K9M 1;  1YJN 1;  1Y1V I;  1TWA I;  2QA4 Z;  2B63 I;  2M48 A;  4MON A;  4NFR A;  1S72 Z;  2KPI A;  3RZO I;  4NBB A;  5A2Q b;  3G6E 1;  2R92 I;  3VMG A;  3HOZ I;  4RS4 A;  2JS4 A;  3I07 A;  3D9X A;  1WCM I;  2RT9 A;  4MD8 A;  1YIJ Z;  2ZAE B;  1I6H I;  1NUI A;  1JWH C;  2E2I I;  4BBS I;  1VQM Z;  1RO4 A;  3CCV 1;  3MZL B;  1KQS Z;  1NJI 2;  2J6A A;  3KIH A;  1SFO I;  5C4J I;  4A3D I;  2VUM I;  4Y7N I;  3G4S 1;  4BY1 I;  2OZK A;  3F3P C;  3MON A;  3CCU 1;  2V8I A;  3G71 1;  3OW2 Y;  3TE5 B;  2E9H A;  4NBE A;  3HKZ A;  1YI2 1;  3NFZ A;  3CC7 Z;  1YJW 1;  3CCE 1;  1YIT Z;  1YJ9 Z;  2PM9 A;  3J7A 4;  1Q81 2;  4HH4 A;  3MZK B;  3CQZ I;  2KI7 B;  3M3Y I;  3JAM b;  3HOV I;  1VQL Z;  2QA4 1;  1YHQ Z;  3J81 f;  1Z02 A;  1M1K 2;  3QWU A;  3FQM A;  3KIF A;  2GTI A;  1VQ6 1;  2OTJ Z;  3JAM f;  1KD1 2;  3S15 I;  4RVG A;  1KC8 2;  3GTJ I;  5IP7 I;  4DK1 A;  1X3Z A;  4A3M I;  2RIQ A;  1QVG Z;  3S16 I;  4RVH A;  1YIJ 1;  2R7Z I;  1KRL A;  1RNI A;  1K8A 1;  3GTM S;  1VQM 1;  3CCV Z;  5T67 A;  4E2Z A;  3CXC Z;  1PFT A;  4NBH A;  3S1M I;  3NH8 A;  2LIY A;  4RV9 A;  4XX2 A;  4A3L I;  4NOZ A;  1NP6 A;  1WII A;  3G71 Z;  4A93 I;  1TWC I;  1YJW Z;  1YUA A;  1YIT 1;  1YJ9 1;  2BJO A;  2RBL A;  4E30 A;  2P3Y A;  2F4M A;  2I3C A;  3CCL 1;  4NH1 C;  1N8R 2;  1Q86 2;  2IZ4 A;  1Q81 1;  3CC4 1;  3BG1 B;  3NDJ A;  1TWH I;  3CME Z;  3GTP I;  2V8J A;  3TDH B;  3CC2 1;  3F3F C;  5D1P A;  2F4O A;  1K73 1;  2JNY A;  4A3C I;  2JA8 I;  1DL6 A;  4NB8 A;  1LQL A;  3CCR Z;  3GTK I;  1ML8 A;  3CCE Z;  4BBR I;  2G2K A;  1QYP A;  4MXU A;  3IFU A;  2Y0S A;  1JJ2 Z;  4BY7 I;  2JA6 I;  1VQL 1;  2V8K A;  3CCQ Z;  3HOY I;  5D1O A;  2OOY B;  1ZH1 A;  1YUK A;  5IT9 f;  4A3G I;  1QVF Z;  1VQ6 Z;  2JA5 I;  1VQ5 1;  5C3E I;  4A3B I;  3GTL I;  4NB9 A;  4RVF A;  3CCL Z;  3S2H I;  2RHB A;  5FLM I;  4A3F I;  2NVY I;  3CCM Z;  4CL1 A;  3S14 I;  1TWG I;  3CC4 Z;  3T4N B;  1VQ9 1;  4QTT A;  3S2D I;  4X6A I;  5FLX b;  5C44 I;  2GU2 A;  1RO2 A;  4NBF A;  4A3K I;  1ZB9 A;  3GTM I;  3VB9 A;  5LL6 f;  1R9T I;  2Q4Z A;  5A2Q f;  3PO2 I;  3I55 1;  2QLV B;  3H0G I;  1Z03 A;  3J81 b;  2E2J I;  3I4M I;  2QR1 B;  3GCF A;  1VQ8 1;  4E2W A;  2K5R A;  3CCQ 1;  3GTO I;  1K8A 2;  1I50 I;  5T64 A;  1VQ7 1;  4E31 A;  2JUB A;  2JA7 I;  3CPW Z;  1USP A;  2QEX 1;  4NBC A;  3FKI I;  3CME 1;  1JJ2 Y;  1VQK Z;  3CC2 Z;  1QF8 A;  1RO0 A;  1VLA A;  4E32 A;  1Q7Y 2;  2DE6 A;  3IX0 A;  4E33 A;  1L1O C;  4MD7 A;  1N2F A;  4RVD A;  1Y1V S;  3CCM 1;  5IP9 I;  1KC8 1;  2IZ3 A;  3CCR 1;  2VUG A;  3VMH A;  3CCS 1;  3U50 C;  4A3E I;  3GKQ A;  2R93 I;  5CM2 M;  1TFI A;  1ZB8 A;  1M90 1;  3K7A I;  2NVX I;  1VQN Z;  3NH5 A;  4TNU A;  4NBG A;  4HGZ A;  3BG0 B;  1P9N A;  3IF8 A;  1VQO 1;  2QRD B;  2YAD A;  3I56 Z;  1VQ5 Z;  1I3Q I;  5AN9 F;  3PO3 I;  3S1Q I;  1KQS Y;  2WAQ A;  2P28 A;  2W03 A;  1QVF Y;  4MRI A;  4HGY A;  2K3R A;  1VQ9 Z;  5T6B A;  3CMA 1;  2R6M A;  1K83 I;  2Q51 A;  1S7M A;  1M90 2;  2JMO A;  1VQK 1;  3PO3 S;  2QKD A;  2QRC B;  3J80 f;  5C4X I;  3HOW I;  1VQP Z;  2JR6 A;  3I55 Z;  3CPW Y;  3CCS Z;  1Q7Y 1;  3FQQ A;  1VQ8 Z;  1X0T A;  4QTU A;  3Q87 A;  2OTL 1;  5IT9 b;  3CCJ 1;  4BXX I;  1VQN 1;  2NVQ I;  2PMZ A;  1YJN Z;  3GTG I;  1VQ7 Z;  1K9M 2;  2HU9 A;  3S1R I;  3GTQ I;  3P5J B;  2DE5 A;  2QEX Z;  1VQ4 Z;  1Q82 1;  4AYB A;  1X3W A;  3G6E Z;  3HOU I;  5FLX f;  3LUS A;  3NDI A;  2AKL A;  4MD9 A;  2RPR A;  4NBD A;  3CD6 1;  1Q82 2;  4E2Y A;  1Z01 A;  1USP B;  2VF1 A;  1VQP 1;  3J80 b;  2LFU A;  1N8R 1;  2GTH A;  2PK7 A;  3VTN A;  4E2X A;  3CCU Z;  4Y52 I;  3EER A;  4NBA A;  3S1N I;  2NVT I;  4A3J I;  1VQO Z;  3I56 1;  3ESW A;  1S72 1;  1NJI 1;  1M1K 1;  2W04 A;  2OTL Z;  3S17 I;  3CCJ Z;  4DQY B;  1Y1W I;  1RLY A;  3VMI A;  2QRE B;  1WW9 A;  3RZD I;  3I4N I;  4A3I I;  2DE7 A;  1YHQ 1;  3CMA Z;  3OW2 Z;  1VQ4 1;  3NH4 A;  2EGT A;  2OOX B;  1QVG Y;  4EWC A;  2M6N A;  1Q86 1;  1KD1 1;  1K73 2;  1W2B Z;  3HOX I;  2OTJ 1;  3G4S Z;  3M4O I;  2O4H A;  3CXC Y;  4DGL A;  2O53 A;  5D1O B;  3H3V J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...