4MONA

Orthorhombic monellin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sweet-tasting protein
molecule keywords MONELLIN
publication title Structure of monellin refined to 2.3 a resolution in the orthorhombic crystal form.
pubmed doi rcsb
total genus 6
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4monA00
1KRLA 4MONA 3MONA
chains in the Genus database with same CATH superfamily
4MD9A 1W2BY 2GTIA 1VQ6Z 3I4NI 3CCQ1 2LIYA 3OW2Z 1Q7Y1 2NVXI 2R92I 3Q87A 3HKZA 2RT9A 1VQLZ 2QEX1 2DE5A 3TDHB 3CCU1 3G6E1 2W04A 1Q811 1Q862 4RVDA 5IT9b 2DE7A 3S1NI 2QR1B 2DE6A 4HGYA 2E2HI 3CD6Z 2JIPA 3CCR1 2PK7A 1Y8CA 2F4OA 3CPWY 2JA6I 3NH4A 1YITZ 3H0GI 3CCMZ 1Y1VS 1VQP1 4E31A 3HOZI 1M1K2 2GTHA 5C4JI 2O53A 1VQM1 3S16I 2NVQI 3T4NB 4Y52I 4NB9A 4BY1I 4MXUA 3I4MI 4TNUA 1YHQZ 1RO2A 2JIQA 2O4HA 5C3EI 2OOXB 1YJWZ 2JIOA 3VMIA 1X3WA 3FQMA 5FLMI 2OTL1 1P9NA 4AYBA 3IX0A 1ZB8A 3NFZA 1RLYA 2R7ZI 1R9TI 3NH8A 1AA6A 3S1QI 4A3BI 2P28A 4E2XA 1VQ4Z 1SIWA 2WB1A 1WJ2A 3FQQA 4S1TA 1JJ2Z 3BG0B 3HOUI 3CC41 5FLXb 1YJN1 1M901 3PO2I 1QVGY 3GCFA 1VQN1 1KD11 1Q16A 2VF1A 3F3FC 1L1OC 2OZKA 1NJI2 5T64A 2VPZA 1VQ9Z 1N8R2 5IP7I 1TFIA 4MD7A 4QTUA 1VQ51 3NDIA 1VQK1 2R6MA 4EWCA 4Y7NI 2JR6A 2QLVB 1W2BZ 1VQO1 5A2Qf 3CCV1 4X6AI 1RNIA 2V8JA 2VPWA 1YI2Z 3GTKI 1TWCI 4E2YA 3G71Z 5D1PA 4A3JI 1FDIA 2EGTA 4NBCA 2G2KA 1K8A1 2WAQA 4A3LI 1NP6A 1WZNA 1QF8A 1S7MA 1VQ61 3GTGI 4RS4A 2ZAEB 3CCEZ 5C44I 3K7AI 3BG1B 4RV9A 1WIIA 1TWFI 3CPWZ 3I561 1VQL1 4A3EI 2KPIA 3CCQZ 1I3QI 3CQZI 5D1OB 3EEDA 2E7ZA 5CM2M 3CC7Z 1K9M1 3S1RI 3VB9A 3J80f 3CC2Z 2OTJZ 1Q7Y2 3CD61 1USPB 1WW9A 1TWGI 1Z01A 1YIJZ 2E2JI 4A3KI 4E2ZA 3D6WA 3I55Z 3PO3I 1K731 1X3ZA 2V45A 5D1OA 4RVGA 4RVFA 1Q812 2NAPA 5C4XI 1RO4A 4NH1C 1SFOI 3HOWI 3J81f 1USPA 3D2LA 5IP9I 3S1MI 1ZB9A 5T67A 3CMEZ 4BBSI 1RQFA 4CL1A 1VQ8Z 3JAMb 1YHQ1 4NBDA 1VLAA 4RVHA 1KQSY 1VQ71 2YU9I 2Q4ZA 2IZ3A 1JWHC 3F3PC 1YJW1 3CCSZ 2QRDB 3KIFA 3VMGA 3FKII 2J6AA 3NDJA 2V8KA 2K5RA 3IFUA 2BJOA 2VUGA 4HGZA 2JS4A 2JIMA 1Q821 1QVGZ 4NB8A 4MD8A 4NFRA 3CMAZ 3CCL1 2JUBA 1YUKA 2PMZA 1YJ9Z 1VQ41 2I3CA 3S2HI 2Q51A 4NBBA 2JA7I 2HU9A 4MRIA 4HH4A 4NOZA 1KC81 3GTPI 3RZOI 1I50I 4A93I 2IV2X 3GTQI 5IT9f 3J80b 4A3DI 2R93I 4E32A 3S14I 3QWUA 3GKQA 3MZLB 1QYPA 3TE5B 1VQ91 1NUIA 2H85A 3CCJZ 3U50C 3D9XA 1I6HI 5T6BA 1S72Z 1DL6A 3MZKB 1QVFY 1M902 3GTLI 3HOYI 1KD12 2JA8I 4BBRI 3KIHA 2JMOA 2B63I 1YI21 3G711 2QA41 2LEXA 2OOYB 2QREB 3PO3S 4NBAA 3G4SZ 2K3RA 1VQOZ 3CCVZ 2YADA 3GTMS 2M6NA 4E30A 2E2II 3S15I 2NVTI 3HOVI 3GTJI 3IF8A 4NBGA 2M48A 1Q861 2VPXA 3ESWA 2Y0SA 3IR7A 2RBLA 1K8A2 4MONA 2V8IA 3CXCZ 1Z02A 2HF1A 2PM9A 3M3YI 1PFTA 3CC71 2QEXZ 3CC21 3CCUZ 2JNYA 2VPYA 3G6EZ 3I56Z 1M1K1 2OTJ1 5FLXf 3CXCY 1YIJ1 1YIT1 3CCM1 3VTNA 3GTMI 3I551 3OW2Y 1N2FA 3M4OI 2RHBA 3CCRZ 2IZ4A 1KQSZ 1TWHI 1YUAA 3S17I 2AYDA 1K9M2 2JIRA 4DK1A 2LFUA 1VQPZ 2W03A 2QKDA 2AKLA 3H3VJ 1Z03A 3CME1 5A2Qb 2GU2A 1KRLA 1VQ81 1K732 4E2WA 1VQMZ 4BXXI 3NH5A 4DQYB 4A3MI 2JA5I 1WCMI 3CCS1 3VMHA 2F4MA 1RO0A 3LUSA 4A3CI 1VQ7Z 4BY7I 2OTLZ 3GTOI 4A3II 1ML8A 4XX2A 4MH4A 3J7A4 5AN9F 4A3GI 3CMA1 1Y1WI 4DGLA 1Y1VI 1YJ91 1NJI1 3RZDI 2RPRA 3MONA 3CCLZ 3HOXI 1Q822 1QVFZ 2E9HA 4A3FI 1N8R1 1YJNZ 3CC4Z 1ZH1A 1FDOA 1QXFA 1VQNZ 2NVYI 4QTTA 2VUMI 4NBEA 3CCJ1 3EERA 2RIQA 1KC82 1S721 3J81b 2V3VA 2P3YA 1JJ2Y 4NBFA 2QRCB 1VQ5Z 1VQKZ 1TWAI 2KI7B 3JAMf 4NBHA 3G4S1 1K83I 1LQLA 1X0TA 3CCE1 2QA4Z 4E33A 5LL6f 3S2DI 3I07A 3P5JB
chains in the Genus database with same CATH topology
4MD9A 1W2BY 2GTIA 1VQ6Z 3I4NI 3CCQ1 2LIYA 3OW2Z 1Q7Y1 2NVXI 2R92I 3Q87A 3HKZA 2RT9A 1VQLZ 2QEX1 2DE5A 3TDHB 3CCU1 3G6E1 2W04A 1Q811 1Q862 4RVDA 5IT9b 2DE7A 3S1NI 2QR1B 2DE6A 4HGYA 2E2HI 3CD6Z 3CCR1 2PK7A 2F4OA 3CPWY 2JA6I 3NH4A 1YITZ 3H0GI 1VQP1 3CCMZ 1Y1VS 4E31A 3HOZI 1M1K2 2GTHA 5C4JI 2O53A 1VQM1 3S16I 2NVQI 3T4NB 4Y52I 4NB9A 4BY1I 4MXUA 3I4MI 4TNUA 1YHQZ 1RO2A 2O4HA 5C3EI 2OOXB 1YJWZ 3VMIA 1X3WA 3FQMA 5FLMI 2OTL1 1P9NA 4AYBA 3IX0A 1ZB8A 3NFZA 1RLYA 2R7ZI 1R9TI 3NH8A 3S1QI 4A3BI 2P28A 4E2XA 1VQ4Z 2WB1A 3FQQA 4S1TA 1JJ2Z 3BG0B 3HOUI 3CC41 5FLXb 1YJN1 1M901 3PO2I 1QVGY 3GCFA 1VQN1 1KD11 2VF1A 3F3FC 1L1OC 2OZKA 1NJI2 5T64A 1VQ9Z 1N8R2 5IP7I 1TFIA 4MD7A 4QTUA 1VQ51 3NDIA 1VQK1 2R6MA 4EWCA 4Y7NI 2JR6A 2QLVB 1W2BZ 1VQO1 5A2Qf 3CCV1 4X6AI 1RNIA 2V8JA 1YI2Z 3GTKI 1TWCI 4E2YA 3G71Z 5D1PA 4A3JI 2EGTA 4NBCA 2G2KA 1K8A1 2WAQA 4A3LI 1NP6A 1QF8A 1S7MA 1VQ61 3GTGI 4RS4A 2ZAEB 3CCEZ 5C44I 3K7AI 3BG1B 4RV9A 1WIIA 1TWFI 3CPWZ 3I561 1VQL1 4A3EI 2KPIA 3CCQZ 1I3QI 3CQZI 5D1OB 3EEDA 5CM2M 3CC7Z 1K9M1 3S1RI 3VB9A 3J80f 3CC2Z 2OTJZ 1Q7Y2 3CD61 1USPB 1WW9A 1TWGI 1Z01A 1YIJZ 2E2JI 4A3KI 4E2ZA 3D6WA 3I55Z 3PO3I 1K731 1X3ZA 5D1OA 4RVGA 4RVFA 1Q812 5C4XI 1RO4A 4NH1C 1SFOI 3HOWI 3J81f 1USPA 5IP9I 3S1MI 1ZB9A 5T67A 3CMEZ 4BBSI 1RQFA 4CL1A 1VQ8Z 3JAMb 1YHQ1 4NBDA 1VLAA 4RVHA 1KQSY 1VQ71 2YU9I 2Q4ZA 2IZ3A 1JWHC 3F3PC 1YJW1 3CCSZ 2QRDB 3KIFA 3VMGA 3FKII 2J6AA 3NDJA 2V8KA 2K5RA 3IFUA 2BJOA 2VUGA 4HGZA 2JS4A 1Q821 1QVGZ 4NB8A 4MD8A 4NFRA 3CMAZ 3CCL1 2JUBA 1YUKA 2PMZA 1YJ9Z 1VQ41 2I3CA 3S2HI 2Q51A 4NBBA 2JA7I 2HU9A 4MRIA 4HH4A 4NOZA 1KC81 3GTPI 3RZOI 1I50I 4A93I 3GTQI 5IT9f 3J80b 4A3DI 2R93I 4E32A 3S14I 3QWUA 3GKQA 3MZLB 1QYPA 3TE5B 1VQ91 1NUIA 2H85A 3CCJZ 3U50C 3D9XA 1I6HI 5T6BA 1S72Z 1DL6A 3MZKB 1QVFY 1M902 3GTLI 3HOYI 1KD12 2JA8I 4BBRI 3KIHA 2JMOA 2B63I 1YI21 3G711 2QA41 2OOYB 2QREB 3PO3S 4NBAA 3G4SZ 2K3RA 1VQOZ 3CCVZ 2YADA 3GTMS 2M6NA 4E30A 2E2II 3S15I 2NVTI 3HOVI 3GTJI 3IF8A 4NBGA 2M48A 1Q861 3ESWA 2Y0SA 2RBLA 1K8A2 4MONA 2V8IA 3CXCZ 1Z02A 2HF1A 2PM9A 3M3YI 1PFTA 3CC71 2QEXZ 3CC21 3CCUZ 2JNYA 3G6EZ 1M1K1 3I56Z 2OTJ1 5FLXf 3CXCY 1YIJ1 1YIT1 3CCM1 3VTNA 3GTMI 3I551 3OW2Y 1N2FA 3M4OI 2RHBA 3CCRZ 2IZ4A 1KQSZ 1TWHI 1YUAA 3S17I 1K9M2 4DK1A 2LFUA 1VQPZ 2W03A 2QKDA 2AKLA 3H3VJ 1Z03A 3CME1 5A2Qb 2GU2A 1KRLA 1VQ81 1K732 4E2WA 1VQMZ 4BXXI 3NH5A 4DQYB 4A3MI 2JA5I 1WCMI 3CCS1 3VMHA 2F4MA 1RO0A 3LUSA 4A3CI 1VQ7Z 4BY7I 2OTLZ 3GTOI 4A3II 1ML8A 4XX2A 4MH4A 3J7A4 5AN9F 4A3GI 3CMA1 1Y1WI 4DGLA 1Y1VI 1YJ91 1NJI1 3RZDI 2RPRA 3MONA 3CCLZ 3HOXI 1Q822 1QVFZ 2E9HA 4A3FI 1N8R1 1YJNZ 3CC4Z 1ZH1A 1VQNZ 2NVYI 4QTTA 2VUMI 4NBEA 3CCJ1 3EERA 2RIQA 1KC82 1S721 3J81b 2P3YA 1JJ2Y 4NBFA 2QRCB 1VQ5Z 1VQKZ 1TWAI 2KI7B 3JAMf 4NBHA 3G4S1 1K83I 1LQLA 1X0TA 3CCE1 2QA4Z 4E33A 5LL6f 3S2DI 3I07A 3P5JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRL A;  4MON A;  3MON A; 
#chains in the Genus database with same CATH topology
 4MD9 A;  1W2B Y;  2GTI A;  1VQ6 Z;  3I4N I;  3CCQ 1;  2LIY A;  3OW2 Z;  1Q7Y 1;  2NVX I;  2R92 I;  3Q87 A;  3HKZ A;  2RT9 A;  1VQL Z;  2QEX 1;  2DE5 A;  3TDH B;  3CCU 1;  3G6E 1;  2W04 A;  1Q81 1;  1Q86 2;  4RVD A;  5IT9 b;  2DE7 A;  3S1N I;  2QR1 B;  2DE6 A;  4HGY A;  2E2H I;  3CD6 Z;  2JIP A;  3CCR 1;  2PK7 A;  1Y8C A;  2F4O A;  3CPW Y;  2JA6 I;  3NH4 A;  1YIT Z;  3H0G I;  3CCM Z;  1Y1V S;  1VQP 1;  4E31 A;  3HOZ I;  1M1K 2;  2GTH A;  5C4J I;  2O53 A;  1VQM 1;  3S16 I;  2NVQ I;  3T4N B;  4Y52 I;  4NB9 A;  4BY1 I;  4MXU A;  3I4M I;  4TNU A;  1YHQ Z;  1RO2 A;  2JIQ A;  2O4H A;  5C3E I;  2OOX B;  1YJW Z;  2JIO A;  3VMI A;  1X3W A;  3FQM A;  5FLM I;  2OTL 1;  1P9N A;  4AYB A;  3IX0 A;  1ZB8 A;  3NFZ A;  1RLY A;  2R7Z I;  1R9T I;  3NH8 A;  1AA6 A;  3S1Q I;  4A3B I;  2P28 A;  4E2X A;  1VQ4 Z;  1SIW A;  2WB1 A;  1WJ2 A;  3FQQ A;  4S1T A;  1JJ2 Z;  3BG0 B;  3HOU I;  3CC4 1;  5FLX b;  1YJN 1;  1M90 1;  3PO2 I;  1QVG Y;  3GCF A;  1VQN 1;  1KD1 1;  1Q16 A;  2VF1 A;  3F3F C;  1L1O C;  2OZK A;  1NJI 2;  5T64 A;  2VPZ A;  1VQ9 Z;  1N8R 2;  5IP7 I;  1TFI A;  4MD7 A;  4QTU A;  1VQ5 1;  3NDI A;  1VQK 1;  2R6M A;  4EWC A;  4Y7N I;  2JR6 A;  2QLV B;  1W2B Z;  1VQO 1;  5A2Q f;  3CCV 1;  4X6A I;  1RNI A;  2V8J A;  2VPW A;  1YI2 Z;  3GTK I;  1TWC I;  4E2Y A;  3G71 Z;  5D1P A;  4A3J I;  1FDI A;  2EGT A;  4NBC A;  2G2K A;  1K8A 1;  2WAQ A;  4A3L I;  1NP6 A;  1WZN A;  1QF8 A;  1S7M A;  1VQ6 1;  3GTG I;  4RS4 A;  2ZAE B;  3CCE Z;  5C44 I;  3K7A I;  3BG1 B;  4RV9 A;  1WII A;  1TWF I;  3CPW Z;  3I56 1;  1VQL 1;  4A3E I;  2KPI A;  3CCQ Z;  1I3Q I;  3CQZ I;  5D1O B;  3EED A;  2E7Z A;  5CM2 M;  3CC7 Z;  1K9M 1;  3S1R I;  3VB9 A;  3J80 f;  3CC2 Z;  2OTJ Z;  1Q7Y 2;  3CD6 1;  1USP B;  1WW9 A;  1TWG I;  1Z01 A;  1YIJ Z;  2E2J I;  4A3K I;  4E2Z A;  3D6W A;  3I55 Z;  3PO3 I;  1K73 1;  1X3Z A;  2V45 A;  5D1O A;  4RVG A;  4RVF A;  1Q81 2;  2NAP A;  5C4X I;  1RO4 A;  4NH1 C;  1SFO I;  3HOW I;  3J81 f;  1USP A;  3D2L A;  5IP9 I;  3S1M I;  1ZB9 A;  5T67 A;  3CME Z;  4BBS I;  1RQF A;  4CL1 A;  1VQ8 Z;  3JAM b;  1YHQ 1;  4NBD A;  1VLA A;  4RVH A;  1KQS Y;  1VQ7 1;  2YU9 I;  2Q4Z A;  2IZ3 A;  1JWH C;  3F3P C;  1YJW 1;  3CCS Z;  2QRD B;  3KIF A;  3VMG A;  3FKI I;  2J6A A;  3NDJ A;  2V8K A;  2K5R A;  3IFU A;  2BJO A;  2VUG A;  4HGZ A;  2JS4 A;  2JIM A;  1Q82 1;  1QVG Z;  4NB8 A;  4MD8 A;  4NFR A;  3CMA Z;  3CCL 1;  2JUB A;  1YUK A;  2PMZ A;  1YJ9 Z;  1VQ4 1;  2I3C A;  3S2H I;  2Q51 A;  4NBB A;  2JA7 I;  2HU9 A;  4MRI A;  4HH4 A;  4NOZ A;  1KC8 1;  3GTP I;  3RZO I;  1I50 I;  4A93 I;  2IV2 X;  3GTQ I;  5IT9 f;  3J80 b;  4A3D I;  2R93 I;  4E32 A;  3S14 I;  3QWU A;  3GKQ A;  3MZL B;  1QYP A;  3TE5 B;  1VQ9 1;  1NUI A;  2H85 A;  3CCJ Z;  3U50 C;  3D9X A;  1I6H I;  5T6B A;  1S72 Z;  1DL6 A;  3MZK B;  1QVF Y;  1M90 2;  3GTL I;  3HOY I;  1KD1 2;  2JA8 I;  4BBR I;  3KIH A;  2JMO A;  2B63 I;  1YI2 1;  3G71 1;  2QA4 1;  2LEX A;  2OOY B;  2QRE B;  3PO3 S;  4NBA A;  3G4S Z;  2K3R A;  1VQO Z;  3CCV Z;  2YAD A;  3GTM S;  2M6N A;  4E30 A;  2E2I I;  3S15 I;  2NVT I;  3HOV I;  3GTJ I;  3IF8 A;  4NBG A;  2M48 A;  1Q86 1;  2VPX A;  3ESW A;  2Y0S A;  3IR7 A;  2RBL A;  1K8A 2;  4MON A;  2V8I A;  3CXC Z;  1Z02 A;  2HF1 A;  2PM9 A;  3M3Y I;  1PFT A;  3CC7 1;  2QEX Z;  3CC2 1;  3CCU Z;  2JNY A;  2VPY A;  3G6E Z;  3I56 Z;  1M1K 1;  2OTJ 1;  5FLX f;  3CXC Y;  1YIJ 1;  1YIT 1;  3CCM 1;  3VTN A;  3GTM I;  3I55 1;  3OW2 Y;  1N2F A;  3M4O I;  2RHB A;  3CCR Z;  2IZ4 A;  1KQS Z;  1TWH I;  1YUA A;  3S17 I;  2AYD A;  1K9M 2;  2JIR A;  4DK1 A;  2LFU A;  1VQP Z;  2W03 A;  2QKD A;  2AKL A;  3H3V J;  1Z03 A;  3CME 1;  5A2Q b;  2GU2 A;  1KRL A;  1VQ8 1;  1K73 2;  4E2W A;  1VQM Z;  4BXX I;  3NH5 A;  4DQY B;  4A3M I;  2JA5 I;  1WCM I;  3CCS 1;  3VMH A;  2F4M A;  1RO0 A;  3LUS A;  4A3C I;  1VQ7 Z;  4BY7 I;  2OTL Z;  3GTO I;  4A3I I;  1ML8 A;  4XX2 A;  4MH4 A;  3J7A 4;  5AN9 F;  4A3G I;  3CMA 1;  1Y1W I;  4DGL A;  1Y1V I;  1YJ9 1;  1NJI 1;  3RZD I;  2RPR A;  3MON A;  3CCL Z;  3HOX I;  1Q82 2;  1QVF Z;  2E9H A;  4A3F I;  1N8R 1;  1YJN Z;  3CC4 Z;  1ZH1 A;  1FDO A;  1QXF A;  1VQN Z;  2NVY I;  4QTT A;  2VUM I;  4NBE A;  3CCJ 1;  3EER A;  2RIQ A;  1KC8 2;  1S72 1;  3J81 b;  2V3V A;  2P3Y A;  1JJ2 Y;  4NBF A;  2QRC B;  1VQ5 Z;  1VQK Z;  1TWA I;  2KI7 B;  3JAM f;  4NBH A;  3G4S 1;  1K83 I;  1LQL A;  1X0T A;  3CCE 1;  2QA4 Z;  4E33 A;  5LL6 f;  3S2D I;  3I07 A;  3P5J B; 
#chains in the Genus database with same CATH homology
 4MD9 A;  1W2B Y;  2GTI A;  1VQ6 Z;  3I4N I;  3CCQ 1;  2LIY A;  3OW2 Z;  1Q7Y 1;  2NVX I;  2R92 I;  3Q87 A;  3HKZ A;  2RT9 A;  1VQL Z;  2QEX 1;  2DE5 A;  3TDH B;  3CCU 1;  3G6E 1;  2W04 A;  1Q81 1;  1Q86 2;  4RVD A;  5IT9 b;  2DE7 A;  3S1N I;  2QR1 B;  2DE6 A;  4HGY A;  2E2H I;  3CD6 Z;  3CCR 1;  2PK7 A;  2F4O A;  3CPW Y;  2JA6 I;  3NH4 A;  1YIT Z;  3H0G I;  1VQP 1;  3CCM Z;  1Y1V S;  4E31 A;  3HOZ I;  1M1K 2;  2GTH A;  5C4J I;  2O53 A;  1VQM 1;  3S16 I;  2NVQ I;  3T4N B;  4Y52 I;  4NB9 A;  4BY1 I;  4MXU A;  3I4M I;  4TNU A;  1YHQ Z;  1RO2 A;  2O4H A;  5C3E I;  2OOX B;  1YJW Z;  3VMI A;  1X3W A;  3FQM A;  5FLM I;  2OTL 1;  1P9N A;  4AYB A;  3IX0 A;  1ZB8 A;  3NFZ A;  1RLY A;  2R7Z I;  1R9T I;  3NH8 A;  3S1Q I;  4A3B I;  2P28 A;  4E2X A;  1VQ4 Z;  2WB1 A;  3FQQ A;  4S1T A;  1JJ2 Z;  3BG0 B;  3HOU I;  3CC4 1;  5FLX b;  1YJN 1;  1M90 1;  3PO2 I;  1QVG Y;  3GCF A;  1VQN 1;  1KD1 1;  2VF1 A;  3F3F C;  1L1O C;  2OZK A;  1NJI 2;  5T64 A;  1VQ9 Z;  1N8R 2;  5IP7 I;  1TFI A;  4MD7 A;  4QTU A;  1VQ5 1;  3NDI A;  1VQK 1;  2R6M A;  4EWC A;  4Y7N I;  2JR6 A;  2QLV B;  1W2B Z;  1VQO 1;  5A2Q f;  3CCV 1;  4X6A I;  1RNI A;  2V8J A;  1YI2 Z;  3GTK I;  1TWC I;  4E2Y A;  3G71 Z;  5D1P A;  4A3J I;  2EGT A;  4NBC A;  2G2K A;  1K8A 1;  2WAQ A;  4A3L I;  1NP6 A;  1QF8 A;  1S7M A;  1VQ6 1;  3GTG I;  4RS4 A;  2ZAE B;  3CCE Z;  5C44 I;  3K7A I;  3BG1 B;  4RV9 A;  1WII A;  1TWF I;  3CPW Z;  3I56 1;  1VQL 1;  4A3E I;  2KPI A;  3CCQ Z;  1I3Q I;  3CQZ I;  5D1O B;  3EED A;  5CM2 M;  3CC7 Z;  1K9M 1;  3S1R I;  3VB9 A;  3J80 f;  3CC2 Z;  2OTJ Z;  1Q7Y 2;  3CD6 1;  1USP B;  1WW9 A;  1TWG I;  1Z01 A;  1YIJ Z;  2E2J I;  4A3K I;  4E2Z A;  3D6W A;  3I55 Z;  3PO3 I;  1K73 1;  1X3Z A;  5D1O A;  4RVG A;  4RVF A;  1Q81 2;  5C4X I;  1RO4 A;  4NH1 C;  1SFO I;  3HOW I;  3J81 f;  1USP A;  5IP9 I;  3S1M I;  1ZB9 A;  5T67 A;  3CME Z;  4BBS I;  1RQF A;  4CL1 A;  1VQ8 Z;  3JAM b;  1YHQ 1;  4NBD A;  1VLA A;  4RVH A;  1KQS Y;  1VQ7 1;  2YU9 I;  2Q4Z A;  2IZ3 A;  1JWH C;  3F3P C;  1YJW 1;  3CCS Z;  2QRD B;  3KIF A;  3VMG A;  3FKI I;  2J6A A;  3NDJ A;  2V8K A;  2K5R A;  3IFU A;  2BJO A;  2VUG A;  4HGZ A;  2JS4 A;  1Q82 1;  1QVG Z;  4NB8 A;  4MD8 A;  4NFR A;  3CMA Z;  3CCL 1;  2JUB A;  1YUK A;  2PMZ A;  1YJ9 Z;  1VQ4 1;  2I3C A;  3S2H I;  2Q51 A;  4NBB A;  2JA7 I;  2HU9 A;  4MRI A;  4HH4 A;  4NOZ A;  1KC8 1;  3GTP I;  3RZO I;  1I50 I;  4A93 I;  3GTQ I;  5IT9 f;  3J80 b;  4A3D I;  2R93 I;  4E32 A;  3S14 I;  3QWU A;  3GKQ A;  3MZL B;  1QYP A;  3TE5 B;  1VQ9 1;  1NUI A;  2H85 A;  3CCJ Z;  3U50 C;  3D9X A;  1I6H I;  5T6B A;  1S72 Z;  1DL6 A;  3MZK B;  1QVF Y;  1M90 2;  3GTL I;  3HOY I;  1KD1 2;  2JA8 I;  4BBR I;  3KIH A;  2JMO A;  2B63 I;  1YI2 1;  3G71 1;  2QA4 1;  2OOY B;  2QRE B;  3PO3 S;  4NBA A;  3G4S Z;  2K3R A;  1VQO Z;  3CCV Z;  2YAD A;  3GTM S;  2M6N A;  4E30 A;  2E2I I;  3S15 I;  2NVT I;  3HOV I;  3GTJ I;  3IF8 A;  4NBG A;  2M48 A;  1Q86 1;  3ESW A;  2Y0S A;  2RBL A;  1K8A 2;  4MON A;  2V8I A;  3CXC Z;  1Z02 A;  2HF1 A;  2PM9 A;  3M3Y I;  1PFT A;  3CC7 1;  2QEX Z;  3CC2 1;  3CCU Z;  2JNY A;  3G6E Z;  1M1K 1;  3I56 Z;  2OTJ 1;  5FLX f;  3CXC Y;  1YIJ 1;  1YIT 1;  3CCM 1;  3VTN A;  3GTM I;  3I55 1;  3OW2 Y;  1N2F A;  3M4O I;  2RHB A;  3CCR Z;  2IZ4 A;  1KQS Z;  1TWH I;  1YUA A;  3S17 I;  1K9M 2;  4DK1 A;  2LFU A;  1VQP Z;  2W03 A;  2QKD A;  2AKL A;  3H3V J;  1Z03 A;  3CME 1;  5A2Q b;  2GU2 A;  1KRL A;  1VQ8 1;  1K73 2;  4E2W A;  1VQM Z;  4BXX I;  3NH5 A;  4DQY B;  4A3M I;  2JA5 I;  1WCM I;  3CCS 1;  3VMH A;  2F4M A;  1RO0 A;  3LUS A;  4A3C I;  1VQ7 Z;  4BY7 I;  2OTL Z;  3GTO I;  4A3I I;  1ML8 A;  4XX2 A;  4MH4 A;  3J7A 4;  5AN9 F;  4A3G I;  3CMA 1;  1Y1W I;  4DGL A;  1Y1V I;  1YJ9 1;  1NJI 1;  3RZD I;  2RPR A;  3MON A;  3CCL Z;  3HOX I;  1Q82 2;  1QVF Z;  2E9H A;  4A3F I;  1N8R 1;  1YJN Z;  3CC4 Z;  1ZH1 A;  1VQN Z;  2NVY I;  4QTT A;  2VUM I;  4NBE A;  3CCJ 1;  3EER A;  2RIQ A;  1KC8 2;  1S72 1;  3J81 b;  2P3Y A;  1JJ2 Y;  4NBF A;  2QRC B;  1VQ5 Z;  1VQK Z;  1TWA I;  2KI7 B;  3JAM f;  4NBH A;  3G4S 1;  1K83 I;  1LQL A;  1X0T A;  3CCE 1;  2QA4 Z;  4E33 A;  5LL6 f;  3S2D I;  3I07 A;  3P5J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...