4MONA

Orthorhombic monellin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
b'REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONELLIN
publication title Structure of monellin refined to 2.3 a resolution in the orthorhombic crystal form.
pubmed doi rcsb
molecule tags Sweet-tasting protein
total genus 6
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4monA00
4MONA 3MONA 1KRLA
chains in the Genus database with same CATH superfamily
2DE7A 5IT9b 2LFUA 1KC81 5IT9f 1K83I 2JNYA 3H3VJ 3J7A4 3CCVZ 2K3RA 3RZDI 1Y1VI 3HOVI 3NH8A 3HOZI 2LEXA 1X0TA 1QF8A 2W04A 3I561 3G4SZ 1VQ91 2JS4A 4NBFA 1KRLA 3GCFA 1Q861 2RPRA 2RT9A 4RVDA 4A3JI 2GTHA 2JMOA 5CM2M 1W2BY 1VQK1 1QVFY 3S1RI 3HOYI 2VPWA 1Z03A 4MRIA 3CPWY 2DE6A 4NBGA 4A3KI 1YUKA 3CCQ1 5T67A 1Q822 2WB1A 2GU2A 2OOXB 3CD6Z 3PO3I 4E31A 3LUSA 1YUAA 2R6MA 4A3DI 2Y0SA 1N8R1 2OTLZ 2ZAEB 2V8JA 2JIOA 3J81b 1QVGZ 3S17I 3J81f 2OZKA 4XX2A 3S2DI 3GTMS 4X6AI 3I07A 3M4OI 1M1K2 4RS4A 3G6E1 3CCV1 1K731 2V8IA 3P5JB 2NVTI 3VB9A 5D1OA 1Y8CA 3QWUA 2RIQA 2F4MA 1Q811 3HOWI 1TWCI 1VLAA 4NBDA 4HH4A 3G711 4E30A 3I56Z 1VQ9Z 1JWHC 1K8A1 3I551 1M901 4A93I 2J6AA 4RVFA 4BBSI 1WIIA 2LIYA 4MD8A 3HKZA 3GTOI 4A3CI 4NBAA 1QXFA 3NFZA 1VQKZ 1TWHI 3S15I 1VQN1 1Y1VS 1NJI2 3PO2I 3FQMA 1I3QI 3CCJ1 2WAQA 2HU9A 1RO2A 1SIWA 1Q16A 3S14I 3IFUA 2JA6I 4QTUA 2RBLA 4E32A 1L1OC 3CCQZ 1KQSY 2PM9A 1X3ZA 2IZ3A 2NVYI 1K9M2 1YJN1 3VMIA 1ML8A 1R9TI 2JIQA 1W2BZ 1DL6A 1QVFZ 4MD7A 2AYDA 3CPWZ 3G6EZ 4TNUA 2OTJ1 2Q51A 4S1TA 5C44I 5T6BA 1TWGI 1Z02A 2W03A 4EWCA 3GTLI 1YI2Z 3IX0A 3CCM1 2JA7I 4NFRA 3PO3S 1X3WA 3G71Z 1TFIA 2QKDA 4A3FI 3I4NI 1Z01A 1ZB9A 3I55Z 3JAMb 4NB9A 3JAMf 1VQP1 3CME1 1Q821 3H0GI 1TWFI 2PMZA 1USPB 2QEX1 1YJ91 4MONA 3IR7A 3GTJI 3NDIA 2VPZA 1VQNZ 3TDHB 2IZ4A 5FLMI 3CCJZ 2O4HA 4CL1A 3CCUZ 2OOYB 3CMA1 4E2WA 1M1K1 1YJNZ 3CCS1 2DE5A 2NAPA 1RLYA 4BY1I 1VQ51 2R92I 2K5RA 3VMHA 2VF1A 3BG1B 3CC71 3U50C 1YHQ1 2QR1B 1KQSZ 2OTJZ 1KD12 2YU9I 1AA6A 1WJ2A 1YI21 2YADA 3D6WA 5C4JI 1YIT1 1VQL1 3CCMZ 1Q7Y2 2QLVB 1YIJ1 5T64A 3BG0B 5C3EI 3CCE1 1NJI1 3S1NI 1SFOI 5D1PA 3KIHA 1P9NA 1VQPZ 3GKQA 3CMEZ 2E2JI 3CCL1 5IP7I 5FLXb 2O53A 5FLXf 2E7ZA 2QEXZ 1K9M1 2QRDB 1YJ9Z 4HGYA 4Y7NI 3HOXI 4A3LI 3TE5B 3CQZI 4A3GI 3CCU1 4A3MI 1N2FA 1Y1WI 3CMAZ 3J80b 2NVXI 2IV2X 4NH1C 3VMGA 5A2Qb 1S721 4NB8A 2E2II 1I6HI 1VQM1 3CCSZ 2GTIA 1LQLA 3K7AI 3I4MI 3GTKI 3IF8A 1VQ41 3RZOI 1VQ5Z 5IP9I 1WCMI 3CC7Z 1YHQZ 4MH4A 4NOZA 4DK1A 3NH4A 1WW9A 2PK7A 2VUMI 2JUBA 4RV9A 4BY7I 3FKII 4NBEA 4E33A 1YITZ 1VQ81 3F3FC 1VQLZ 2QRCB 2QA41 1YIJZ 1YJW1 3T4NB 4BBRI 2Q4ZA 1VQ71 3CCEZ 2VPYA 4DGLA 2NVQI 2JR6A 2E9HA 2V3VA 3CCR1 3CCLZ 4A3BI 1RO4A 1S7MA 1KC82 2M6NA 3EERA 5D1OB 3D9XA 3CC21 2VUGA 3GTQI 4QTTA 5C4XI 5AN9F 2VPXA 3CC4Z 3CXCY 1QYPA 4RVGA 2KPIA 3EEDA 3OW2Y 1ZB8A 1RO0A 4A3II 1NUIA 1JJ2Y 4E2XA 4DQYB 1S72Z 1I50I 1KD11 3M3YI 3GTPI 1VQMZ 1VQO1 4NBHA 1PFTA 1Q862 1VQ61 1VQ4Z 1Q7Y1 3S2HI 3S1MI 1NP6A 4E2ZA 2V45A 3MZKB 2HF1A 3F3PC 4AYBA 3S16I 2JA8I 3S1QI 2G2KA 1VQ8Z 2QREB 2QA4Z 1WZNA 2M48A 4MD9A 1YJWZ 1FDIA 1USPA 5LL6f 3VTNA 1VQ7Z 2F4OA 1N8R2 3NDJA 2H85A 2I3CA 3CCRZ 3ESWA 4RVHA 3G4S1 3KIFA 3CC2Z 2JIMA 1K732 3CC41 4NBBA 3Q87A 2R7ZI 4MXUA 2KI7B 1RNIA 3J80f 3MONA 3NH5A 1Q812 1ZH1A 2P3YA 3GTMI 2R93I 1QVGY 5A2Qf 3GTGI 2P28A 4HGZA 1K8A2 3FQQA 2JA5I 1TWAI 1VQOZ 1M902 3MZLB 3D2LA 1VQ6Z 2RHBA 2JIPA 1RQFA 4A3EI 3CD61 3CXCZ 2E2HI 4E2YA 4BXXI 2B63I 2AKLA 2JIRA 1FDOA 3OW2Z 2OTL1 3HOUI 2V8KA 2BJOA 1JJ2Z 2EGTA 4Y52I 4NBCA
chains in the Genus database with same CATH topology
2DE7A 5IT9b 2LFUA 1KC81 5IT9f 1K83I 2JNYA 3H3VJ 3J7A4 3CCVZ 2K3RA 3RZDI 1Y1VI 3HOVI 3NH8A 3HOZI 1X0TA 1QF8A 2W04A 3I561 3G4SZ 1VQ91 2JS4A 4NBFA 1KRLA 3GCFA 1Q861 2RPRA 2RT9A 4RVDA 4A3JI 2GTHA 2JMOA 5CM2M 1W2BY 1VQK1 1QVFY 3S1RI 3HOYI 1Z03A 4MRIA 3CPWY 2DE6A 4NBGA 4A3KI 1YUKA 3CCQ1 5T67A 1Q822 2WB1A 2GU2A 2OOXB 3CD6Z 3PO3I 4E31A 3LUSA 1YUAA 2R6MA 4A3DI 2Y0SA 1N8R1 2OTLZ 2ZAEB 2V8JA 1QVGZ 3J81b 3S17I 3J81f 2OZKA 4XX2A 3S2DI 3GTMS 4X6AI 3I07A 3M4OI 1M1K2 4RS4A 3G6E1 3CCV1 1K731 2V8IA 3P5JB 2NVTI 3VB9A 5D1OA 3QWUA 2RIQA 2F4MA 1Q811 3HOWI 1TWCI 1VLAA 4NBDA 4HH4A 3G711 4E30A 3I56Z 1VQ9Z 1JWHC 1K8A1 3I551 1M901 4A93I 2J6AA 4RVFA 4BBSI 1WIIA 2LIYA 4MD8A 3HKZA 3GTOI 4A3CI 4NBAA 3NFZA 1VQKZ 1TWHI 3S15I 1VQN1 1Y1VS 1NJI2 3PO2I 3FQMA 1I3QI 3CCJ1 2WAQA 2HU9A 1RO2A 3S14I 3IFUA 2JA6I 4QTUA 2RBLA 4E32A 1L1OC 3CCQZ 1KQSY 2PM9A 1X3ZA 2IZ3A 2NVYI 1K9M2 1YJN1 3VMIA 1ML8A 1R9TI 1W2BZ 1DL6A 1QVFZ 4MD7A 3CPWZ 3G6EZ 4TNUA 2OTJ1 2Q51A 4S1TA 5C44I 5T6BA 1TWGI 1Z02A 2W03A 4EWCA 3GTLI 1YI2Z 3IX0A 3CCM1 2JA7I 4NFRA 3PO3S 1X3WA 3G71Z 1TFIA 2QKDA 4A3FI 3I4NI 1Z01A 1ZB9A 3I55Z 3JAMb 4NB9A 3JAMf 1VQP1 3CME1 1Q821 3H0GI 1TWFI 2PMZA 1USPB 2QEX1 1YJ91 4MONA 3GTJI 3NDIA 1VQNZ 3TDHB 2IZ4A 5FLMI 3CCJZ 2O4HA 4CL1A 3CCUZ 2OOYB 3CMA1 4E2WA 1M1K1 1YJNZ 3CCS1 2DE5A 1RLYA 4BY1I 1VQ51 2R92I 2K5RA 3VMHA 2VF1A 3BG1B 3CC71 3U50C 1YHQ1 2QR1B 1KQSZ 2OTJZ 1KD12 2YU9I 1YI21 2YADA 3D6WA 5C4JI 1YIT1 1VQL1 3CCMZ 1Q7Y2 2QLVB 1YIJ1 5T64A 3BG0B 5C3EI 3CCE1 1NJI1 3S1NI 1SFOI 5D1PA 3KIHA 1P9NA 1VQPZ 3GKQA 3CMEZ 2E2JI 3CCL1 5IP7I 5FLXb 2O53A 5FLXf 2QEXZ 1K9M1 2QRDB 1YJ9Z 4HGYA 4Y7NI 3HOXI 4A3LI 3TE5B 3CQZI 4A3GI 3CCU1 4A3MI 1N2FA 1Y1WI 3CMAZ 3J80b 2NVXI 4NH1C 3VMGA 5A2Qb 1S721 4NB8A 2E2II 1I6HI 1VQM1 3CCSZ 2GTIA 1LQLA 3K7AI 3I4MI 3GTKI 3IF8A 1VQ41 3RZOI 1VQ5Z 5IP9I 1WCMI 3CC7Z 1YHQZ 4MH4A 4NOZA 4DK1A 3NH4A 1WW9A 2PK7A 2VUMI 2JUBA 4RV9A 4BY7I 3FKII 4NBEA 4E33A 1YITZ 1VQ81 3F3FC 1VQLZ 2QRCB 2QA41 1YIJZ 1YJW1 3T4NB 4BBRI 2Q4ZA 1VQ71 3CCEZ 4DGLA 2NVQI 2JR6A 2E9HA 3CCR1 3CCLZ 4A3BI 1RO4A 1S7MA 1KC82 2M6NA 3EERA 5D1OB 3D9XA 3CC21 2VUGA 3GTQI 4QTTA 5C4XI 5AN9F 3CC4Z 3CXCY 1QYPA 4RVGA 2KPIA 3EEDA 3OW2Y 1ZB8A 1RO0A 4A3II 1NUIA 1JJ2Y 4E2XA 4DQYB 1S72Z 1I50I 1KD11 3M3YI 3GTPI 1VQMZ 1VQO1 4NBHA 1PFTA 1Q862 1VQ61 1VQ4Z 1Q7Y1 3S2HI 3S1MI 1NP6A 4E2ZA 3MZKB 2HF1A 3F3PC 4AYBA 3S16I 2JA8I 3S1QI 2G2KA 1VQ8Z 2QREB 2QA4Z 2M48A 4MD9A 1YJWZ 1USPA 5LL6f 3VTNA 1VQ7Z 2F4OA 1N8R2 3NDJA 2H85A 2I3CA 3CCRZ 3ESWA 4RVHA 3G4S1 3KIFA 3CC2Z 1K732 3CC41 4NBBA 3Q87A 2R7ZI 4MXUA 2KI7B 1RNIA 3MONA 3J80f 3NH5A 1Q812 1ZH1A 2P3YA 3GTMI 2R93I 1QVGY 5A2Qf 3GTGI 2P28A 4HGZA 1K8A2 3FQQA 2JA5I 1TWAI 1VQOZ 1M902 3MZLB 1VQ6Z 2RHBA 4A3EI 1RQFA 3CD61 3CXCZ 2E2HI 4E2YA 4BXXI 2B63I 2AKLA 3OW2Z 2OTL1 3HOUI 2V8KA 2BJOA 1JJ2Z 2EGTA 4Y52I 4NBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MON A;  3MON A;  1KRL A; 
#chains in the Genus database with same CATH topology
 2DE7 A;  5IT9 b;  2LFU A;  1KC8 1;  5IT9 f;  1K83 I;  2JNY A;  3H3V J;  3J7A 4;  3CCV Z;  2K3R A;  3RZD I;  1Y1V I;  3HOV I;  3NH8 A;  3HOZ I;  2LEX A;  1X0T A;  1QF8 A;  2W04 A;  3I56 1;  3G4S Z;  1VQ9 1;  2JS4 A;  4NBF A;  1KRL A;  3GCF A;  1Q86 1;  2RPR A;  2RT9 A;  4RVD A;  4A3J I;  2GTH A;  2JMO A;  5CM2 M;  1W2B Y;  1VQK 1;  1QVF Y;  3S1R I;  3HOY I;  2VPW A;  1Z03 A;  4MRI A;  3CPW Y;  2DE6 A;  4NBG A;  4A3K I;  1YUK A;  3CCQ 1;  5T67 A;  1Q82 2;  2WB1 A;  2GU2 A;  2OOX B;  3CD6 Z;  3PO3 I;  4E31 A;  3LUS A;  1YUA A;  2R6M A;  4A3D I;  2Y0S A;  1N8R 1;  2OTL Z;  2ZAE B;  2V8J A;  2JIO A;  3J81 b;  1QVG Z;  3S17 I;  3J81 f;  2OZK A;  4XX2 A;  3S2D I;  3GTM S;  4X6A I;  3I07 A;  3M4O I;  1M1K 2;  4RS4 A;  3G6E 1;  3CCV 1;  1K73 1;  2V8I A;  3P5J B;  2NVT I;  3VB9 A;  5D1O A;  1Y8C A;  3QWU A;  2RIQ A;  2F4M A;  1Q81 1;  3HOW I;  1TWC I;  1VLA A;  4NBD A;  4HH4 A;  3G71 1;  4E30 A;  3I56 Z;  1VQ9 Z;  1JWH C;  1K8A 1;  3I55 1;  1M90 1;  4A93 I;  2J6A A;  4RVF A;  4BBS I;  1WII A;  2LIY A;  4MD8 A;  3HKZ A;  3GTO I;  4A3C I;  4NBA A;  1QXF A;  3NFZ A;  1VQK Z;  1TWH I;  3S15 I;  1VQN 1;  1Y1V S;  1NJI 2;  3PO2 I;  3FQM A;  1I3Q I;  3CCJ 1;  2WAQ A;  2HU9 A;  1RO2 A;  1SIW A;  1Q16 A;  3S14 I;  3IFU A;  2JA6 I;  4QTU A;  2RBL A;  4E32 A;  1L1O C;  3CCQ Z;  1KQS Y;  2PM9 A;  1X3Z A;  2IZ3 A;  2NVY I;  1K9M 2;  1YJN 1;  3VMI A;  1ML8 A;  1R9T I;  2JIQ A;  1W2B Z;  1DL6 A;  1QVF Z;  4MD7 A;  2AYD A;  3CPW Z;  3G6E Z;  4TNU A;  2OTJ 1;  2Q51 A;  4S1T A;  5C44 I;  5T6B A;  1TWG I;  1Z02 A;  2W03 A;  4EWC A;  3GTL I;  1YI2 Z;  3IX0 A;  3CCM 1;  2JA7 I;  4NFR A;  3PO3 S;  1X3W A;  3G71 Z;  1TFI A;  2QKD A;  4A3F I;  3I4N I;  1Z01 A;  1ZB9 A;  3I55 Z;  3JAM b;  4NB9 A;  3JAM f;  1VQP 1;  3CME 1;  1Q82 1;  3H0G I;  1TWF I;  2PMZ A;  1USP B;  2QEX 1;  1YJ9 1;  4MON A;  3IR7 A;  3GTJ I;  3NDI A;  2VPZ A;  1VQN Z;  3TDH B;  2IZ4 A;  5FLM I;  3CCJ Z;  2O4H A;  4CL1 A;  3CCU Z;  2OOY B;  3CMA 1;  4E2W A;  1M1K 1;  1YJN Z;  3CCS 1;  2DE5 A;  2NAP A;  1RLY A;  4BY1 I;  1VQ5 1;  2R92 I;  2K5R A;  3VMH A;  2VF1 A;  3BG1 B;  3CC7 1;  3U50 C;  1YHQ 1;  2QR1 B;  1KQS Z;  2OTJ Z;  1KD1 2;  2YU9 I;  1AA6 A;  1WJ2 A;  1YI2 1;  2YAD A;  3D6W A;  5C4J I;  1YIT 1;  1VQL 1;  3CCM Z;  1Q7Y 2;  2QLV B;  1YIJ 1;  5T64 A;  3BG0 B;  5C3E I;  3CCE 1;  1NJI 1;  3S1N I;  1SFO I;  5D1P A;  3KIH A;  1P9N A;  1VQP Z;  3GKQ A;  3CME Z;  2E2J I;  3CCL 1;  5IP7 I;  5FLX b;  2O53 A;  5FLX f;  2E7Z A;  2QEX Z;  1K9M 1;  2QRD B;  1YJ9 Z;  4HGY A;  4Y7N I;  3HOX I;  4A3L I;  3TE5 B;  3CQZ I;  4A3G I;  3CCU 1;  4A3M I;  1N2F A;  1Y1W I;  3CMA Z;  3J80 b;  2NVX I;  2IV2 X;  4NH1 C;  3VMG A;  5A2Q b;  1S72 1;  4NB8 A;  2E2I I;  1I6H I;  1VQM 1;  3CCS Z;  2GTI A;  1LQL A;  3K7A I;  3I4M I;  3GTK I;  3IF8 A;  1VQ4 1;  3RZO I;  1VQ5 Z;  5IP9 I;  1WCM I;  3CC7 Z;  1YHQ Z;  4MH4 A;  4NOZ A;  4DK1 A;  3NH4 A;  1WW9 A;  2PK7 A;  2VUM I;  2JUB A;  4RV9 A;  4BY7 I;  3FKI I;  4NBE A;  4E33 A;  1YIT Z;  1VQ8 1;  3F3F C;  1VQL Z;  2QRC B;  2QA4 1;  1YIJ Z;  1YJW 1;  3T4N B;  4BBR I;  2Q4Z A;  1VQ7 1;  3CCE Z;  2VPY A;  4DGL A;  2NVQ I;  2JR6 A;  2E9H A;  2V3V A;  3CCR 1;  3CCL Z;  4A3B I;  1RO4 A;  1S7M A;  1KC8 2;  2M6N A;  3EER A;  5D1O B;  3D9X A;  3CC2 1;  2VUG A;  3GTQ I;  4QTT A;  5C4X I;  5AN9 F;  2VPX A;  3CC4 Z;  3CXC Y;  1QYP A;  4RVG A;  2KPI A;  3EED A;  3OW2 Y;  1ZB8 A;  1RO0 A;  4A3I I;  1NUI A;  1JJ2 Y;  4E2X A;  4DQY B;  1S72 Z;  1I50 I;  1KD1 1;  3M3Y I;  3GTP I;  1VQM Z;  1VQO 1;  4NBH A;  1PFT A;  1Q86 2;  1VQ6 1;  1VQ4 Z;  1Q7Y 1;  3S2H I;  3S1M I;  1NP6 A;  4E2Z A;  2V45 A;  3MZK B;  2HF1 A;  3F3P C;  4AYB A;  3S16 I;  2JA8 I;  3S1Q I;  2G2K A;  1VQ8 Z;  2QRE B;  2QA4 Z;  1WZN A;  2M48 A;  4MD9 A;  1YJW Z;  1FDI A;  1USP A;  5LL6 f;  3VTN A;  1VQ7 Z;  2F4O A;  1N8R 2;  3NDJ A;  2H85 A;  2I3C A;  3CCR Z;  3ESW A;  4RVH A;  3G4S 1;  3KIF A;  3CC2 Z;  2JIM A;  1K73 2;  3CC4 1;  4NBB A;  3Q87 A;  2R7Z I;  4MXU A;  2KI7 B;  1RNI A;  3J80 f;  3MON A;  3NH5 A;  1Q81 2;  1ZH1 A;  2P3Y A;  3GTM I;  2R93 I;  1QVG Y;  5A2Q f;  3GTG I;  2P28 A;  4HGZ A;  1K8A 2;  3FQQ A;  2JA5 I;  1TWA I;  1VQO Z;  1M90 2;  3MZL B;  3D2L A;  1VQ6 Z;  2RHB A;  2JIP A;  1RQF A;  4A3E I;  3CD6 1;  3CXC Z;  2E2H I;  4E2Y A;  4BXX I;  2B63 I;  2AKL A;  2JIR A;  1FDO A;  3OW2 Z;  2OTL 1;  3HOU I;  2V8K A;  2BJO A;  1JJ2 Z;  2EGT A;  4Y52 I;  4NBC A; 
#chains in the Genus database with same CATH homology
 2DE7 A;  5IT9 b;  2LFU A;  1KC8 1;  5IT9 f;  1K83 I;  2JNY A;  3H3V J;  3J7A 4;  3CCV Z;  2K3R A;  3RZD I;  1Y1V I;  3HOV I;  3NH8 A;  3HOZ I;  1X0T A;  1QF8 A;  2W04 A;  3I56 1;  3G4S Z;  1VQ9 1;  2JS4 A;  4NBF A;  1KRL A;  3GCF A;  1Q86 1;  2RPR A;  2RT9 A;  4RVD A;  4A3J I;  2GTH A;  2JMO A;  5CM2 M;  1W2B Y;  1VQK 1;  1QVF Y;  3S1R I;  3HOY I;  1Z03 A;  4MRI A;  3CPW Y;  2DE6 A;  4NBG A;  4A3K I;  1YUK A;  3CCQ 1;  5T67 A;  1Q82 2;  2WB1 A;  2GU2 A;  2OOX B;  3CD6 Z;  3PO3 I;  4E31 A;  3LUS A;  1YUA A;  2R6M A;  4A3D I;  2Y0S A;  1N8R 1;  2OTL Z;  2ZAE B;  2V8J A;  1QVG Z;  3J81 b;  3S17 I;  3J81 f;  2OZK A;  4XX2 A;  3S2D I;  3GTM S;  4X6A I;  3I07 A;  3M4O I;  1M1K 2;  4RS4 A;  3G6E 1;  3CCV 1;  1K73 1;  2V8I A;  3P5J B;  2NVT I;  3VB9 A;  5D1O A;  3QWU A;  2RIQ A;  2F4M A;  1Q81 1;  3HOW I;  1TWC I;  1VLA A;  4NBD A;  4HH4 A;  3G71 1;  4E30 A;  3I56 Z;  1VQ9 Z;  1JWH C;  1K8A 1;  3I55 1;  1M90 1;  4A93 I;  2J6A A;  4RVF A;  4BBS I;  1WII A;  2LIY A;  4MD8 A;  3HKZ A;  3GTO I;  4A3C I;  4NBA A;  3NFZ A;  1VQK Z;  1TWH I;  3S15 I;  1VQN 1;  1Y1V S;  1NJI 2;  3PO2 I;  3FQM A;  1I3Q I;  3CCJ 1;  2WAQ A;  2HU9 A;  1RO2 A;  3S14 I;  3IFU A;  2JA6 I;  4QTU A;  2RBL A;  4E32 A;  1L1O C;  3CCQ Z;  1KQS Y;  2PM9 A;  1X3Z A;  2IZ3 A;  2NVY I;  1K9M 2;  1YJN 1;  3VMI A;  1ML8 A;  1R9T I;  1W2B Z;  1DL6 A;  1QVF Z;  4MD7 A;  3CPW Z;  3G6E Z;  4TNU A;  2OTJ 1;  2Q51 A;  4S1T A;  5C44 I;  5T6B A;  1TWG I;  1Z02 A;  2W03 A;  4EWC A;  3GTL I;  1YI2 Z;  3IX0 A;  3CCM 1;  2JA7 I;  4NFR A;  3PO3 S;  1X3W A;  3G71 Z;  1TFI A;  2QKD A;  4A3F I;  3I4N I;  1Z01 A;  1ZB9 A;  3I55 Z;  3JAM b;  4NB9 A;  3JAM f;  1VQP 1;  3CME 1;  1Q82 1;  3H0G I;  1TWF I;  2PMZ A;  1USP B;  2QEX 1;  1YJ9 1;  4MON A;  3GTJ I;  3NDI A;  1VQN Z;  3TDH B;  2IZ4 A;  5FLM I;  3CCJ Z;  2O4H A;  4CL1 A;  3CCU Z;  2OOY B;  3CMA 1;  4E2W A;  1M1K 1;  1YJN Z;  3CCS 1;  2DE5 A;  1RLY A;  4BY1 I;  1VQ5 1;  2R92 I;  2K5R A;  3VMH A;  2VF1 A;  3BG1 B;  3CC7 1;  3U50 C;  1YHQ 1;  2QR1 B;  1KQS Z;  2OTJ Z;  1KD1 2;  2YU9 I;  1YI2 1;  2YAD A;  3D6W A;  5C4J I;  1YIT 1;  1VQL 1;  3CCM Z;  1Q7Y 2;  2QLV B;  1YIJ 1;  5T64 A;  3BG0 B;  5C3E I;  3CCE 1;  1NJI 1;  3S1N I;  1SFO I;  5D1P A;  3KIH A;  1P9N A;  1VQP Z;  3GKQ A;  3CME Z;  2E2J I;  3CCL 1;  5IP7 I;  5FLX b;  2O53 A;  5FLX f;  2QEX Z;  1K9M 1;  2QRD B;  1YJ9 Z;  4HGY A;  4Y7N I;  3HOX I;  4A3L I;  3TE5 B;  3CQZ I;  4A3G I;  3CCU 1;  4A3M I;  1N2F A;  1Y1W I;  3CMA Z;  3J80 b;  2NVX I;  4NH1 C;  3VMG A;  5A2Q b;  1S72 1;  4NB8 A;  2E2I I;  1I6H I;  1VQM 1;  3CCS Z;  2GTI A;  1LQL A;  3K7A I;  3I4M I;  3GTK I;  3IF8 A;  1VQ4 1;  3RZO I;  1VQ5 Z;  5IP9 I;  1WCM I;  3CC7 Z;  1YHQ Z;  4MH4 A;  4NOZ A;  4DK1 A;  3NH4 A;  1WW9 A;  2PK7 A;  2VUM I;  2JUB A;  4RV9 A;  4BY7 I;  3FKI I;  4NBE A;  4E33 A;  1YIT Z;  1VQ8 1;  3F3F C;  1VQL Z;  2QRC B;  2QA4 1;  1YIJ Z;  1YJW 1;  3T4N B;  4BBR I;  2Q4Z A;  1VQ7 1;  3CCE Z;  4DGL A;  2NVQ I;  2JR6 A;  2E9H A;  3CCR 1;  3CCL Z;  4A3B I;  1RO4 A;  1S7M A;  1KC8 2;  2M6N A;  3EER A;  5D1O B;  3D9X A;  3CC2 1;  2VUG A;  3GTQ I;  4QTT A;  5C4X I;  5AN9 F;  3CC4 Z;  3CXC Y;  1QYP A;  4RVG A;  2KPI A;  3EED A;  3OW2 Y;  1ZB8 A;  1RO0 A;  4A3I I;  1NUI A;  1JJ2 Y;  4E2X A;  4DQY B;  1S72 Z;  1I50 I;  1KD1 1;  3M3Y I;  3GTP I;  1VQM Z;  1VQO 1;  4NBH A;  1PFT A;  1Q86 2;  1VQ6 1;  1VQ4 Z;  1Q7Y 1;  3S2H I;  3S1M I;  1NP6 A;  4E2Z A;  3MZK B;  2HF1 A;  3F3P C;  4AYB A;  3S16 I;  2JA8 I;  3S1Q I;  2G2K A;  1VQ8 Z;  2QRE B;  2QA4 Z;  2M48 A;  4MD9 A;  1YJW Z;  1USP A;  5LL6 f;  3VTN A;  1VQ7 Z;  2F4O A;  1N8R 2;  3NDJ A;  2H85 A;  2I3C A;  3CCR Z;  3ESW A;  4RVH A;  3G4S 1;  3KIF A;  3CC2 Z;  1K73 2;  3CC4 1;  4NBB A;  3Q87 A;  2R7Z I;  4MXU A;  2KI7 B;  1RNI A;  3MON A;  3J80 f;  3NH5 A;  1Q81 2;  1ZH1 A;  2P3Y A;  3GTM I;  2R93 I;  1QVG Y;  5A2Q f;  3GTG I;  2P28 A;  4HGZ A;  1K8A 2;  3FQQ A;  2JA5 I;  1TWA I;  1VQO Z;  1M90 2;  3MZL B;  1VQ6 Z;  2RHB A;  4A3E I;  1RQF A;  3CD6 1;  3CXC Z;  2E2H I;  4E2Y A;  4BXX I;  2B63 I;  2AKL A;  3OW2 Z;  2OTL 1;  3HOU I;  2V8K A;  2BJO A;  1JJ2 Z;  2EGT A;  4Y52 I;  4NBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...