3G6EZ

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g6eZ00
1KD11 3CMEZ 1YIJ1 3I561 3CC41 1K731 3CCSZ 3I56Z 3CCV1 1Q862 1Q821 3I551 3CMA1 3CCE1 1N8R1 1M901 1YIT1 3CCUZ 1VQ8Z 1K8A2 1KC81 1KQSZ 1Q811 3CXCZ 3CCU1 3CC71 1VQL1 2OTL1 3CD6Z 1VQ81 1VQ61 1VQPZ 2QEX1 1W2BY 1VQNZ 1YJW1 1VQOZ 1VQ6Z 1VQN1 1QVFZ 3CC21 1YI2Z 1VQP1 1QVFY 3CCQZ 1Q822 1KQSY 3CPWZ 2OTJZ 1YI21 3CCM1 2QA41 1VQ91 3G4SZ 1VQ51 3CCVZ 1VQ4Z 1KD12 1QVGY 1YHQZ 1VQLZ 3CC7Z 2OTLZ 3CD61 2OTJ1 1VQ9Z 1KC82 3CCRZ 1VQ5Z 1YITZ 1YJNZ 1N8R2 3G71Z 1K9M1 1M1K2 3CCR1 1VQ71 1Q861 1Q812 3G6E1 3CC4Z 3CPWY 1QVGZ 1YJ91 1K8A1 2QEXZ 1VQK1 3CCS1 1YJ9Z 2QA4Z 3G6EZ 1NJI1 3G4S1 1YIJZ 1NJI2 1VQ41 1VQMZ 3G711 1JJ2Y 1S721 1Q7Y1 1S72Z 3CCL1 1YJWZ 1VQM1 1JJ2Z 1K732 3OW2Y 1VQKZ 3CME1 3CCJZ 1VQO1 1YHQ1 1M902 3CCLZ 3CCJ1 1Q7Y2 1VQ7Z 3CCMZ 1K9M2 1M1K1 3I55Z 1W2BZ 3CCQ1 3CCEZ 3CC2Z 1YJN1 3CXCY 3OW2Z 3CMAZ
chains in the Genus database with same CATH superfamily
3I4NI 2YU9I 4A3II 1Q16A 4DGLA 2E2JI 1TWCI 1M901 2GTIA 1VQ8Z 2E9HA 3S1RI 2JS4A 2QRCB 3GKQA 2OTL1 3CD6Z 3FQQA 2IZ3A 4A3KI 2QEX1 2EGTA 2GU2A 1VQOZ 1SFOI 3CC21 3EERA 3GTMI 3LUSA 1KQSY 4NB9A 5T67A 3KIHA 2F4MA 4A3DI 3G4SZ 3CCVZ 1VQ4Z 1KD12 4BY1I 4A3CI 2WB1A 1VLAA 1WIIA 2OTLZ 3CD61 2DE5A 1WW9A 1VQ9Z 3CCRZ 1VQ5Z 1JWHC 1YJNZ 3FKII 5FLXb 4MXUA 5IT9f 3CCR1 3IF8A 1Q861 2JA6I 4MD8A 2KI7B 3IR7A 4A3MI 2PK7A 2RHBA 4HGYA 3G6EZ 3G4S1 5D1OA 1X3ZA 1VQMZ 3G711 4E32A 2JIMA 4Y52I 3CCL1 3PO3S 3K7AI 5LL6f 3OW2Y 2H85A 4XX2A 3CME1 2JA8I 2VF1A 1YHQ1 3HOUI 4BBSI 3IFUA 3T4NB 4RVFA 3CCJ1 3Q87A 1AA6A 4QTUA 2JIOA 2YADA 1W2BZ 3TE5B 2RT9A 3CC2Z 2K3RA 3I4MI 1YUKA 2E2HI 1TWFI 3I561 2DE7A 3KIFA 3CC41 1K731 2O4HA 3I56Z 3CCV1 1I6HI 1Q821 3GTQI 3JAMb 3M4OI 2JMOA 1Y1VI 4DK1A 4NBGA 3M3YI 3ESWA 1KQSZ 3S1MI 1Q811 2VPYA 3CXCZ 1I50I 1VQL1 2P28A 3D2LA 4RVGA 5D1OB 1VQPZ 3HKZA 1FDOA 1VQNZ 1YJW1 3S17I 1TFIA 2RPRA 1VQN1 3F3PC 2IV2X 1Q822 4CL1A 3CPWZ 2QA41 5AN9F 1VQ51 4RV9A 1ML8A 4NBEA 3HOYI 4NBAA 1PFTA 2V3VA 2GTHA 1N2FA 3J81f 1YHQZ 1VQLZ 2OTJ1 3MZKB 1WCMI 2RIQA 5C44I 4S1TA 5IT9b 1QVGZ 3P5JB 2R6MA 2OOXB 2VPXA 3TDHB 1K8A1 3NH4A 3BG0B 1VQK1 2VPWA 1Z02A 2QLVB 3D9XA 1YJ9Z 2QA4Z 4MONA 3F3FC 2BJOA 4X6AI 3D6WA 1NJI1 1NJI2 1YIJZ 5T6BA 4E2ZA 2JIPA 4A3BI 3PO3I 2W04A 1Q7Y1 1RLYA 3MONA 2QKDA 1YJWZ 2JIQA 3S1NI 3CCJZ 2LIYA 1VQO1 3FQMA 1M902 1X0TA 1WZNA 1X3WA 3H0GI 3I07A 2NVQI 2AYDA 1Z01A 2JA7I 4RVHA 3CXCY 2R7ZI 3CMEZ 2IZ4A 1YIJ1 4E30A 1Q862 3CMA1 5D1PA 3CCE1 3HOVI 3S16I 3CCUZ 3GTPI 1RO2A 3CCU1 2G2KA 3HOZI 4A3GI 2E7ZA 2KPIA 4NBFA 2VUGA 1VQ81 3GTOI 3GTKI 1P9NA 1WJ2A 3VTNA 3J81b 4NOZA 2B63I 1QVFY 3CCQZ 4NH1C 3BG1B 1YI21 3CCM1 4MH4A 1Y8CA 1ZH1A 2PM9A 1VQ91 4MRIA 4EWCA 4A93I 3NDJA 2M48A 4TNUA 1QVGY 3PO2I 3HOXI 5C3EI 3CQZI 1USPB 2ZAEB 2VUMI 1KC82 1YITZ 1TWHI 4MD9A 3G71Z 5FLMI 5A2Qb 3VB9A 3J7A4 2WAQA 2JA5I 2Q51A 3G6E1 3CC4Z 3S14I 2NAPA 4BBRI 1YJ91 2QEXZ 2R92I 1QYPA 2QRDB 4A3LI 1S7MA 4AYBA 1JJ2Y 5C4XI 2RBLA 2VPZA 4BY7I 3GCFA 1RNIA 2JUBA 4E31A 3VMHA 3GTJI 2DE6A 1FDIA 1S72Z 4E2WA 1JJ2Z 1K732 2JR6A 3MZLB 3GTLI 2V45A 3RZDI 1TWGI 3GTMS 2HF1A 3NH5A 1Z03A 1ZB8A 1K9M2 1M1K1 3EEDA 3CCQ1 2P3YA 4NBBA 3CCEZ 2LEXA 2NVXI 2I3CA 3CMAZ 3S1QI 1KD11 1NUIA 4NBDA 3QWUA 4MD7A 4Y7NI 2E2II 3CCSZ 3J80b 2O53A 1RQFA 3I551 1ZB9A 3J80f 1N8R1 1YIT1 2V8KA 1K8A2 1KC81 5T64A 4A3FI 3CC71 2OZKA 3U50C 3HOWI 5C4JI 1VQ61 1W2BY 5IP7I 2Y0SA 2HU9A 4E33A 1VQ6Z 4NB8A 1RO4A 2V8JA 2V8IA 2J6AA 2JNYA 1QVFZ 1YI2Z 4NBHA 1VQP1 1SIWA 5IP9I 4RS4A 2OTJZ 2NVYI 1I3QI 3NFZA 2M6NA 2R93I 4NBCA 4A3JI 3S15I 1USPA 3RZOI 1Y1WI 2PMZA 3VMGA 3S2HI 3CC7Z 4E2XA 4DQYB 1LQLA 1N8R2 1K9M1 1M1K2 1K83I 1KRLA 1R9TI 1VQ71 4QTTA 1Q812 3CPWY 5A2Qf 5CM2M 1TWAI 4NFRA 3JAMf 1DL6A 3CCS1 3GTGI 4RVDA 1YUAA 4E2YA 1VQ41 3NH8A 1QF8A 4HH4A 2AKLA 2LFUA 1S721 3S2DI 2QREB 2W03A 1RO0A 2NVTI 3IX0A 2OOYB 5FLXf 1VQM1 2F4OA 1VQKZ 4A3EI 2K5RA 3NDIA 3CCLZ 1Y1VS 1Q7Y2 1NP6A 1VQ7Z 1L1OC 4HGZA 2QR1B 2JIRA 3CCMZ 3I55Z 4BXXI 3H3VJ 1QXFA 2Q4ZA 3VMIA 1YJN1 3OW2Z
chains in the Genus database with same CATH topology
3I4NI 2YU9I 4A3II 4DGLA 2E2JI 1TWCI 1M901 2GTIA 1VQ8Z 2E9HA 3S1RI 2JS4A 2QRCB 3GKQA 2OTL1 3CD6Z 3FQQA 2IZ3A 4A3KI 2QEX1 2EGTA 2GU2A 1VQOZ 1SFOI 3CC21 3EERA 3GTMI 3LUSA 1KQSY 4NB9A 5T67A 3KIHA 2F4MA 4A3DI 3G4SZ 3CCVZ 1VQ4Z 1KD12 4BY1I 4A3CI 2WB1A 1VLAA 1WIIA 2OTLZ 3CD61 2DE5A 1WW9A 1VQ9Z 3CCRZ 1VQ5Z 1JWHC 1YJNZ 3FKII 5FLXb 4MXUA 5IT9f 3CCR1 3IF8A 1Q861 2JA6I 4MD8A 2KI7B 4A3MI 2PK7A 2RHBA 4HGYA 3G6EZ 3G4S1 5D1OA 1X3ZA 1VQMZ 3G711 4E32A 4Y52I 3CCL1 3PO3S 3K7AI 5LL6f 3OW2Y 2H85A 4XX2A 3CME1 2JA8I 2VF1A 1YHQ1 3HOUI 4BBSI 3IFUA 3T4NB 4RVFA 3CCJ1 3Q87A 4QTUA 2YADA 1W2BZ 3TE5B 2RT9A 3CC2Z 2K3RA 3I4MI 1YUKA 2E2HI 1TWFI 3I561 2DE7A 3KIFA 3CC41 1K731 2O4HA 3I56Z 3CCV1 1I6HI 1Q821 3GTQI 3JAMb 3M4OI 2JMOA 1Y1VI 4DK1A 4NBGA 3M3YI 3ESWA 1KQSZ 3S1MI 1Q811 3CXCZ 1I50I 1VQL1 2P28A 4RVGA 5D1OB 1VQPZ 3HKZA 1VQNZ 1YJW1 3S17I 1TFIA 2RPRA 1VQN1 3F3PC 1Q822 4CL1A 3CPWZ 2QA41 5AN9F 1VQ51 4RV9A 1ML8A 4NBEA 3HOYI 4NBAA 1PFTA 2GTHA 1N2FA 3J81f 1YHQZ 1VQLZ 2OTJ1 3MZKB 1WCMI 2RIQA 5C44I 4S1TA 5IT9b 1QVGZ 3P5JB 2R6MA 2OOXB 3TDHB 1K8A1 3NH4A 3BG0B 1VQK1 1Z02A 2QLVB 3D9XA 1YJ9Z 2QA4Z 4MONA 3F3FC 2BJOA 4X6AI 3D6WA 1NJI1 1NJI2 1YIJZ 5T6BA 4E2ZA 4A3BI 3PO3I 1Q7Y1 2W04A 1RLYA 3MONA 2QKDA 1YJWZ 3S1NI 3CCJZ 2LIYA 1VQO1 3FQMA 1M902 1X0TA 1X3WA 3H0GI 3I07A 2NVQI 1Z01A 2JA7I 4RVHA 3CXCY 2R7ZI 3CMEZ 2IZ4A 1YIJ1 4E30A 1Q862 3CMA1 5D1PA 3CCE1 3HOVI 3S16I 3CCUZ 3GTPI 1RO2A 3CCU1 2G2KA 3HOZI 4A3GI 2KPIA 4NBFA 2VUGA 1VQ81 3GTOI 3GTKI 1P9NA 3VTNA 3J81b 4NOZA 2B63I 1QVFY 3CCQZ 4NH1C 3BG1B 1YI21 3CCM1 4MH4A 1ZH1A 2PM9A 1VQ91 4MRIA 4EWCA 4A93I 3NDJA 2M48A 4TNUA 1QVGY 3PO2I 3HOXI 5C3EI 3CQZI 1USPB 2ZAEB 2VUMI 1KC82 1YITZ 1TWHI 4MD9A 3G71Z 5FLMI 5A2Qb 3VB9A 3J7A4 2WAQA 2JA5I 2Q51A 3G6E1 3CC4Z 3S14I 4BBRI 1YJ91 2QEXZ 2R92I 1QYPA 2QRDB 4A3LI 1S7MA 4AYBA 1JJ2Y 5C4XI 2RBLA 4BY7I 3GCFA 1RNIA 2JUBA 4E31A 3VMHA 3GTJI 2DE6A 1S72Z 4E2WA 1JJ2Z 1K732 2JR6A 3MZLB 3GTLI 3RZDI 1TWGI 3GTMS 2HF1A 3NH5A 1Z03A 1ZB8A 1K9M2 1M1K1 3EEDA 3CCQ1 2P3YA 4NBBA 3CCEZ 2NVXI 2I3CA 3CMAZ 3S1QI 1KD11 1NUIA 4NBDA 3QWUA 4MD7A 4Y7NI 2E2II 3CCSZ 3J80b 2O53A 1RQFA 3I551 1ZB9A 3J80f 1N8R1 1YIT1 2V8KA 1K8A2 1KC81 5T64A 4A3FI 3CC71 2OZKA 3U50C 3HOWI 5C4JI 1VQ61 1W2BY 5IP7I 2Y0SA 2HU9A 4E33A 1VQ6Z 4NB8A 1RO4A 2V8JA 2V8IA 2J6AA 2JNYA 1QVFZ 1YI2Z 4NBHA 1VQP1 5IP9I 4RS4A 2OTJZ 2NVYI 1I3QI 3NFZA 2M6NA 2R93I 4NBCA 4A3JI 3S15I 1USPA 3RZOI 1Y1WI 2PMZA 3VMGA 3S2HI 3CC7Z 4E2XA 4DQYB 1LQLA 1N8R2 1K9M1 1M1K2 1K83I 1KRLA 1R9TI 1VQ71 4QTTA 1Q812 3CPWY 5A2Qf 5CM2M 1TWAI 4NFRA 3JAMf 1DL6A 3CCS1 3GTGI 4RVDA 1YUAA 4E2YA 1VQ41 3NH8A 1QF8A 4HH4A 2AKLA 2LFUA 1S721 3S2DI 2QREB 2W03A 1RO0A 2NVTI 3IX0A 2OOYB 5FLXf 1VQM1 2F4OA 1VQKZ 4A3EI 2K5RA 3NDIA 3CCLZ 1Y1VS 1Q7Y2 1NP6A 1VQ7Z 1L1OC 4HGZA 2QR1B 3CCMZ 3I55Z 4BXXI 3H3VJ 2Q4ZA 3VMIA 1YJN1 3OW2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 1;  3CME Z;  1YIJ 1;  3I56 1;  3CC4 1;  1K73 1;  3CCS Z;  3I56 Z;  3CCV 1;  1Q86 2;  1Q82 1;  3I55 1;  3CMA 1;  3CCE 1;  1N8R 1;  1M90 1;  1YIT 1;  3CCU Z;  1VQ8 Z;  1K8A 2;  1KC8 1;  1KQS Z;  1Q81 1;  3CXC Z;  3CCU 1;  3CC7 1;  1VQL 1;  2OTL 1;  3CD6 Z;  1VQ8 1;  1VQ6 1;  1VQP Z;  2QEX 1;  1W2B Y;  1VQN Z;  1YJW 1;  1VQO Z;  1VQ6 Z;  1VQN 1;  1QVF Z;  3CC2 1;  1YI2 Z;  1VQP 1;  1QVF Y;  3CCQ Z;  1Q82 2;  1KQS Y;  3CPW Z;  2OTJ Z;  1YI2 1;  3CCM 1;  2QA4 1;  1VQ9 1;  3G4S Z;  1VQ5 1;  3CCV Z;  1VQ4 Z;  1KD1 2;  1QVG Y;  1YHQ Z;  1VQL Z;  3CC7 Z;  2OTL Z;  3CD6 1;  2OTJ 1;  1VQ9 Z;  1KC8 2;  3CCR Z;  1VQ5 Z;  1YIT Z;  1YJN Z;  1N8R 2;  3G71 Z;  1K9M 1;  1M1K 2;  3CCR 1;  1VQ7 1;  1Q86 1;  1Q81 2;  3G6E 1;  3CC4 Z;  3CPW Y;  1QVG Z;  1YJ9 1;  1K8A 1;  2QEX Z;  1VQK 1;  3CCS 1;  1YJ9 Z;  2QA4 Z;  3G6E Z;  1NJI 1;  3G4S 1;  1YIJ Z;  1NJI 2;  1VQ4 1;  1VQM Z;  3G71 1;  1JJ2 Y;  1S72 1;  1Q7Y 1;  1S72 Z;  3CCL 1;  1YJW Z;  1VQM 1;  1JJ2 Z;  1K73 2;  3OW2 Y;  1VQK Z;  3CME 1;  3CCJ Z;  1VQO 1;  1YHQ 1;  1M90 2;  3CCL Z;  3CCJ 1;  1Q7Y 2;  1VQ7 Z;  3CCM Z;  1K9M 2;  1M1K 1;  3I55 Z;  1W2B Z;  3CCQ 1;  3CCE Z;  3CC2 Z;  1YJN 1;  3CXC Y;  3OW2 Z;  3CMA Z; 
#chains in the Genus database with same CATH topology
 3I4N I;  2YU9 I;  4A3I I;  1Q16 A;  4DGL A;  2E2J I;  1TWC I;  1M90 1;  2GTI A;  1VQ8 Z;  2E9H A;  3S1R I;  2JS4 A;  2QRC B;  3GKQ A;  2OTL 1;  3CD6 Z;  3FQQ A;  2IZ3 A;  4A3K I;  2QEX 1;  2EGT A;  2GU2 A;  1VQO Z;  1SFO I;  3CC2 1;  3EER A;  3GTM I;  3LUS A;  1KQS Y;  4NB9 A;  5T67 A;  3KIH A;  2F4M A;  4A3D I;  3G4S Z;  3CCV Z;  1VQ4 Z;  1KD1 2;  4BY1 I;  4A3C I;  2WB1 A;  1VLA A;  1WII A;  2OTL Z;  3CD6 1;  2DE5 A;  1WW9 A;  1VQ9 Z;  3CCR Z;  1VQ5 Z;  1JWH C;  1YJN Z;  3FKI I;  5FLX b;  4MXU A;  5IT9 f;  3CCR 1;  3IF8 A;  1Q86 1;  2JA6 I;  4MD8 A;  2KI7 B;  3IR7 A;  4A3M I;  2PK7 A;  2RHB A;  4HGY A;  3G6E Z;  3G4S 1;  5D1O A;  1X3Z A;  1VQM Z;  3G71 1;  4E32 A;  2JIM A;  4Y52 I;  3CCL 1;  3PO3 S;  3K7A I;  5LL6 f;  3OW2 Y;  2H85 A;  4XX2 A;  3CME 1;  2JA8 I;  2VF1 A;  1YHQ 1;  3HOU I;  4BBS I;  3IFU A;  3T4N B;  4RVF A;  3CCJ 1;  3Q87 A;  1AA6 A;  4QTU A;  2JIO A;  2YAD A;  1W2B Z;  3TE5 B;  2RT9 A;  3CC2 Z;  2K3R A;  3I4M I;  1YUK A;  2E2H I;  1TWF I;  3I56 1;  2DE7 A;  3KIF A;  3CC4 1;  1K73 1;  2O4H A;  3I56 Z;  3CCV 1;  1I6H I;  1Q82 1;  3GTQ I;  3JAM b;  3M4O I;  2JMO A;  1Y1V I;  4DK1 A;  4NBG A;  3M3Y I;  3ESW A;  1KQS Z;  3S1M I;  1Q81 1;  2VPY A;  3CXC Z;  1I50 I;  1VQL 1;  2P28 A;  3D2L A;  4RVG A;  5D1O B;  1VQP Z;  3HKZ A;  1FDO A;  1VQN Z;  1YJW 1;  3S17 I;  1TFI A;  2RPR A;  1VQN 1;  3F3P C;  2IV2 X;  1Q82 2;  4CL1 A;  3CPW Z;  2QA4 1;  5AN9 F;  1VQ5 1;  4RV9 A;  1ML8 A;  4NBE A;  3HOY I;  4NBA A;  1PFT A;  2V3V A;  2GTH A;  1N2F A;  3J81 f;  1YHQ Z;  1VQL Z;  2OTJ 1;  3MZK B;  1WCM I;  2RIQ A;  5C44 I;  4S1T A;  5IT9 b;  1QVG Z;  3P5J B;  2R6M A;  2OOX B;  2VPX A;  3TDH B;  1K8A 1;  3NH4 A;  3BG0 B;  1VQK 1;  2VPW A;  1Z02 A;  2QLV B;  3D9X A;  1YJ9 Z;  2QA4 Z;  4MON A;  3F3F C;  2BJO A;  4X6A I;  3D6W A;  1NJI 1;  1NJI 2;  1YIJ Z;  5T6B A;  4E2Z A;  2JIP A;  4A3B I;  3PO3 I;  2W04 A;  1Q7Y 1;  1RLY A;  3MON A;  2QKD A;  1YJW Z;  2JIQ A;  3S1N I;  3CCJ Z;  2LIY A;  1VQO 1;  3FQM A;  1M90 2;  1X0T A;  1WZN A;  1X3W A;  3H0G I;  3I07 A;  2NVQ I;  2AYD A;  1Z01 A;  2JA7 I;  4RVH A;  3CXC Y;  2R7Z I;  3CME Z;  2IZ4 A;  1YIJ 1;  4E30 A;  1Q86 2;  3CMA 1;  5D1P A;  3CCE 1;  3HOV I;  3S16 I;  3CCU Z;  3GTP I;  1RO2 A;  3CCU 1;  2G2K A;  3HOZ I;  4A3G I;  2E7Z A;  2KPI A;  4NBF A;  2VUG A;  1VQ8 1;  3GTO I;  3GTK I;  1P9N A;  1WJ2 A;  3VTN A;  3J81 b;  4NOZ A;  2B63 I;  1QVF Y;  3CCQ Z;  4NH1 C;  3BG1 B;  1YI2 1;  3CCM 1;  4MH4 A;  1Y8C A;  1ZH1 A;  2PM9 A;  1VQ9 1;  4MRI A;  4EWC A;  4A93 I;  3NDJ A;  2M48 A;  4TNU A;  1QVG Y;  3PO2 I;  3HOX I;  5C3E I;  3CQZ I;  1USP B;  2ZAE B;  2VUM I;  1KC8 2;  1YIT Z;  1TWH I;  4MD9 A;  3G71 Z;  5FLM I;  5A2Q b;  3VB9 A;  3J7A 4;  2WAQ A;  2JA5 I;  2Q51 A;  3G6E 1;  3CC4 Z;  3S14 I;  2NAP A;  4BBR I;  1YJ9 1;  2QEX Z;  2R92 I;  1QYP A;  2QRD B;  4A3L I;  1S7M A;  4AYB A;  1JJ2 Y;  5C4X I;  2RBL A;  2VPZ A;  4BY7 I;  3GCF A;  1RNI A;  2JUB A;  4E31 A;  3VMH A;  3GTJ I;  2DE6 A;  1FDI A;  1S72 Z;  4E2W A;  1JJ2 Z;  1K73 2;  2JR6 A;  3MZL B;  3GTL I;  2V45 A;  3RZD I;  1TWG I;  3GTM S;  2HF1 A;  3NH5 A;  1Z03 A;  1ZB8 A;  1K9M 2;  1M1K 1;  3EED A;  3CCQ 1;  2P3Y A;  4NBB A;  3CCE Z;  2LEX A;  2NVX I;  2I3C A;  3CMA Z;  3S1Q I;  1KD1 1;  1NUI A;  4NBD A;  3QWU A;  4MD7 A;  4Y7N I;  2E2I I;  3CCS Z;  3J80 b;  2O53 A;  1RQF A;  3I55 1;  1ZB9 A;  3J80 f;  1N8R 1;  1YIT 1;  2V8K A;  1K8A 2;  1KC8 1;  5T64 A;  4A3F I;  3CC7 1;  2OZK A;  3U50 C;  3HOW I;  5C4J I;  1VQ6 1;  1W2B Y;  5IP7 I;  2Y0S A;  2HU9 A;  4E33 A;  1VQ6 Z;  4NB8 A;  1RO4 A;  2V8J A;  2V8I A;  2J6A A;  2JNY A;  1QVF Z;  1YI2 Z;  4NBH A;  1VQP 1;  1SIW A;  5IP9 I;  4RS4 A;  2OTJ Z;  2NVY I;  1I3Q I;  3NFZ A;  2M6N A;  2R93 I;  4NBC A;  4A3J I;  3S15 I;  1USP A;  3RZO I;  1Y1W I;  2PMZ A;  3VMG A;  3S2H I;  3CC7 Z;  4E2X A;  4DQY B;  1LQL A;  1N8R 2;  1K9M 1;  1M1K 2;  1K83 I;  1KRL A;  1R9T I;  1VQ7 1;  4QTT A;  1Q81 2;  3CPW Y;  5A2Q f;  5CM2 M;  1TWA I;  4NFR A;  3JAM f;  1DL6 A;  3CCS 1;  3GTG I;  4RVD A;  1YUA A;  4E2Y A;  1VQ4 1;  3NH8 A;  1QF8 A;  4HH4 A;  2AKL A;  2LFU A;  1S72 1;  3S2D I;  2QRE B;  2W03 A;  1RO0 A;  2NVT I;  3IX0 A;  2OOY B;  5FLX f;  1VQM 1;  2F4O A;  1VQK Z;  4A3E I;  2K5R A;  3NDI A;  3CCL Z;  1Y1V S;  1Q7Y 2;  1NP6 A;  1VQ7 Z;  1L1O C;  4HGZ A;  2QR1 B;  2JIR A;  3CCM Z;  3I55 Z;  4BXX I;  3H3V J;  1QXF A;  2Q4Z A;  3VMI A;  1YJN 1;  3OW2 Z; 
#chains in the Genus database with same CATH homology
 3I4N I;  2YU9 I;  4A3I I;  4DGL A;  2E2J I;  1TWC I;  1M90 1;  2GTI A;  1VQ8 Z;  2E9H A;  3S1R I;  2JS4 A;  2QRC B;  3GKQ A;  2OTL 1;  3CD6 Z;  3FQQ A;  2IZ3 A;  4A3K I;  2QEX 1;  2EGT A;  2GU2 A;  1VQO Z;  1SFO I;  3CC2 1;  3EER A;  3GTM I;  3LUS A;  1KQS Y;  4NB9 A;  5T67 A;  3KIH A;  2F4M A;  4A3D I;  3G4S Z;  3CCV Z;  1VQ4 Z;  1KD1 2;  4BY1 I;  4A3C I;  2WB1 A;  1VLA A;  1WII A;  2OTL Z;  3CD6 1;  2DE5 A;  1WW9 A;  1VQ9 Z;  3CCR Z;  1VQ5 Z;  1JWH C;  1YJN Z;  3FKI I;  5FLX b;  4MXU A;  5IT9 f;  3CCR 1;  3IF8 A;  1Q86 1;  2JA6 I;  4MD8 A;  2KI7 B;  4A3M I;  2PK7 A;  2RHB A;  4HGY A;  3G6E Z;  3G4S 1;  5D1O A;  1X3Z A;  1VQM Z;  3G71 1;  4E32 A;  4Y52 I;  3CCL 1;  3PO3 S;  3K7A I;  5LL6 f;  3OW2 Y;  2H85 A;  4XX2 A;  3CME 1;  2JA8 I;  2VF1 A;  1YHQ 1;  3HOU I;  4BBS I;  3IFU A;  3T4N B;  4RVF A;  3CCJ 1;  3Q87 A;  4QTU A;  2YAD A;  1W2B Z;  3TE5 B;  2RT9 A;  3CC2 Z;  2K3R A;  3I4M I;  1YUK A;  2E2H I;  1TWF I;  3I56 1;  2DE7 A;  3KIF A;  3CC4 1;  1K73 1;  2O4H A;  3I56 Z;  3CCV 1;  1I6H I;  1Q82 1;  3GTQ I;  3JAM b;  3M4O I;  2JMO A;  1Y1V I;  4DK1 A;  4NBG A;  3M3Y I;  3ESW A;  1KQS Z;  3S1M I;  1Q81 1;  3CXC Z;  1I50 I;  1VQL 1;  2P28 A;  4RVG A;  5D1O B;  1VQP Z;  3HKZ A;  1VQN Z;  1YJW 1;  3S17 I;  1TFI A;  2RPR A;  1VQN 1;  3F3P C;  1Q82 2;  4CL1 A;  3CPW Z;  2QA4 1;  5AN9 F;  1VQ5 1;  4RV9 A;  1ML8 A;  4NBE A;  3HOY I;  4NBA A;  1PFT A;  2GTH A;  1N2F A;  3J81 f;  1YHQ Z;  1VQL Z;  2OTJ 1;  3MZK B;  1WCM I;  2RIQ A;  5C44 I;  4S1T A;  5IT9 b;  1QVG Z;  3P5J B;  2R6M A;  2OOX B;  3TDH B;  1K8A 1;  3NH4 A;  3BG0 B;  1VQK 1;  1Z02 A;  2QLV B;  3D9X A;  1YJ9 Z;  2QA4 Z;  4MON A;  3F3F C;  2BJO A;  4X6A I;  3D6W A;  1NJI 1;  1NJI 2;  1YIJ Z;  5T6B A;  4E2Z A;  4A3B I;  3PO3 I;  1Q7Y 1;  2W04 A;  1RLY A;  3MON A;  2QKD A;  1YJW Z;  3S1N I;  3CCJ Z;  2LIY A;  1VQO 1;  3FQM A;  1M90 2;  1X0T A;  1X3W A;  3H0G I;  3I07 A;  2NVQ I;  1Z01 A;  2JA7 I;  4RVH A;  3CXC Y;  2R7Z I;  3CME Z;  2IZ4 A;  1YIJ 1;  4E30 A;  1Q86 2;  3CMA 1;  5D1P A;  3CCE 1;  3HOV I;  3S16 I;  3CCU Z;  3GTP I;  1RO2 A;  3CCU 1;  2G2K A;  3HOZ I;  4A3G I;  2KPI A;  4NBF A;  2VUG A;  1VQ8 1;  3GTO I;  3GTK I;  1P9N A;  3VTN A;  3J81 b;  4NOZ A;  2B63 I;  1QVF Y;  3CCQ Z;  4NH1 C;  3BG1 B;  1YI2 1;  3CCM 1;  4MH4 A;  1ZH1 A;  2PM9 A;  1VQ9 1;  4MRI A;  4EWC A;  4A93 I;  3NDJ A;  2M48 A;  4TNU A;  1QVG Y;  3PO2 I;  3HOX I;  5C3E I;  3CQZ I;  1USP B;  2ZAE B;  2VUM I;  1KC8 2;  1YIT Z;  1TWH I;  4MD9 A;  3G71 Z;  5FLM I;  5A2Q b;  3VB9 A;  3J7A 4;  2WAQ A;  2JA5 I;  2Q51 A;  3G6E 1;  3CC4 Z;  3S14 I;  4BBR I;  1YJ9 1;  2QEX Z;  2R92 I;  1QYP A;  2QRD B;  4A3L I;  1S7M A;  4AYB A;  1JJ2 Y;  5C4X I;  2RBL A;  4BY7 I;  3GCF A;  1RNI A;  2JUB A;  4E31 A;  3VMH A;  3GTJ I;  2DE6 A;  1S72 Z;  4E2W A;  1JJ2 Z;  1K73 2;  2JR6 A;  3MZL B;  3GTL I;  3RZD I;  1TWG I;  3GTM S;  2HF1 A;  3NH5 A;  1Z03 A;  1ZB8 A;  1K9M 2;  1M1K 1;  3EED A;  3CCQ 1;  2P3Y A;  4NBB A;  3CCE Z;  2NVX I;  2I3C A;  3CMA Z;  3S1Q I;  1KD1 1;  1NUI A;  4NBD A;  3QWU A;  4MD7 A;  4Y7N I;  2E2I I;  3CCS Z;  3J80 b;  2O53 A;  1RQF A;  3I55 1;  1ZB9 A;  3J80 f;  1N8R 1;  1YIT 1;  2V8K A;  1K8A 2;  1KC8 1;  5T64 A;  4A3F I;  3CC7 1;  2OZK A;  3U50 C;  3HOW I;  5C4J I;  1VQ6 1;  1W2B Y;  5IP7 I;  2Y0S A;  2HU9 A;  4E33 A;  1VQ6 Z;  4NB8 A;  1RO4 A;  2V8J A;  2V8I A;  2J6A A;  2JNY A;  1QVF Z;  1YI2 Z;  4NBH A;  1VQP 1;  5IP9 I;  4RS4 A;  2OTJ Z;  2NVY I;  1I3Q I;  3NFZ A;  2M6N A;  2R93 I;  4NBC A;  4A3J I;  3S15 I;  1USP A;  3RZO I;  1Y1W I;  2PMZ A;  3VMG A;  3S2H I;  3CC7 Z;  4E2X A;  4DQY B;  1LQL A;  1N8R 2;  1K9M 1;  1M1K 2;  1K83 I;  1KRL A;  1R9T I;  1VQ7 1;  4QTT A;  1Q81 2;  3CPW Y;  5A2Q f;  5CM2 M;  1TWA I;  4NFR A;  3JAM f;  1DL6 A;  3CCS 1;  3GTG I;  4RVD A;  1YUA A;  4E2Y A;  1VQ4 1;  3NH8 A;  1QF8 A;  4HH4 A;  2AKL A;  2LFU A;  1S72 1;  3S2D I;  2QRE B;  2W03 A;  1RO0 A;  2NVT I;  3IX0 A;  2OOY B;  5FLX f;  1VQM 1;  2F4O A;  1VQK Z;  4A3E I;  2K5R A;  3NDI A;  3CCL Z;  1Y1V S;  1Q7Y 2;  1NP6 A;  1VQ7 Z;  1L1O C;  4HGZ A;  2QR1 B;  3CCM Z;  3I55 Z;  4BXX I;  3H3V J;  2Q4Z A;  3VMI A;  1YJN 1;  3OW2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...