4MONA

Orthorhombic monellin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONELLIN
publication title Structure of monellin refined to 2.3 a resolution in the orthorhombic crystal form.
pubmed doi rcsb
molecule tags Sweet-tasting protein
total genus 6
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4monA00
4MONA 1KRLA 3MONA
chains in the Genus database with same CATH superfamily
3J81f 5LL6f 3OW2Y 2JIPA 2JMOA 3H0GI 3CCL1 3PO3S 3CCSZ 4X6AI 4S1TA 4RVFA 2E2HI 3IR7A 2JUBA 3FQQA 3RZDI 1JJ2Z 1K731 3CCU1 2M6NA 2J6AA 2NVYI 1USPB 4E2YA 1RLYA 2DE5A 2IV2X 4MRIA 2JA7I 2Q4ZA 2G2KA 1M901 5T6BA 2B63I 1WJ2A 3HOVI 3I55Z 4NBHA 3J81b 1K732 4BY1I 1VQLZ 4BY7I 3VMGA 1Q861 3CCM1 4NBEA 1M1K1 3H3VJ 2QLVB 1VQO1 2DE7A 1VQK1 1TWAI 1TWHI 3G4S1 4A3MI 1M902 1YI21 1Y8CA 2M48A 1VQNZ 3G711 3HOUI 4TNUA 1VQ7Z 1FDOA 4EWCA 1ZH1A 1YJW1 1VQ91 1RO2A 2QA41 1Q862 1M1K2 2R92I 5C4JI 2QRDB 3GTJI 3I56Z 3LUSA 1Q821 1QXFA 5C3EI 1KRLA 2RIQA 3D9XA 1RNIA 1WCMI 2VPYA 2K5RA 2PK7A 3HOZI 1VQ71 3PO3I 1I50I 2E9HA 1ZB9A 3RZOI 4A3DI 4E31A 2RPRA 2VF1A 3CXCZ 3S14I 5FLXf 2H85A 1Z01A 1Q822 3CCQZ 2QEXZ 2E2II 3CCJ1 4A3FI 4NBFA 3CPWY 1RO0A 3J80f 1K9M1 5T67A 1NP6A 1YUKA 3GTLI 3CCE1 3S16I 1SFOI 3EERA 1Q811 2NAPA 3IFUA 3CC2Z 3CCLZ 1S7MA 1VQ51 3NFZA 2EGTA 1WZNA 3CCUZ 1K83I 1QF8A 1YJ91 2IZ4A 2VUMI 2I3CA 2PM9A 3IX0A 3JAMf 4MH4A 3HOXI 3CXCY 1K9M2 2LIYA 1Q812 3GTQI 3S15I 2NVXI 2OTJ1 3CC21 3GKQA 5FLXb 3GTMS 3CQZI 1RO4A 3EEDA 3S1QI 3D6WA 2JR6A 4A3EI 1YIJ1 3CCR1 4QTTA 1K8A1 2JIMA 2VPWA 3KIFA 1QYPA 3CCMZ 2YU9I 4HH4A 3S1NI 1W2BY 3P5JB 1VQOZ 5IP7I 5IP9I 4HGZA 2E2JI 1YJN1 4BBRI 1VQKZ 3G4SZ 3HOYI 4DGLA 3MZLB 1VQ41 2R7ZI 1YI2Z 3JAMb 4A3GI 4NOZA 3G71Z 3FQMA 2QKDA 4NBCA 3CCV1 1K8A2 1VQM1 1YJWZ 1VQ9Z 2QA4Z 2OTL1 3KIHA 2V8IA 1X3ZA 3CME1 4MD8A 1X3WA 2VPZA 2LFUA 2JA5I 3F3FC 4NB9A 4A3CI 1JWHC 1VQP1 1Z03A 5C4XI 2P3YA 4NBBA 1TWGI 2VPXA 3I4NI 1YIT1 1N8R1 3BG1B 4A3KI 1FDIA 3Q87A 2JIOA 4NBAA 3CPWZ 4DK1A 2O4HA 2JNYA 2QREB 3M3YI 3CCJZ 2P28A 2R93I 1WIIA 2GU2A 3CMA1 5D1OB 4E32A 3CCEZ 2AKLA 2AYDA 1N8R2 3HOWI 1Q7Y1 4E2WA 3NDJA 3MONA 1N2FA 2KPIA 3S2HI 1VQ5Z 2WAQA 3ESWA 3GTMI 1WW9A 4E2XA 4NFRA 2YADA 5IT9f 3CD61 4BXXI 2RBLA 1YJ9Z 3CC41 2E7ZA 4RV9A 1YHQ1 1KC81 2OOYB 1Q16A 2R6MA 2W03A 3VMIA 4MD7A 4MONA 4AYBA 2OTJZ 3GTKI 2OOXB 1Q7Y2 2F4MA 1R9TI 1S721 1Y1WI 2NVTI 3S1MI 2W04A 2DE6A 1NJI1 3TE5B 3NDIA 1YIJZ 3CCRZ 1W2BZ 2QR1B 1KC82 1I3QI 2JIRA 3F3PC 3S1RI 3I4MI 2JA8I 4BBSI 5D1PA 3CC71 1KQSY 2RT9A 2Y0SA 3U50C 1YJNZ 5IT9b 1VQ4Z 1NJI2 4XX2A 4Y52I 3CCVZ 4A3II 1VQMZ 3J80b 2ZAEB 2OTLZ 3CMEZ 4E33A 2V3VA 4NB8A 2Q51A 2LEXA 1VQPZ 1VQ81 1LQLA 4A3JI 5C44I 1VQ61 1I6HI 4QTUA 3G6E1 1YITZ 2HU9A 1VLAA 3MZKB 2KI7B 3IF8A 1RQFA 4MD9A 4RVGA 3VMHA 3CCS1 1TWFI 3PO2I 2JS4A 3GTOI 1TWCI 3CMAZ 3GCFA 4A3BI 5A2Qf 2K3RA 4HGYA 4CL1A 3NH8A 2QRCB 5AN9F 1JJ2Y 1QVGZ 3TDHB 3BG0B 3CD6Z 2O53A 3CC4Z 1TFIA 1YHQZ 2JA6I 1QVFZ 1USPA 3S17I 3M4OI 3I551 2JIQA 2WB1A 2V8KA 4RVHA 2PMZA 2F4OA 1VQL1 1YUAA 2V45A 1NUIA 2OZKA 1S72Z 4A93I 3S2DI 2VUGA 3J7A4 1P9NA 1Y1VI 2RHBA 5CM2M 1KQSZ 5A2Qb 4E30A 2HF1A 1Z02A 3D2LA 1QVGY 1VQN1 3NH5A 4RS4A 3VB9A 3CC7Z 4Y7NI 3QWUA 3K7AI 4NBDA 1ML8A 1QVFY 3I07A 2GTHA 1KD11 3OW2Z 3VTNA 4A3LI 5T64A 3I561 4NBGA 2V8JA 4NH1C 1AA6A 3HKZA 1DL6A 1SIWA 3GTGI 5FLMI 2BJOA 2GTIA 1ZB8A 4MXUA 3NH4A 3T4NB 1PFTA 4E2ZA 4RVDA 1KD12 1VQ8Z 1VQ6Z 1X0TA 1Y1VS 5D1OA 2NVQI 1L1OC 3FKII 3G6EZ 4DQYB 2QEX1 3CCQ1 2IZ3A 3GTPI
chains in the Genus database with same CATH topology
3J81f 5LL6f 3OW2Y 2JMOA 3H0GI 3CCL1 3PO3S 3CCSZ 4X6AI 4S1TA 4RVFA 2E2HI 2JUBA 3FQQA 3RZDI 1JJ2Z 1K731 3CCU1 2M6NA 2J6AA 2NVYI 1USPB 4E2YA 1RLYA 2DE5A 4MRIA 2JA7I 2Q4ZA 2G2KA 1M901 5T6BA 2B63I 3HOVI 3I55Z 4NBHA 3J81b 1K732 4BY1I 1VQLZ 4BY7I 3VMGA 1Q861 3CCM1 4NBEA 1M1K1 3H3VJ 2QLVB 1VQO1 2DE7A 1VQK1 1TWAI 1TWHI 3G4S1 4A3MI 1M902 1YI21 2M48A 1VQNZ 3G711 3HOUI 4TNUA 1VQ7Z 4EWCA 1ZH1A 1YJW1 1VQ91 1RO2A 2QA41 1Q862 1M1K2 2R92I 5C4JI 2QRDB 3GTJI 3I56Z 3LUSA 1Q821 5C3EI 1KRLA 2RIQA 3D9XA 1RNIA 1WCMI 2K5RA 2PK7A 3HOZI 1VQ71 3PO3I 1I50I 2E9HA 1ZB9A 3RZOI 4A3DI 4E31A 2RPRA 2VF1A 3CXCZ 3S14I 5FLXf 2H85A 1Z01A 1Q822 3CCQZ 2QEXZ 2E2II 3CCJ1 4A3FI 4NBFA 3CPWY 1RO0A 3J80f 1K9M1 5T67A 1NP6A 1YUKA 3GTLI 3CCE1 3S16I 1SFOI 3EERA 1Q811 3CC2Z 3IFUA 3CCLZ 1S7MA 1VQ51 3NFZA 2EGTA 3CCUZ 1K83I 1QF8A 1YJ91 2IZ4A 2VUMI 2I3CA 2PM9A 3IX0A 3JAMf 4MH4A 3HOXI 3CXCY 1K9M2 2LIYA 1Q812 3GTQI 3S15I 2NVXI 2OTJ1 3CC21 3GKQA 5FLXb 3GTMS 3CQZI 1RO4A 3EEDA 3S1QI 3D6WA 2JR6A 4A3EI 1YIJ1 3CCR1 4QTTA 1K8A1 3KIFA 1QYPA 3CCMZ 2YU9I 4HH4A 3S1NI 1W2BY 1VQOZ 3P5JB 5IP7I 5IP9I 4HGZA 2E2JI 1YJN1 4BBRI 1VQKZ 3G4SZ 3HOYI 4DGLA 3MZLB 1VQ41 2R7ZI 1YI2Z 3JAMb 4A3GI 4NOZA 3G71Z 3FQMA 2QKDA 4NBCA 3CCV1 1K8A2 1VQM1 1YJWZ 1VQ9Z 2QA4Z 2OTL1 3KIHA 2V8IA 1X3ZA 3CME1 4MD8A 1X3WA 2LFUA 2JA5I 3F3FC 4NB9A 4A3CI 1JWHC 1VQP1 1Z03A 5C4XI 2P3YA 4NBBA 1TWGI 3I4NI 1YIT1 1N8R1 3BG1B 4A3KI 3Q87A 4NBAA 3CPWZ 4DK1A 2O4HA 2JNYA 2QREB 3M3YI 3CCJZ 2P28A 2R93I 1WIIA 2GU2A 3CMA1 5D1OB 4E32A 3CCEZ 2AKLA 1N8R2 3HOWI 1Q7Y1 4E2WA 3NDJA 3MONA 1N2FA 2KPIA 3S2HI 1VQ5Z 2WAQA 3ESWA 3GTMI 1WW9A 4E2XA 4NFRA 2YADA 5IT9f 3CD61 4BXXI 2RBLA 1YJ9Z 3CC41 4RV9A 1YHQ1 1KC81 2OOYB 2R6MA 2W03A 3VMIA 4MD7A 4MONA 4AYBA 2OTJZ 3GTKI 2OOXB 1Q7Y2 2F4MA 1R9TI 1S721 1Y1WI 2NVTI 3S1MI 2W04A 2DE6A 1NJI1 3TE5B 3NDIA 1YIJZ 3CCRZ 1W2BZ 2QR1B 1KC82 1I3QI 3F3PC 3S1RI 3I4MI 2JA8I 4BBSI 5D1PA 3CC71 1KQSY 2RT9A 2Y0SA 3U50C 1YJNZ 5IT9b 1VQ4Z 1NJI2 4XX2A 4Y52I 3CCVZ 4A3II 1VQMZ 3J80b 2ZAEB 2OTLZ 3CMEZ 4E33A 4NB8A 2Q51A 1VQPZ 1VQ81 4A3JI 1LQLA 5C44I 1VQ61 1I6HI 4QTUA 3G6E1 1YITZ 2HU9A 1VLAA 3MZKB 2KI7B 3IF8A 1RQFA 4MD9A 4RVGA 3VMHA 3CCS1 1TWFI 3PO2I 2JS4A 3GTOI 1TWCI 3CMAZ 3GCFA 4A3BI 5A2Qf 2K3RA 4HGYA 4CL1A 3NH8A 2QRCB 5AN9F 1JJ2Y 1QVGZ 3TDHB 3BG0B 3CD6Z 2O53A 3CC4Z 1TFIA 1YHQZ 2JA6I 1QVFZ 1USPA 3S17I 3M4OI 3I551 2WB1A 2V8KA 4RVHA 2PMZA 2F4OA 1VQL1 1YUAA 1NUIA 2OZKA 1S72Z 4A93I 3S2DI 2VUGA 3J7A4 1P9NA 1Y1VI 2RHBA 5CM2M 1KQSZ 5A2Qb 4E30A 2HF1A 1Z02A 1QVGY 1VQN1 3NH5A 4RS4A 3VB9A 3CC7Z 4Y7NI 3QWUA 3K7AI 4NBDA 1ML8A 1QVFY 3I07A 2GTHA 1KD11 3OW2Z 3VTNA 4A3LI 5T64A 3I561 4NBGA 2V8JA 4NH1C 3HKZA 1DL6A 3GTGI 5FLMI 2BJOA 2GTIA 1ZB8A 4MXUA 3NH4A 3T4NB 1PFTA 4E2ZA 4RVDA 1KD12 1VQ8Z 1VQ6Z 1X0TA 1Y1VS 5D1OA 2NVQI 1L1OC 3FKII 3G6EZ 4DQYB 2QEX1 3CCQ1 2IZ3A 3GTPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MON A;  1KRL A;  3MON A; 
#chains in the Genus database with same CATH topology
 3J81 f;  5LL6 f;  3OW2 Y;  2JIP A;  2JMO A;  3H0G I;  3CCL 1;  3PO3 S;  3CCS Z;  4X6A I;  4S1T A;  4RVF A;  2E2H I;  3IR7 A;  2JUB A;  3FQQ A;  3RZD I;  1JJ2 Z;  1K73 1;  3CCU 1;  2M6N A;  2J6A A;  2NVY I;  1USP B;  4E2Y A;  1RLY A;  2DE5 A;  2IV2 X;  4MRI A;  2JA7 I;  2Q4Z A;  2G2K A;  1M90 1;  5T6B A;  2B63 I;  1WJ2 A;  3HOV I;  3I55 Z;  4NBH A;  3J81 b;  1K73 2;  4BY1 I;  1VQL Z;  4BY7 I;  3VMG A;  1Q86 1;  3CCM 1;  4NBE A;  1M1K 1;  3H3V J;  2QLV B;  1VQO 1;  2DE7 A;  1VQK 1;  1TWA I;  1TWH I;  3G4S 1;  4A3M I;  1M90 2;  1YI2 1;  1Y8C A;  2M48 A;  1VQN Z;  3G71 1;  3HOU I;  4TNU A;  1VQ7 Z;  1FDO A;  4EWC A;  1ZH1 A;  1YJW 1;  1VQ9 1;  1RO2 A;  2QA4 1;  1Q86 2;  1M1K 2;  2R92 I;  5C4J I;  2QRD B;  3GTJ I;  3I56 Z;  3LUS A;  1Q82 1;  1QXF A;  5C3E I;  1KRL A;  2RIQ A;  3D9X A;  1RNI A;  1WCM I;  2VPY A;  2K5R A;  2PK7 A;  3HOZ I;  1VQ7 1;  3PO3 I;  1I50 I;  2E9H A;  1ZB9 A;  3RZO I;  4A3D I;  4E31 A;  2RPR A;  2VF1 A;  3CXC Z;  3S14 I;  5FLX f;  2H85 A;  1Z01 A;  1Q82 2;  3CCQ Z;  2QEX Z;  2E2I I;  3CCJ 1;  4A3F I;  4NBF A;  3CPW Y;  1RO0 A;  3J80 f;  1K9M 1;  5T67 A;  1NP6 A;  1YUK A;  3GTL I;  3CCE 1;  3S16 I;  1SFO I;  3EER A;  1Q81 1;  2NAP A;  3IFU A;  3CC2 Z;  3CCL Z;  1S7M A;  1VQ5 1;  3NFZ A;  2EGT A;  1WZN A;  3CCU Z;  1K83 I;  1QF8 A;  1YJ9 1;  2IZ4 A;  2VUM I;  2I3C A;  2PM9 A;  3IX0 A;  3JAM f;  4MH4 A;  3HOX I;  3CXC Y;  1K9M 2;  2LIY A;  1Q81 2;  3GTQ I;  3S15 I;  2NVX I;  2OTJ 1;  3CC2 1;  3GKQ A;  5FLX b;  3GTM S;  3CQZ I;  1RO4 A;  3EED A;  3S1Q I;  3D6W A;  2JR6 A;  4A3E I;  1YIJ 1;  3CCR 1;  4QTT A;  1K8A 1;  2JIM A;  2VPW A;  3KIF A;  1QYP A;  3CCM Z;  2YU9 I;  4HH4 A;  3S1N I;  1W2B Y;  3P5J B;  1VQO Z;  5IP7 I;  5IP9 I;  4HGZ A;  2E2J I;  1YJN 1;  4BBR I;  1VQK Z;  3G4S Z;  3HOY I;  4DGL A;  3MZL B;  1VQ4 1;  2R7Z I;  1YI2 Z;  3JAM b;  4A3G I;  4NOZ A;  3G71 Z;  3FQM A;  2QKD A;  4NBC A;  3CCV 1;  1K8A 2;  1VQM 1;  1YJW Z;  1VQ9 Z;  2QA4 Z;  2OTL 1;  3KIH A;  2V8I A;  1X3Z A;  3CME 1;  4MD8 A;  1X3W A;  2VPZ A;  2LFU A;  2JA5 I;  3F3F C;  4NB9 A;  4A3C I;  1JWH C;  1VQP 1;  1Z03 A;  5C4X I;  2P3Y A;  4NBB A;  1TWG I;  2VPX A;  3I4N I;  1YIT 1;  1N8R 1;  3BG1 B;  4A3K I;  1FDI A;  3Q87 A;  2JIO A;  4NBA A;  3CPW Z;  4DK1 A;  2O4H A;  2JNY A;  2QRE B;  3M3Y I;  3CCJ Z;  2P28 A;  2R93 I;  1WII A;  2GU2 A;  3CMA 1;  5D1O B;  4E32 A;  3CCE Z;  2AKL A;  2AYD A;  1N8R 2;  3HOW I;  1Q7Y 1;  4E2W A;  3NDJ A;  3MON A;  1N2F A;  2KPI A;  3S2H I;  1VQ5 Z;  2WAQ A;  3ESW A;  3GTM I;  1WW9 A;  4E2X A;  4NFR A;  2YAD A;  5IT9 f;  3CD6 1;  4BXX I;  2RBL A;  1YJ9 Z;  3CC4 1;  2E7Z A;  4RV9 A;  1YHQ 1;  1KC8 1;  2OOY B;  1Q16 A;  2R6M A;  2W03 A;  3VMI A;  4MD7 A;  4MON A;  4AYB A;  2OTJ Z;  3GTK I;  2OOX B;  1Q7Y 2;  2F4M A;  1R9T I;  1S72 1;  1Y1W I;  2NVT I;  3S1M I;  2W04 A;  2DE6 A;  1NJI 1;  3TE5 B;  3NDI A;  1YIJ Z;  3CCR Z;  1W2B Z;  2QR1 B;  1KC8 2;  1I3Q I;  2JIR A;  3F3P C;  3S1R I;  3I4M I;  2JA8 I;  4BBS I;  5D1P A;  3CC7 1;  1KQS Y;  2RT9 A;  2Y0S A;  3U50 C;  1YJN Z;  5IT9 b;  1VQ4 Z;  1NJI 2;  4XX2 A;  4Y52 I;  3CCV Z;  4A3I I;  1VQM Z;  3J80 b;  2ZAE B;  2OTL Z;  3CME Z;  4E33 A;  2V3V A;  4NB8 A;  2Q51 A;  2LEX A;  1VQP Z;  1VQ8 1;  1LQL A;  4A3J I;  5C44 I;  1VQ6 1;  1I6H I;  4QTU A;  3G6E 1;  1YIT Z;  2HU9 A;  1VLA A;  3MZK B;  2KI7 B;  3IF8 A;  1RQF A;  4MD9 A;  4RVG A;  3VMH A;  3CCS 1;  1TWF I;  3PO2 I;  2JS4 A;  3GTO I;  1TWC I;  3CMA Z;  3GCF A;  4A3B I;  5A2Q f;  2K3R A;  4HGY A;  4CL1 A;  3NH8 A;  2QRC B;  5AN9 F;  1JJ2 Y;  1QVG Z;  3TDH B;  3BG0 B;  3CD6 Z;  2O53 A;  3CC4 Z;  1TFI A;  1YHQ Z;  2JA6 I;  1QVF Z;  1USP A;  3S17 I;  3M4O I;  3I55 1;  2JIQ A;  2WB1 A;  2V8K A;  4RVH A;  2PMZ A;  2F4O A;  1VQL 1;  1YUA A;  2V45 A;  1NUI A;  2OZK A;  1S72 Z;  4A93 I;  3S2D I;  2VUG A;  3J7A 4;  1P9N A;  1Y1V I;  2RHB A;  5CM2 M;  1KQS Z;  5A2Q b;  4E30 A;  2HF1 A;  1Z02 A;  3D2L A;  1QVG Y;  1VQN 1;  3NH5 A;  4RS4 A;  3VB9 A;  3CC7 Z;  4Y7N I;  3QWU A;  3K7A I;  4NBD A;  1ML8 A;  1QVF Y;  3I07 A;  2GTH A;  1KD1 1;  3OW2 Z;  3VTN A;  4A3L I;  5T64 A;  3I56 1;  4NBG A;  2V8J A;  4NH1 C;  1AA6 A;  3HKZ A;  1DL6 A;  1SIW A;  3GTG I;  5FLM I;  2BJO A;  2GTI A;  1ZB8 A;  4MXU A;  3NH4 A;  3T4N B;  1PFT A;  4E2Z A;  4RVD A;  1KD1 2;  1VQ8 Z;  1VQ6 Z;  1X0T A;  1Y1V S;  5D1O A;  2NVQ I;  1L1O C;  3FKI I;  3G6E Z;  4DQY B;  2QEX 1;  3CCQ 1;  2IZ3 A;  3GTP I; 
#chains in the Genus database with same CATH homology
 3J81 f;  5LL6 f;  3OW2 Y;  2JMO A;  3H0G I;  3CCL 1;  3PO3 S;  3CCS Z;  4X6A I;  4S1T A;  4RVF A;  2E2H I;  2JUB A;  3FQQ A;  3RZD I;  1JJ2 Z;  1K73 1;  3CCU 1;  2M6N A;  2J6A A;  2NVY I;  1USP B;  4E2Y A;  1RLY A;  2DE5 A;  4MRI A;  2JA7 I;  2Q4Z A;  2G2K A;  1M90 1;  5T6B A;  2B63 I;  3HOV I;  3I55 Z;  4NBH A;  3J81 b;  1K73 2;  4BY1 I;  1VQL Z;  4BY7 I;  3VMG A;  1Q86 1;  3CCM 1;  4NBE A;  1M1K 1;  3H3V J;  2QLV B;  1VQO 1;  2DE7 A;  1VQK 1;  1TWA I;  1TWH I;  3G4S 1;  4A3M I;  1M90 2;  1YI2 1;  2M48 A;  1VQN Z;  3G71 1;  3HOU I;  4TNU A;  1VQ7 Z;  4EWC A;  1ZH1 A;  1YJW 1;  1VQ9 1;  1RO2 A;  2QA4 1;  1Q86 2;  1M1K 2;  2R92 I;  5C4J I;  2QRD B;  3GTJ I;  3I56 Z;  3LUS A;  1Q82 1;  5C3E I;  1KRL A;  2RIQ A;  3D9X A;  1RNI A;  1WCM I;  2K5R A;  2PK7 A;  3HOZ I;  1VQ7 1;  3PO3 I;  1I50 I;  2E9H A;  1ZB9 A;  3RZO I;  4A3D I;  4E31 A;  2RPR A;  2VF1 A;  3CXC Z;  3S14 I;  5FLX f;  2H85 A;  1Z01 A;  1Q82 2;  3CCQ Z;  2QEX Z;  2E2I I;  3CCJ 1;  4A3F I;  4NBF A;  3CPW Y;  1RO0 A;  3J80 f;  1K9M 1;  5T67 A;  1NP6 A;  1YUK A;  3GTL I;  3CCE 1;  3S16 I;  1SFO I;  3EER A;  1Q81 1;  3CC2 Z;  3IFU A;  3CCL Z;  1S7M A;  1VQ5 1;  3NFZ A;  2EGT A;  3CCU Z;  1K83 I;  1QF8 A;  1YJ9 1;  2IZ4 A;  2VUM I;  2I3C A;  2PM9 A;  3IX0 A;  3JAM f;  4MH4 A;  3HOX I;  3CXC Y;  1K9M 2;  2LIY A;  1Q81 2;  3GTQ I;  3S15 I;  2NVX I;  2OTJ 1;  3CC2 1;  3GKQ A;  5FLX b;  3GTM S;  3CQZ I;  1RO4 A;  3EED A;  3S1Q I;  3D6W A;  2JR6 A;  4A3E I;  1YIJ 1;  3CCR 1;  4QTT A;  1K8A 1;  3KIF A;  1QYP A;  3CCM Z;  2YU9 I;  4HH4 A;  3S1N I;  1W2B Y;  1VQO Z;  3P5J B;  5IP7 I;  5IP9 I;  4HGZ A;  2E2J I;  1YJN 1;  4BBR I;  1VQK Z;  3G4S Z;  3HOY I;  4DGL A;  3MZL B;  1VQ4 1;  2R7Z I;  1YI2 Z;  3JAM b;  4A3G I;  4NOZ A;  3G71 Z;  3FQM A;  2QKD A;  4NBC A;  3CCV 1;  1K8A 2;  1VQM 1;  1YJW Z;  1VQ9 Z;  2QA4 Z;  2OTL 1;  3KIH A;  2V8I A;  1X3Z A;  3CME 1;  4MD8 A;  1X3W A;  2LFU A;  2JA5 I;  3F3F C;  4NB9 A;  4A3C I;  1JWH C;  1VQP 1;  1Z03 A;  5C4X I;  2P3Y A;  4NBB A;  1TWG I;  3I4N I;  1YIT 1;  1N8R 1;  3BG1 B;  4A3K I;  3Q87 A;  4NBA A;  3CPW Z;  4DK1 A;  2O4H A;  2JNY A;  2QRE B;  3M3Y I;  3CCJ Z;  2P28 A;  2R93 I;  1WII A;  2GU2 A;  3CMA 1;  5D1O B;  4E32 A;  3CCE Z;  2AKL A;  1N8R 2;  3HOW I;  1Q7Y 1;  4E2W A;  3NDJ A;  3MON A;  1N2F A;  2KPI A;  3S2H I;  1VQ5 Z;  2WAQ A;  3ESW A;  3GTM I;  1WW9 A;  4E2X A;  4NFR A;  2YAD A;  5IT9 f;  3CD6 1;  4BXX I;  2RBL A;  1YJ9 Z;  3CC4 1;  4RV9 A;  1YHQ 1;  1KC8 1;  2OOY B;  2R6M A;  2W03 A;  3VMI A;  4MD7 A;  4MON A;  4AYB A;  2OTJ Z;  3GTK I;  2OOX B;  1Q7Y 2;  2F4M A;  1R9T I;  1S72 1;  1Y1W I;  2NVT I;  3S1M I;  2W04 A;  2DE6 A;  1NJI 1;  3TE5 B;  3NDI A;  1YIJ Z;  3CCR Z;  1W2B Z;  2QR1 B;  1KC8 2;  1I3Q I;  3F3P C;  3S1R I;  3I4M I;  2JA8 I;  4BBS I;  5D1P A;  3CC7 1;  1KQS Y;  2RT9 A;  2Y0S A;  3U50 C;  1YJN Z;  5IT9 b;  1VQ4 Z;  1NJI 2;  4XX2 A;  4Y52 I;  3CCV Z;  4A3I I;  1VQM Z;  3J80 b;  2ZAE B;  2OTL Z;  3CME Z;  4E33 A;  4NB8 A;  2Q51 A;  1VQP Z;  1VQ8 1;  4A3J I;  1LQL A;  5C44 I;  1VQ6 1;  1I6H I;  4QTU A;  3G6E 1;  1YIT Z;  2HU9 A;  1VLA A;  3MZK B;  2KI7 B;  3IF8 A;  1RQF A;  4MD9 A;  4RVG A;  3VMH A;  3CCS 1;  1TWF I;  3PO2 I;  2JS4 A;  3GTO I;  1TWC I;  3CMA Z;  3GCF A;  4A3B I;  5A2Q f;  2K3R A;  4HGY A;  4CL1 A;  3NH8 A;  2QRC B;  5AN9 F;  1JJ2 Y;  1QVG Z;  3TDH B;  3BG0 B;  3CD6 Z;  2O53 A;  3CC4 Z;  1TFI A;  1YHQ Z;  2JA6 I;  1QVF Z;  1USP A;  3S17 I;  3M4O I;  3I55 1;  2WB1 A;  2V8K A;  4RVH A;  2PMZ A;  2F4O A;  1VQL 1;  1YUA A;  1NUI A;  2OZK A;  1S72 Z;  4A93 I;  3S2D I;  2VUG A;  3J7A 4;  1P9N A;  1Y1V I;  2RHB A;  5CM2 M;  1KQS Z;  5A2Q b;  4E30 A;  2HF1 A;  1Z02 A;  1QVG Y;  1VQN 1;  3NH5 A;  4RS4 A;  3VB9 A;  3CC7 Z;  4Y7N I;  3QWU A;  3K7A I;  4NBD A;  1ML8 A;  1QVF Y;  3I07 A;  2GTH A;  1KD1 1;  3OW2 Z;  3VTN A;  4A3L I;  5T64 A;  3I56 1;  4NBG A;  2V8J A;  4NH1 C;  3HKZ A;  1DL6 A;  3GTG I;  5FLM I;  2BJO A;  2GTI A;  1ZB8 A;  4MXU A;  3NH4 A;  3T4N B;  1PFT A;  4E2Z A;  4RVD A;  1KD1 2;  1VQ8 Z;  1VQ6 Z;  1X0T A;  1Y1V S;  5D1O A;  2NVQ I;  1L1O C;  3FKI I;  3G6E Z;  4DQY B;  2QEX 1;  3CCQ 1;  2IZ3 A;  3GTP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...