4MONA

Orthorhombic monellin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONELLIN
publication title Structure of monellin refined to 2.3 a resolution in the orthorhombic crystal form.
pubmed doi rcsb
molecule tags Sweet-tasting protein
total genus 6
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4monA00
4MONA 3MONA 1KRLA
chains in the Genus database with same CATH superfamily
3I07A 4NFRA 2E9HA 3IFUA 3J80f 4QTUA 3GTGI 3CC7Z 1M901 2NVTI 1SIWA 3CPWY 1QVFY 1YJ9Z 1WW9A 2B63I 1X3ZA 2JS4A 3CMA1 2AYDA 3CCV1 1YHQ1 3GTPI 3I55Z 1P9NA 2OTL1 4E30A 3CCSZ 3CCU1 1WCMI 4A3LI 3NH5A 3U50C 1YI2Z 4RS4A 3QWUA 2DE7A 2RPRA 1S721 4NBHA 3CCE1 1YJN1 2JUBA 3BG0B 5AN9F 1VQOZ 1I3QI 3TE5B 3BG1B 3MONA 1NJI1 3PO3I 3NDIA 3CXCY 1VQ8Z 1Z01A 4RVGA 3VTNA 3F3FC 3T4NB 3MZKB 3CD6Z 1WIIA 3FKII 4A93I 4QTTA 2BJOA 2VF1A 1W2BY 3OW2Y 2R7ZI 1L1OC 3CME1 2K3RA 2DE6A 1QXFA 1Q812 4NOZA 4S1TA 2HU9A 2QKDA 3NH8A 1K9M2 1KQSZ 2Q51A 4NH1C 1JJ2Y 1USPA 3P5JB 2VPXA 2AKLA 4MD8A 1TWFI 4E32A 3CCMZ 4A3JI 2QEXZ 4MXUA 1VQP1 1VQ9Z 1KC82 5A2Qf 2NVYI 2WB1A 1KD12 3ESWA 1S7MA 2LIYA 4BXXI 3S2DI 4Y52I 3RZOI 3M3YI 1Z03A 3H0GI 1VQLZ 3HOVI 1VQ61 3CC2Z 1VQMZ 1WZNA 2VPWA 1Y8CA 2VUGA 2KPIA 4HH4A 2JIPA 4MD7A 1NUIA 3J81f 1K83I 3IX0A 4EWCA 3G711 1YJWZ 1I6HI 3RZDI 2QLVB 1LQLA 3CCJ1 3GTQI 1Y1VI 2R6MA 1VQ41 2I3CA 2P3YA 1Y1WI 5T6BA 2WAQA 4A3GI 4E31A 1M1K1 3GTMI 2V3VA 4Y7NI 1QVGY 1RLYA 3EEDA 3HOYI 2ZAEB 4HGZA 3NFZA 1PFTA 3D2LA 2PK7A 3H3VJ 2DE5A 2GTIA 4E33A 2O4HA 3PO3S 3HKZA 2GU2A 2JNYA 2VPZA 4RVHA 1VQNZ 2JR6A 1YUKA 3S14I 1K8A2 1YITZ 1FDIA 1USPB 4A3MI 3G4SZ 3JAMb 1TWCI 4A3BI 3F3PC 2JIQA 3I4NI 3KIFA 4RVDA 3CC4Z 1R9TI 4NBCA 3GTJI 3S1RI 2PMZA 2E7ZA 3CPWZ 1YJW1 1QVFZ 3CCLZ 4MONA 4A3DI 1Q7Y2 1VQ51 3VMGA 5FLMI 1Q821 1VQK1 3KIHA 3HOXI 2JIRA 2QA4Z 2IZ3A 4E2ZA 3CCQZ 5T67A 3HOZI 1K8A1 2H85A 4A3KI 3CCRZ 1YIJZ 1TWGI 2OTJ1 3GCFA 1SFOI 2PM9A 5FLXb 3HOUI 3CC71 3S17I 1Z02A 4DQYB 3G6EZ 2QREB 2F4MA 3CQZI 4XX2A 5T64A 2M6NA 1YJ91 3FQMA 5C4JI 4E2YA 1N8R2 2VPYA 2QRDB 2W04A 4HGYA 2R93I 1AA6A 1VQ7Z 1RQFA 3I551 1Y1VS 2JA8I 4BY1I 1M1K2 3CCS1 1FDOA 5IT9b 3I56Z 2NVQI 3D6WA 1W2BZ 3PO2I 2LFUA 3GTMS 1YI21 1M902 3S16I 3CMAZ 3CCVZ 2JIOA 3EERA 4E2XA 1YHQZ 2KI7B 1QYPA 1VQO1 2OTLZ 2E2HI 3CCUZ 2EGTA 4CL1A 1DL6A 4BBRI 1S72Z 1VQ81 3CCEZ 1YJNZ 4NBDA 2VUMI 2RHBA 4A3EI 3CD61 1TFIA 1Q811 3IR7A 2QA41 2IV2X 1K9M1 3CCR1 4TNUA 1K731 4RV9A 3JAMf 1WJ2A 1NJI2 2Q4ZA 3CCM1 1KC81 1RNIA 2QEX1 3D9XA 2V8KA 1Q822 3CMEZ 3VMIA 1KD11 1VQ91 2RIQA 4NBFA 4DK1A 1N2FA 2OOXB 2Y0SA 2J6AA 3Q87A 2F4OA 1Q861 3I561 4NB8A 5C3EI 1NP6A 1VQL1 1VQPZ 3CC21 1VQM1 1VLAA 2GTHA 2YU9I 1QVGZ 2JMOA 2M48A 2V8IA 2R92I 3GTKI 2JIMA 1RO0A 3S15I 5FLXf 4A3FI 4E2WA 2OZKA 1KQSY 4X6AI 3J80b 2LEXA 1VQ6Z 4NBAA 5CM2M 5D1OB 1ZH1A 2V45A 3J7A4 4A3II 2NVXI 5IT9f 2OOYB 3G71Z 2G2KA 4DGLA 1JWHC 3K7AI 3VMHA 4MRIA 3LUSA 1ML8A 3CCJZ 3GTLI 2E2JI 2NAPA 1VQ4Z 2QRCB 4MD9A 3NH4A 1QF8A 2JA6I 2JA5I 4AYBA 2YADA 2V8JA 1X0TA 3CXCZ 1VQN1 3MZLB 1YIT1 3S1NI 5D1OA 3VB9A 1ZB8A 3IF8A 3OW2Z 3S1QI 3S2HI 1K732 3G4S1 4NBGA 2RT9A 3CC41 1Q16A 1JJ2Z 2P28A 3GTOI 1KRLA 1YUAA 4A3CI 3HOWI 1RO2A 2RBLA 2W03A 1Q7Y1 1TWHI 5IP9I 2E2II 5IP7I 4BY7I 3S1MI 1ZB9A 3CCL1 1Q862 4NBEA 2K5RA 2QR1B 3FQQA 4MH4A 4NB9A 3CCQ1 4BBSI 1RO4A 1YIJ1 1I50I 2O53A 3M4OI 3TDHB 1X3WA 5A2Qb 3NDJA 1VQ5Z 2HF1A 5C4XI 1VQKZ 2IZ4A 1N8R1 5D1PA 3G6E1 5C44I 1TWAI 4RVFA 3I4MI 3GKQA 4NBBA 2OTJZ 1VQ71 2JA7I 5LL6f 3J81b
chains in the Genus database with same CATH topology
3I07A 4NFRA 2E9HA 3IFUA 3J80f 4QTUA 3GTGI 3CC7Z 1M901 2NVTI 3CPWY 1QVFY 1YJ9Z 1WW9A 2B63I 1X3ZA 2JS4A 3CMA1 3CCV1 1YHQ1 3GTPI 3I55Z 1P9NA 2OTL1 4E30A 3CCSZ 3CCU1 1WCMI 4A3LI 3NH5A 3U50C 1YI2Z 4RS4A 3QWUA 2DE7A 2RPRA 1S721 4NBHA 3CCE1 1YJN1 2JUBA 3BG0B 5AN9F 1VQOZ 1I3QI 3TE5B 3BG1B 3MONA 1NJI1 3PO3I 3NDIA 3CXCY 1VQ8Z 1Z01A 4RVGA 3VTNA 3F3FC 3T4NB 3MZKB 3CD6Z 1WIIA 3FKII 4A93I 4QTTA 2BJOA 2VF1A 1W2BY 3OW2Y 2R7ZI 1L1OC 3CME1 2K3RA 2DE6A 1Q812 4NOZA 4S1TA 2HU9A 2QKDA 3NH8A 1K9M2 1KQSZ 2Q51A 4NH1C 1JJ2Y 1USPA 3P5JB 2AKLA 4MD8A 1TWFI 4E32A 3CCMZ 4A3JI 2QEXZ 4MXUA 1VQP1 1VQ9Z 1KC82 5A2Qf 2NVYI 2WB1A 1KD12 3ESWA 1S7MA 2LIYA 4BXXI 3S2DI 4Y52I 3RZOI 3M3YI 1Z03A 3H0GI 1VQLZ 3HOVI 1VQ61 3CC2Z 1VQMZ 2VUGA 2KPIA 4HH4A 4MD7A 1NUIA 3J81f 1K83I 3IX0A 4EWCA 3G711 1YJWZ 1I6HI 3RZDI 2QLVB 1LQLA 3CCJ1 3GTQI 1Y1VI 2R6MA 1VQ41 2I3CA 2P3YA 1Y1WI 5T6BA 2WAQA 4A3GI 4E31A 1M1K1 3GTMI 4Y7NI 1QVGY 1RLYA 3EEDA 3HOYI 2ZAEB 4HGZA 3NFZA 1PFTA 2PK7A 3H3VJ 2DE5A 2GTIA 4E33A 2O4HA 3PO3S 3HKZA 2GU2A 2JNYA 4RVHA 1VQNZ 2JR6A 1YUKA 3S14I 1K8A2 1YITZ 1USPB 4A3MI 3G4SZ 3JAMb 1TWCI 4A3BI 3F3PC 3I4NI 3KIFA 4RVDA 3CC4Z 1R9TI 4NBCA 3GTJI 3S1RI 2PMZA 3CPWZ 1YJW1 1QVFZ 3CCLZ 4MONA 4A3DI 1Q7Y2 1VQ51 3VMGA 5FLMI 1Q821 1VQK1 3KIHA 3HOXI 2QA4Z 2IZ3A 4E2ZA 3CCQZ 5T67A 3HOZI 1K8A1 2H85A 4A3KI 3CCRZ 1YIJZ 1TWGI 2OTJ1 3GCFA 1SFOI 2PM9A 5FLXb 3HOUI 3CC71 3S17I 1Z02A 4DQYB 5T64A 2QREB 2F4MA 3CQZI 4XX2A 3G6EZ 2M6NA 1YJ91 3FQMA 5C4JI 4E2YA 1N8R2 2R93I 2QRDB 2W04A 4HGYA 1VQ7Z 1RQFA 3I551 1Y1VS 2JA8I 4BY1I 1M1K2 3CCS1 5IT9b 3I56Z 2NVQI 3D6WA 1W2BZ 3PO2I 2LFUA 3GTMS 1YI21 1M902 3S16I 3CMAZ 3CCVZ 3EERA 4E2XA 1YHQZ 2KI7B 1QYPA 1VQO1 2OTLZ 2E2HI 3CCUZ 2EGTA 4CL1A 1DL6A 4BBRI 1S72Z 1VQ81 3CCEZ 1YJNZ 4NBDA 2VUMI 2RHBA 4A3EI 3CD61 1TFIA 1Q811 2QA41 1K9M1 3CCR1 4TNUA 1K731 4RV9A 3JAMf 1NJI2 2Q4ZA 3CCM1 1KC81 1RNIA 2QEX1 3D9XA 2V8KA 1Q822 3CMEZ 3VMIA 1KD11 1VQ91 2RIQA 4NBFA 4DK1A 1N2FA 2OOXB 2Y0SA 2J6AA 3Q87A 2F4OA 1Q861 3I561 4NB8A 5C3EI 1NP6A 1VQL1 1VQPZ 3CC21 1VQM1 1VLAA 2GTHA 2YU9I 1QVGZ 2JMOA 2M48A 2V8IA 2R92I 3GTKI 1RO0A 3S15I 5FLXf 4A3FI 4E2WA 2OZKA 1KQSY 4X6AI 3J80b 1VQ6Z 4NBAA 5CM2M 5D1OB 1ZH1A 3J7A4 4A3II 2NVXI 5IT9f 2OOYB 3G71Z 2G2KA 4DGLA 1JWHC 3K7AI 3VMHA 4MRIA 3LUSA 1ML8A 3CCJZ 3GTLI 2E2JI 1VQ4Z 2QRCB 4MD9A 3NH4A 1QF8A 2JA6I 2JA5I 4AYBA 2YADA 2V8JA 1X0TA 3CXCZ 1VQN1 3MZLB 1YIT1 3S1NI 5D1OA 3VB9A 1ZB8A 3IF8A 3OW2Z 3S1QI 3S2HI 1K732 3G4S1 4NBGA 2RT9A 3CC41 1JJ2Z 2P28A 3GTOI 1KRLA 1YUAA 4A3CI 3HOWI 1RO2A 2RBLA 2W03A 1Q7Y1 1TWHI 5IP9I 2E2II 5IP7I 4BY7I 3S1MI 1ZB9A 3CCL1 1Q862 4NBEA 2K5RA 2QR1B 3FQQA 4MH4A 4NB9A 3CCQ1 4BBSI 1RO4A 1YIJ1 1I50I 2O53A 3M4OI 3TDHB 1X3WA 5A2Qb 3NDJA 1VQ5Z 2HF1A 5C4XI 1VQKZ 2IZ4A 1N8R1 5D1PA 3G6E1 5C44I 1TWAI 4RVFA 3I4MI 3GKQA 4NBBA 2OTJZ 1VQ71 2JA7I 5LL6f 3J81b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MON A;  3MON A;  1KRL A; 
#chains in the Genus database with same CATH topology
 3I07 A;  4NFR A;  2E9H A;  3IFU A;  3J80 f;  4QTU A;  3GTG I;  3CC7 Z;  1M90 1;  2NVT I;  1SIW A;  3CPW Y;  1QVF Y;  1YJ9 Z;  1WW9 A;  2B63 I;  1X3Z A;  2JS4 A;  3CMA 1;  2AYD A;  3CCV 1;  1YHQ 1;  3GTP I;  3I55 Z;  1P9N A;  2OTL 1;  4E30 A;  3CCS Z;  3CCU 1;  1WCM I;  4A3L I;  3NH5 A;  3U50 C;  1YI2 Z;  4RS4 A;  3QWU A;  2DE7 A;  2RPR A;  1S72 1;  4NBH A;  3CCE 1;  1YJN 1;  2JUB A;  3BG0 B;  5AN9 F;  1VQO Z;  1I3Q I;  3TE5 B;  3BG1 B;  3MON A;  1NJI 1;  3PO3 I;  3NDI A;  3CXC Y;  1VQ8 Z;  1Z01 A;  4RVG A;  3VTN A;  3F3F C;  3T4N B;  3MZK B;  3CD6 Z;  1WII A;  3FKI I;  4A93 I;  4QTT A;  2BJO A;  2VF1 A;  1W2B Y;  3OW2 Y;  2R7Z I;  1L1O C;  3CME 1;  2K3R A;  2DE6 A;  1QXF A;  1Q81 2;  4NOZ A;  4S1T A;  2HU9 A;  2QKD A;  3NH8 A;  1K9M 2;  1KQS Z;  2Q51 A;  4NH1 C;  1JJ2 Y;  1USP A;  3P5J B;  2VPX A;  2AKL A;  4MD8 A;  1TWF I;  4E32 A;  3CCM Z;  4A3J I;  2QEX Z;  4MXU A;  1VQP 1;  1VQ9 Z;  1KC8 2;  5A2Q f;  2NVY I;  2WB1 A;  1KD1 2;  3ESW A;  1S7M A;  2LIY A;  4BXX I;  3S2D I;  4Y52 I;  3RZO I;  3M3Y I;  1Z03 A;  3H0G I;  1VQL Z;  3HOV I;  1VQ6 1;  3CC2 Z;  1VQM Z;  1WZN A;  2VPW A;  1Y8C A;  2VUG A;  2KPI A;  4HH4 A;  2JIP A;  4MD7 A;  1NUI A;  3J81 f;  1K83 I;  3IX0 A;  4EWC A;  3G71 1;  1YJW Z;  1I6H I;  3RZD I;  2QLV B;  1LQL A;  3CCJ 1;  3GTQ I;  1Y1V I;  2R6M A;  1VQ4 1;  2I3C A;  2P3Y A;  1Y1W I;  5T6B A;  2WAQ A;  4A3G I;  4E31 A;  1M1K 1;  3GTM I;  2V3V A;  4Y7N I;  1QVG Y;  1RLY A;  3EED A;  3HOY I;  2ZAE B;  4HGZ A;  3NFZ A;  1PFT A;  3D2L A;  2PK7 A;  3H3V J;  2DE5 A;  2GTI A;  4E33 A;  2O4H A;  3PO3 S;  3HKZ A;  2GU2 A;  2JNY A;  2VPZ A;  4RVH A;  1VQN Z;  2JR6 A;  1YUK A;  3S14 I;  1K8A 2;  1YIT Z;  1FDI A;  1USP B;  4A3M I;  3G4S Z;  3JAM b;  1TWC I;  4A3B I;  3F3P C;  2JIQ A;  3I4N I;  3KIF A;  4RVD A;  3CC4 Z;  1R9T I;  4NBC A;  3GTJ I;  3S1R I;  2PMZ A;  2E7Z A;  3CPW Z;  1YJW 1;  1QVF Z;  3CCL Z;  4MON A;  4A3D I;  1Q7Y 2;  1VQ5 1;  3VMG A;  5FLM I;  1Q82 1;  1VQK 1;  3KIH A;  3HOX I;  2JIR A;  2QA4 Z;  2IZ3 A;  4E2Z A;  3CCQ Z;  5T67 A;  3HOZ I;  1K8A 1;  2H85 A;  4A3K I;  3CCR Z;  1YIJ Z;  1TWG I;  2OTJ 1;  3GCF A;  1SFO I;  2PM9 A;  5FLX b;  3HOU I;  3CC7 1;  3S17 I;  1Z02 A;  4DQY B;  3G6E Z;  2QRE B;  2F4M A;  3CQZ I;  4XX2 A;  5T64 A;  2M6N A;  1YJ9 1;  3FQM A;  5C4J I;  4E2Y A;  1N8R 2;  2VPY A;  2QRD B;  2W04 A;  4HGY A;  2R93 I;  1AA6 A;  1VQ7 Z;  1RQF A;  3I55 1;  1Y1V S;  2JA8 I;  4BY1 I;  1M1K 2;  3CCS 1;  1FDO A;  5IT9 b;  3I56 Z;  2NVQ I;  3D6W A;  1W2B Z;  3PO2 I;  2LFU A;  3GTM S;  1YI2 1;  1M90 2;  3S16 I;  3CMA Z;  3CCV Z;  2JIO A;  3EER A;  4E2X A;  1YHQ Z;  2KI7 B;  1QYP A;  1VQO 1;  2OTL Z;  2E2H I;  3CCU Z;  2EGT A;  4CL1 A;  1DL6 A;  4BBR I;  1S72 Z;  1VQ8 1;  3CCE Z;  1YJN Z;  4NBD A;  2VUM I;  2RHB A;  4A3E I;  3CD6 1;  1TFI A;  1Q81 1;  3IR7 A;  2QA4 1;  2IV2 X;  1K9M 1;  3CCR 1;  4TNU A;  1K73 1;  4RV9 A;  3JAM f;  1WJ2 A;  1NJI 2;  2Q4Z A;  3CCM 1;  1KC8 1;  1RNI A;  2QEX 1;  3D9X A;  2V8K A;  1Q82 2;  3CME Z;  3VMI A;  1KD1 1;  1VQ9 1;  2RIQ A;  4NBF A;  4DK1 A;  1N2F A;  2OOX B;  2Y0S A;  2J6A A;  3Q87 A;  2F4O A;  1Q86 1;  3I56 1;  4NB8 A;  5C3E I;  1NP6 A;  1VQL 1;  1VQP Z;  3CC2 1;  1VQM 1;  1VLA A;  2GTH A;  2YU9 I;  1QVG Z;  2JMO A;  2M48 A;  2V8I A;  2R92 I;  3GTK I;  2JIM A;  1RO0 A;  3S15 I;  5FLX f;  4A3F I;  4E2W A;  2OZK A;  1KQS Y;  4X6A I;  3J80 b;  2LEX A;  1VQ6 Z;  4NBA A;  5CM2 M;  5D1O B;  1ZH1 A;  2V45 A;  3J7A 4;  4A3I I;  2NVX I;  5IT9 f;  2OOY B;  3G71 Z;  2G2K A;  4DGL A;  1JWH C;  3K7A I;  3VMH A;  4MRI A;  3LUS A;  1ML8 A;  3CCJ Z;  3GTL I;  2E2J I;  2NAP A;  1VQ4 Z;  2QRC B;  4MD9 A;  3NH4 A;  1QF8 A;  2JA6 I;  2JA5 I;  4AYB A;  2YAD A;  2V8J A;  1X0T A;  3CXC Z;  1VQN 1;  3MZL B;  1YIT 1;  3S1N I;  5D1O A;  3VB9 A;  1ZB8 A;  3IF8 A;  3OW2 Z;  3S1Q I;  3S2H I;  1K73 2;  3G4S 1;  4NBG A;  2RT9 A;  3CC4 1;  1Q16 A;  1JJ2 Z;  2P28 A;  3GTO I;  1KRL A;  1YUA A;  4A3C I;  3HOW I;  1RO2 A;  2RBL A;  2W03 A;  1Q7Y 1;  1TWH I;  5IP9 I;  2E2I I;  5IP7 I;  4BY7 I;  3S1M I;  1ZB9 A;  3CCL 1;  1Q86 2;  4NBE A;  2K5R A;  2QR1 B;  3FQQ A;  4MH4 A;  4NB9 A;  3CCQ 1;  4BBS I;  1RO4 A;  1YIJ 1;  1I50 I;  2O53 A;  3M4O I;  3TDH B;  1X3W A;  5A2Q b;  3NDJ A;  1VQ5 Z;  2HF1 A;  5C4X I;  1VQK Z;  2IZ4 A;  1N8R 1;  5D1P A;  3G6E 1;  5C44 I;  1TWA I;  4RVF A;  3I4M I;  3GKQ A;  4NBB A;  2OTJ Z;  1VQ7 1;  2JA7 I;  5LL6 f;  3J81 b; 
#chains in the Genus database with same CATH homology
 3I07 A;  4NFR A;  2E9H A;  3IFU A;  3J80 f;  4QTU A;  3GTG I;  3CC7 Z;  1M90 1;  2NVT I;  3CPW Y;  1QVF Y;  1YJ9 Z;  1WW9 A;  2B63 I;  1X3Z A;  2JS4 A;  3CMA 1;  3CCV 1;  1YHQ 1;  3GTP I;  3I55 Z;  1P9N A;  2OTL 1;  4E30 A;  3CCS Z;  3CCU 1;  1WCM I;  4A3L I;  3NH5 A;  3U50 C;  1YI2 Z;  4RS4 A;  3QWU A;  2DE7 A;  2RPR A;  1S72 1;  4NBH A;  3CCE 1;  1YJN 1;  2JUB A;  3BG0 B;  5AN9 F;  1VQO Z;  1I3Q I;  3TE5 B;  3BG1 B;  3MON A;  1NJI 1;  3PO3 I;  3NDI A;  3CXC Y;  1VQ8 Z;  1Z01 A;  4RVG A;  3VTN A;  3F3F C;  3T4N B;  3MZK B;  3CD6 Z;  1WII A;  3FKI I;  4A93 I;  4QTT A;  2BJO A;  2VF1 A;  1W2B Y;  3OW2 Y;  2R7Z I;  1L1O C;  3CME 1;  2K3R A;  2DE6 A;  1Q81 2;  4NOZ A;  4S1T A;  2HU9 A;  2QKD A;  3NH8 A;  1K9M 2;  1KQS Z;  2Q51 A;  4NH1 C;  1JJ2 Y;  1USP A;  3P5J B;  2AKL A;  4MD8 A;  1TWF I;  4E32 A;  3CCM Z;  4A3J I;  2QEX Z;  4MXU A;  1VQP 1;  1VQ9 Z;  1KC8 2;  5A2Q f;  2NVY I;  2WB1 A;  1KD1 2;  3ESW A;  1S7M A;  2LIY A;  4BXX I;  3S2D I;  4Y52 I;  3RZO I;  3M3Y I;  1Z03 A;  3H0G I;  1VQL Z;  3HOV I;  1VQ6 1;  3CC2 Z;  1VQM Z;  2VUG A;  2KPI A;  4HH4 A;  4MD7 A;  1NUI A;  3J81 f;  1K83 I;  3IX0 A;  4EWC A;  3G71 1;  1YJW Z;  1I6H I;  3RZD I;  2QLV B;  1LQL A;  3CCJ 1;  3GTQ I;  1Y1V I;  2R6M A;  1VQ4 1;  2I3C A;  2P3Y A;  1Y1W I;  5T6B A;  2WAQ A;  4A3G I;  4E31 A;  1M1K 1;  3GTM I;  4Y7N I;  1QVG Y;  1RLY A;  3EED A;  3HOY I;  2ZAE B;  4HGZ A;  3NFZ A;  1PFT A;  2PK7 A;  3H3V J;  2DE5 A;  2GTI A;  4E33 A;  2O4H A;  3PO3 S;  3HKZ A;  2GU2 A;  2JNY A;  4RVH A;  1VQN Z;  2JR6 A;  1YUK A;  3S14 I;  1K8A 2;  1YIT Z;  1USP B;  4A3M I;  3G4S Z;  3JAM b;  1TWC I;  4A3B I;  3F3P C;  3I4N I;  3KIF A;  4RVD A;  3CC4 Z;  1R9T I;  4NBC A;  3GTJ I;  3S1R I;  2PMZ A;  3CPW Z;  1YJW 1;  1QVF Z;  3CCL Z;  4MON A;  4A3D I;  1Q7Y 2;  1VQ5 1;  3VMG A;  5FLM I;  1Q82 1;  1VQK 1;  3KIH A;  3HOX I;  2QA4 Z;  2IZ3 A;  4E2Z A;  3CCQ Z;  5T67 A;  3HOZ I;  1K8A 1;  2H85 A;  4A3K I;  3CCR Z;  1YIJ Z;  1TWG I;  2OTJ 1;  3GCF A;  1SFO I;  2PM9 A;  5FLX b;  3HOU I;  3CC7 1;  3S17 I;  1Z02 A;  4DQY B;  5T64 A;  2QRE B;  2F4M A;  3CQZ I;  4XX2 A;  3G6E Z;  2M6N A;  1YJ9 1;  3FQM A;  5C4J I;  4E2Y A;  1N8R 2;  2R93 I;  2QRD B;  2W04 A;  4HGY A;  1VQ7 Z;  1RQF A;  3I55 1;  1Y1V S;  2JA8 I;  4BY1 I;  1M1K 2;  3CCS 1;  5IT9 b;  3I56 Z;  2NVQ I;  3D6W A;  1W2B Z;  3PO2 I;  2LFU A;  3GTM S;  1YI2 1;  1M90 2;  3S16 I;  3CMA Z;  3CCV Z;  3EER A;  4E2X A;  1YHQ Z;  2KI7 B;  1QYP A;  1VQO 1;  2OTL Z;  2E2H I;  3CCU Z;  2EGT A;  4CL1 A;  1DL6 A;  4BBR I;  1S72 Z;  1VQ8 1;  3CCE Z;  1YJN Z;  4NBD A;  2VUM I;  2RHB A;  4A3E I;  3CD6 1;  1TFI A;  1Q81 1;  2QA4 1;  1K9M 1;  3CCR 1;  4TNU A;  1K73 1;  4RV9 A;  3JAM f;  1NJI 2;  2Q4Z A;  3CCM 1;  1KC8 1;  1RNI A;  2QEX 1;  3D9X A;  2V8K A;  1Q82 2;  3CME Z;  3VMI A;  1KD1 1;  1VQ9 1;  2RIQ A;  4NBF A;  4DK1 A;  1N2F A;  2OOX B;  2Y0S A;  2J6A A;  3Q87 A;  2F4O A;  1Q86 1;  3I56 1;  4NB8 A;  5C3E I;  1NP6 A;  1VQL 1;  1VQP Z;  3CC2 1;  1VQM 1;  1VLA A;  2GTH A;  2YU9 I;  1QVG Z;  2JMO A;  2M48 A;  2V8I A;  2R92 I;  3GTK I;  1RO0 A;  3S15 I;  5FLX f;  4A3F I;  4E2W A;  2OZK A;  1KQS Y;  4X6A I;  3J80 b;  1VQ6 Z;  4NBA A;  5CM2 M;  5D1O B;  1ZH1 A;  3J7A 4;  4A3I I;  2NVX I;  5IT9 f;  2OOY B;  3G71 Z;  2G2K A;  4DGL A;  1JWH C;  3K7A I;  3VMH A;  4MRI A;  3LUS A;  1ML8 A;  3CCJ Z;  3GTL I;  2E2J I;  1VQ4 Z;  2QRC B;  4MD9 A;  3NH4 A;  1QF8 A;  2JA6 I;  2JA5 I;  4AYB A;  2YAD A;  2V8J A;  1X0T A;  3CXC Z;  1VQN 1;  3MZL B;  1YIT 1;  3S1N I;  5D1O A;  3VB9 A;  1ZB8 A;  3IF8 A;  3OW2 Z;  3S1Q I;  3S2H I;  1K73 2;  3G4S 1;  4NBG A;  2RT9 A;  3CC4 1;  1JJ2 Z;  2P28 A;  3GTO I;  1KRL A;  1YUA A;  4A3C I;  3HOW I;  1RO2 A;  2RBL A;  2W03 A;  1Q7Y 1;  1TWH I;  5IP9 I;  2E2I I;  5IP7 I;  4BY7 I;  3S1M I;  1ZB9 A;  3CCL 1;  1Q86 2;  4NBE A;  2K5R A;  2QR1 B;  3FQQ A;  4MH4 A;  4NB9 A;  3CCQ 1;  4BBS I;  1RO4 A;  1YIJ 1;  1I50 I;  2O53 A;  3M4O I;  3TDH B;  1X3W A;  5A2Q b;  3NDJ A;  1VQ5 Z;  2HF1 A;  5C4X I;  1VQK Z;  2IZ4 A;  1N8R 1;  5D1P A;  3G6E 1;  5C44 I;  1TWA I;  4RVF A;  3I4M I;  3GKQ A;  4NBB A;  2OTJ Z;  1VQ7 1;  2JA7 I;  5LL6 f;  3J81 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...