3G6EZ

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g6eZ00
1NJI2 3CC4Z 1KQSZ 3I551 3G6EZ 1Q811 1K8A1 2QA4Z 3CD61 1Q812 1K8A2 1YIJ1 1VQPZ 2QEXZ 3OW2Y 3CMAZ 1VQMZ 2OTLZ 1S72Z 3CCM1 1VQ71 1KD11 1KD12 1VQ6Z 1VQLZ 3CCUZ 1VQN1 1Q861 1YJ9Z 1M1K1 1Q862 1VQ8Z 1M1K2 3CC7Z 3CCQZ 1VQ4Z 3CCSZ 1K9M1 3CPWZ 2OTJ1 3G711 3CCJ1 1VQOZ 3CME1 3CXCZ 3CCL1 1YJN1 3CC2Z 1YHQZ 3G4S1 3G6E1 1K731 1K732 3I56Z 1QVFY 3CCRZ 1VQP1 1JJ2Y 1QVGZ 2QEX1 1W2BY 3CMA1 2OTL1 1YJW1 3I55Z 1YITZ 3CCE1 3CCU1 1VQL1 3CD6Z 1KQSY 1YI2Z 3CC71 1K9M2 3CCMZ 3CCQ1 1VQ7Z 1Q821 1VQ51 1Q7Y1 1Q822 1Q7Y2 1VQNZ 1VQK1 1N8R1 3CC41 1N8R2 3CCVZ 2QA41 1VQ9Z 3OW2Z 1YHQ1 1VQM1 2OTJZ 1S721 3CCR1 3G71Z 3CCJZ 3CPWY 1NJI1 1VQ61 3CMEZ 3CCLZ 1YJNZ 1YIJZ 1YJ91 1M901 3G4SZ 1VQ81 3CXCY 1YIT1 1M902 1VQ41 3CCS1 1YI21 1KC81 1KC82 1QVGY 1YJWZ 1VQO1 3CCEZ 3CC21 1QVFZ 1JJ2Z 3CCV1 1W2BZ 1VQ91 3I561 1VQ5Z 1VQKZ
chains in the Genus database with same CATH superfamily
5A2Qf 3Q87A 2QA4Z 4BXXI 1WJ2A 1Y8CA 2DE5A 3GTLI 3PO3S 3U50C 2LIYA 2E2HI 2OTLZ 1RNIA 1QYPA 2NVTI 1K83I 4NH1C 4NFRA 4E2XA 1VQ8Z 1N2FA 1TFIA 2E2JI 1NP6A 5FLXb 1NUIA 5CM2M 3CPWZ 2DE7A 2OTJ1 3CCJ1 3MONA 3GTJI 3ESWA 5C3EI 5IP9I 3NFZA 4A3KI 3NDIA 3I56Z 1QVFY 3D9XA 4NBHA 2K5RA 1VLAA 2OTL1 1YJW1 1YITZ 2R93I 3TE5B 1YI2Z 4S1TA 2JIQA 3FKII 3CCMZ 1VQ7Z 2JR6A 2IZ4A 3P5JB 4MRIA 3F3FC 2VPXA 2NVQI 2B63I 3VMHA 2JA8I 5C4JI 3OW2Z 3IF8A 2VPZA 2JA7I 4E32A 3GTMI 4QTTA 3CPWY 1VQ61 3HKZA 2M6NA 3CCLZ 4E2ZA 1P9NA 1YIT1 4A3GI 2RBLA 1FDOA 4E2WA 1VQ41 3CCS1 1YI21 3EERA 4X6AI 4RV9A 4MD8A 4A93I 4Y52I 1VQO1 3RZDI 3S1RI 5D1OA 2HF1A 4EWCA 3T4NB 1RO2A 1QF8A 1RO4A 3NH5A 1FDIA 1RQFA 2RIQA 4BY7I 2QKDA 2NVXI 3CC4Z 4NBDA 5A2Qb 3J81b 2JA6I 2YU9I 1Z03A 3OW2Y 1LQLA 4MXUA 1S72Z 3TDHB 2RPRA 2P3YA 4CL1A 1VQN1 3HOWI 3HOYI 1YJ9Z 2H85A 1M1K1 2HU9A 5D1OB 1M1K2 4MH4A 3LUSA 4A3LI 1JWHC 1K9M1 5T6BA 2OOYB 3G711 3J81f 1R9TI 3GKQA 1S7MA 1ZB9A 2KI7B 3VB9A 3CME1 4DQYB 1YJN1 3CC2Z 3S2HI 1YHQZ 3G4S1 2IZ3A 4QTUA 4BBSI 3GTGI 1L1OC 1WIIA 2JS4A 1RO0A 3BG1B 3S1QI 3I55Z 3CD6Z 3S1MI 3F3PC 1VQ51 1WCMI 1VQK1 1I50I 4HGYA 1N8R1 1N8R2 1Y1VS 2JNYA 2QA41 1VQ9Z 3KIFA 4A3CI 3I4MI 1YHQ1 2LEXA 2I3CA 1TWFI 3H0GI 3M4OI 2VPYA 2O53A 1TWHI 1NJI1 1YIJZ 2E2II 1M901 1VQ81 1M902 3VTNA 2RT9A 2RHBA 3GTOI 1ZH1A 4NB9A 2DE6A 1KC81 1KC82 2NAPA 2JMOA 2R6MA 2P28A 3CCEZ 4E33A 1Y1WI 2JIOA 1JJ2Z 2EGTA 1VQ91 3I561 4RS4A 1TWGI 2K3RA 4MD9A 1Q16A 4RVGA 1ZB8A 3G6EZ 1K8A1 5AN9F 2E7ZA 4A3MI 5LL6f 1YIJ1 1K8A2 3PO3I 2V45A 1WZNA 2JIMA 2V8KA 3NH8A 1VQMZ 2Y0SA 3CCM1 1VQ71 2AKLA 2W03A 1KD11 4TNUA 1KD12 2O4HA 1VQLZ 3CCUZ 2WB1A 2JUBA 1Q861 3S15I 1Q862 3VMGA 3CCQZ 2QR1B 2QRDB 3GCFA 4RVFA 3S16I 1X3ZA 2JIPA 4E30A 3CCL1 3NH4A 2Q51A 4A3BI 3G6E1 1K731 1USPA 2V8JA 1K732 3CCRZ 4XX2A 1JJ2Y 3RZOI 1QVGZ 1X3WA 3S1NI 2QREB 2V3VA 3HOVI 3IR7A 1ML8A 1VQL1 3CCU1 2LFUA 3MZKB 5D1PA 3CQZI 1K9M2 3CCQ1 1Q821 3S17I 3EEDA 1Q822 4E2YA 3GTKI 2W04A 4DGLA 3CC41 3HOUI 3K7AI 2PK7A 3JAMf 3CCVZ 4BBRI 3GTPI 4BY1I 1USPB 3VMIA 4NBEA 3D6WA 2PM9A 5IT9f 2F4OA 2OTJZ 1S721 3CCR1 2Q4ZA 3CCJZ 2V8IA 3MZLB 3J80f 3H3VJ 3GTMS 4HGZA 1YJ91 1Z01A 2JA5I 4DK1A 4AYBA 1YUAA 1X0TA 1QVGY 2JIRA 1YJWZ 4A3EI 1PFTA 3CC21 3CCV1 3IFUA 1W2BZ 2R92I 2OOXB 2ZAEB 4A3FI 2AYDA 4A3DI 3D2LA 4E31A 1NJI2 2VF1A 1YUKA 1KQSZ 3I551 4A3II 1Q811 3CD61 1Q812 3S14I 1VQPZ 2QEXZ 3CMAZ 3J7A4 3M3YI 1VQ6Z 2VUGA 3HOXI 3I07A 5FLXf 4NBBA 3CC7Z 3FQMA 3IX0A 3CCSZ 1VQ4Z 4MD7A 1RLYA 1WW9A 4NOZA 5IP7I 4A3JI 3GTQI 1VQOZ 4NBCA 3CXCZ 1Z02A 1SIWA 5C4XI 2PMZA 4NBFA 3I4NI 1VQP1 5T64A 2QEX1 1W2BY 3CMA1 2GTHA 4Y7NI 2QLVB 2YADA 1TWCI 2NVYI 3CCE1 4NB8A 1KQSY 5T67A 3CC71 1Q7Y1 1Q7Y2 5C44I 2IV2X 1VQNZ 1Y1VI 1I6HI 2WAQA 2GU2A 3NDJA 3JAMb 2J6AA 4HH4A 3S2DI 1VQM1 4NBAA 3G71Z 4NBGA 5IT9b 3KIHA 3CMEZ 4RVDA 1YJNZ 1DL6A 3J80b 1SFOI 3G4SZ 3CXCY 2OZKA 1QXFA 5FLMI 1AA6A 2E9HA 2F4MA 2KPIA 1TWAI 2BJOA 2R7ZI 2GTIA 3FQQA 4RVHA 3BG0B 4MONA 1QVFZ 3PO2I 2QRCB 3QWUA 2VUMI 1I3QI 1VQ5Z 2VPWA 2M48A 3HOZI 1KRLA 2G2KA 1VQKZ
chains in the Genus database with same CATH topology
5A2Qf 3Q87A 2QA4Z 4BXXI 2DE5A 3GTLI 3PO3S 3U50C 2LIYA 2E2HI 2OTLZ 1RNIA 1QYPA 2NVTI 1K83I 4NH1C 4NFRA 4E2XA 1VQ8Z 1N2FA 1TFIA 2E2JI 1NP6A 5FLXb 1NUIA 5CM2M 3CPWZ 2DE7A 2OTJ1 3CCJ1 3MONA 3GTJI 3ESWA 5C3EI 5IP9I 3NFZA 4A3KI 3NDIA 3I56Z 1QVFY 3D9XA 4NBHA 2K5RA 1VLAA 2OTL1 1YJW1 1YITZ 2R93I 3TE5B 1YI2Z 4S1TA 3FKII 3CCMZ 1VQ7Z 2JR6A 2IZ4A 3P5JB 4MRIA 3F3FC 2NVQI 2B63I 3VMHA 2JA8I 5C4JI 3OW2Z 3IF8A 2JA7I 4E32A 3GTMI 4QTTA 3CPWY 1VQ61 3HKZA 2M6NA 3CCLZ 4E2ZA 1P9NA 1YIT1 4A3GI 2RBLA 4E2WA 1VQ41 3CCS1 1YI21 3EERA 4X6AI 4RV9A 4MD8A 4A93I 4Y52I 1VQO1 3RZDI 3S1RI 5D1OA 2HF1A 4EWCA 3T4NB 1RO2A 1QF8A 1RO4A 3NH5A 1RQFA 2RIQA 4BY7I 2QKDA 2NVXI 3CC4Z 4NBDA 5A2Qb 3J81b 2JA6I 2YU9I 1Z03A 3OW2Y 1LQLA 4MXUA 1S72Z 3TDHB 2RPRA 2P3YA 4CL1A 1VQN1 3HOWI 3HOYI 1YJ9Z 2H85A 1M1K1 2HU9A 5D1OB 1M1K2 4MH4A 3LUSA 4A3LI 1JWHC 1K9M1 5T6BA 2OOYB 3G711 3J81f 1R9TI 3GKQA 1S7MA 1ZB9A 2KI7B 3VB9A 3CME1 4DQYB 1YJN1 3CC2Z 3S2HI 1YHQZ 3G4S1 2IZ3A 4QTUA 4BBSI 3GTGI 1L1OC 1WIIA 2JS4A 1RO0A 3BG1B 3S1QI 3I55Z 3CD6Z 3S1MI 3F3PC 1VQ51 1WCMI 1VQK1 1I50I 4HGYA 1N8R1 1N8R2 1Y1VS 2JNYA 2QA41 1VQ9Z 3KIFA 4A3CI 3I4MI 1YHQ1 2I3CA 1TWFI 3H0GI 3M4OI 2O53A 1TWHI 1NJI1 1YIJZ 2E2II 1M901 1VQ81 1M902 3VTNA 2RT9A 2RHBA 3GTOI 1ZH1A 4NB9A 2DE6A 1KC81 1KC82 2JMOA 2R6MA 2P28A 3CCEZ 4E33A 1Y1WI 1JJ2Z 2EGTA 1VQ91 3I561 4RS4A 1TWGI 2K3RA 4MD9A 4RVGA 1ZB8A 3G6EZ 1K8A1 5AN9F 4A3MI 5LL6f 1YIJ1 1K8A2 3PO3I 2V8KA 3NH8A 1VQMZ 2Y0SA 3CCM1 1VQ71 2AKLA 2W03A 1KD11 4TNUA 1KD12 2O4HA 1VQLZ 3CCUZ 2WB1A 2JUBA 1Q861 3S15I 1Q862 3VMGA 3CCQZ 2QR1B 2QRDB 3GCFA 4RVFA 3S16I 1X3ZA 3CCL1 4E30A 3NH4A 2Q51A 4A3BI 3G6E1 1K731 1USPA 2V8JA 1K732 3CCRZ 4XX2A 1JJ2Y 3RZOI 1QVGZ 1X3WA 3S1NI 2QREB 3HOVI 1ML8A 1VQL1 3CCU1 2LFUA 3MZKB 5D1PA 3CQZI 1K9M2 3CCQ1 1Q821 3S17I 3EEDA 1Q822 4E2YA 3GTKI 2W04A 4DGLA 3CC41 3HOUI 3K7AI 2PK7A 3JAMf 3CCVZ 4BBRI 3GTPI 4BY1I 1USPB 3VMIA 4NBEA 3D6WA 2PM9A 5IT9f 2F4OA 2OTJZ 1S721 3CCR1 2Q4ZA 3CCJZ 2V8IA 3MZLB 3J80f 3H3VJ 3GTMS 4HGZA 1YJ91 1Z01A 2JA5I 4DK1A 4AYBA 1YUAA 1X0TA 1QVGY 1YJWZ 4A3EI 1PFTA 3CC21 3CCV1 3IFUA 1W2BZ 2R92I 2OOXB 2ZAEB 4A3FI 4A3DI 4E31A 1NJI2 2VF1A 1YUKA 1KQSZ 3I551 4A3II 1Q811 3CD61 1Q812 3S14I 1VQPZ 2QEXZ 3CMAZ 3J7A4 3M3YI 1VQ6Z 2VUGA 3HOXI 3I07A 5FLXf 4NBBA 3CC7Z 3FQMA 3IX0A 3CCSZ 1VQ4Z 4MD7A 1RLYA 1WW9A 4NOZA 5IP7I 4A3JI 3GTQI 1VQOZ 4NBCA 3CXCZ 1Z02A 5C4XI 2PMZA 4NBFA 3I4NI 1VQP1 5T64A 2QEX1 1W2BY 3CMA1 2GTHA 4Y7NI 2QLVB 2YADA 1TWCI 2NVYI 3CCE1 4NB8A 1KQSY 5T67A 3CC71 1Q7Y1 1Q7Y2 5C44I 1VQNZ 1Y1VI 1I6HI 2WAQA 2GU2A 3NDJA 3JAMb 2J6AA 4HH4A 3S2DI 1VQM1 4NBAA 3G71Z 4NBGA 5IT9b 3KIHA 3CMEZ 4RVDA 1YJNZ 1DL6A 3J80b 1SFOI 3G4SZ 3CXCY 2OZKA 5FLMI 2E9HA 2F4MA 2KPIA 1TWAI 2BJOA 2R7ZI 2GTIA 3FQQA 4RVHA 3BG0B 4MONA 1QVFZ 3PO2I 2QRCB 3QWUA 2VUMI 1I3QI 1VQ5Z 2M48A 3HOZI 1KRLA 2G2KA 1VQKZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 2;  3CC4 Z;  1KQS Z;  3I55 1;  3G6E Z;  1Q81 1;  1K8A 1;  2QA4 Z;  3CD6 1;  1Q81 2;  1K8A 2;  1YIJ 1;  1VQP Z;  2QEX Z;  3OW2 Y;  3CMA Z;  1VQM Z;  2OTL Z;  1S72 Z;  3CCM 1;  1VQ7 1;  1KD1 1;  1KD1 2;  1VQ6 Z;  1VQL Z;  3CCU Z;  1VQN 1;  1Q86 1;  1YJ9 Z;  1M1K 1;  1Q86 2;  1VQ8 Z;  1M1K 2;  3CC7 Z;  3CCQ Z;  1VQ4 Z;  3CCS Z;  1K9M 1;  3CPW Z;  2OTJ 1;  3G71 1;  3CCJ 1;  1VQO Z;  3CME 1;  3CXC Z;  3CCL 1;  1YJN 1;  3CC2 Z;  1YHQ Z;  3G4S 1;  3G6E 1;  1K73 1;  1K73 2;  3I56 Z;  1QVF Y;  3CCR Z;  1VQP 1;  1JJ2 Y;  1QVG Z;  2QEX 1;  1W2B Y;  3CMA 1;  2OTL 1;  1YJW 1;  3I55 Z;  1YIT Z;  3CCE 1;  3CCU 1;  1VQL 1;  3CD6 Z;  1KQS Y;  1YI2 Z;  3CC7 1;  1K9M 2;  3CCM Z;  3CCQ 1;  1VQ7 Z;  1Q82 1;  1VQ5 1;  1Q7Y 1;  1Q82 2;  1Q7Y 2;  1VQN Z;  1VQK 1;  1N8R 1;  3CC4 1;  1N8R 2;  3CCV Z;  2QA4 1;  1VQ9 Z;  3OW2 Z;  1YHQ 1;  1VQM 1;  2OTJ Z;  1S72 1;  3CCR 1;  3G71 Z;  3CCJ Z;  3CPW Y;  1NJI 1;  1VQ6 1;  3CME Z;  3CCL Z;  1YJN Z;  1YIJ Z;  1YJ9 1;  1M90 1;  3G4S Z;  1VQ8 1;  3CXC Y;  1YIT 1;  1M90 2;  1VQ4 1;  3CCS 1;  1YI2 1;  1KC8 1;  1KC8 2;  1QVG Y;  1YJW Z;  1VQO 1;  3CCE Z;  3CC2 1;  1QVF Z;  1JJ2 Z;  3CCV 1;  1W2B Z;  1VQ9 1;  3I56 1;  1VQ5 Z;  1VQK Z; 
#chains in the Genus database with same CATH topology
 5A2Q f;  3Q87 A;  2QA4 Z;  4BXX I;  1WJ2 A;  1Y8C A;  2DE5 A;  3GTL I;  3PO3 S;  3U50 C;  2LIY A;  2E2H I;  2OTL Z;  1RNI A;  1QYP A;  2NVT I;  1K83 I;  4NH1 C;  4NFR A;  4E2X A;  1VQ8 Z;  1N2F A;  1TFI A;  2E2J I;  1NP6 A;  5FLX b;  1NUI A;  5CM2 M;  3CPW Z;  2DE7 A;  2OTJ 1;  3CCJ 1;  3MON A;  3GTJ I;  3ESW A;  5C3E I;  5IP9 I;  3NFZ A;  4A3K I;  3NDI A;  3I56 Z;  1QVF Y;  3D9X A;  4NBH A;  2K5R A;  1VLA A;  2OTL 1;  1YJW 1;  1YIT Z;  2R93 I;  3TE5 B;  1YI2 Z;  4S1T A;  2JIQ A;  3FKI I;  3CCM Z;  1VQ7 Z;  2JR6 A;  2IZ4 A;  3P5J B;  4MRI A;  3F3F C;  2VPX A;  2NVQ I;  2B63 I;  3VMH A;  2JA8 I;  5C4J I;  3OW2 Z;  3IF8 A;  2VPZ A;  2JA7 I;  4E32 A;  3GTM I;  4QTT A;  3CPW Y;  1VQ6 1;  3HKZ A;  2M6N A;  3CCL Z;  4E2Z A;  1P9N A;  1YIT 1;  4A3G I;  2RBL A;  1FDO A;  4E2W A;  1VQ4 1;  3CCS 1;  1YI2 1;  3EER A;  4X6A I;  4RV9 A;  4MD8 A;  4A93 I;  4Y52 I;  1VQO 1;  3RZD I;  3S1R I;  5D1O A;  2HF1 A;  4EWC A;  3T4N B;  1RO2 A;  1QF8 A;  1RO4 A;  3NH5 A;  1FDI A;  1RQF A;  2RIQ A;  4BY7 I;  2QKD A;  2NVX I;  3CC4 Z;  4NBD A;  5A2Q b;  3J81 b;  2JA6 I;  2YU9 I;  1Z03 A;  3OW2 Y;  1LQL A;  4MXU A;  1S72 Z;  3TDH B;  2RPR A;  2P3Y A;  4CL1 A;  1VQN 1;  3HOW I;  3HOY I;  1YJ9 Z;  2H85 A;  1M1K 1;  2HU9 A;  5D1O B;  1M1K 2;  4MH4 A;  3LUS A;  4A3L I;  1JWH C;  1K9M 1;  5T6B A;  2OOY B;  3G71 1;  3J81 f;  1R9T I;  3GKQ A;  1S7M A;  1ZB9 A;  2KI7 B;  3VB9 A;  3CME 1;  4DQY B;  1YJN 1;  3CC2 Z;  3S2H I;  1YHQ Z;  3G4S 1;  2IZ3 A;  4QTU A;  4BBS I;  3GTG I;  1L1O C;  1WII A;  2JS4 A;  1RO0 A;  3BG1 B;  3S1Q I;  3I55 Z;  3CD6 Z;  3S1M I;  3F3P C;  1VQ5 1;  1WCM I;  1VQK 1;  1I50 I;  4HGY A;  1N8R 1;  1N8R 2;  1Y1V S;  2JNY A;  2QA4 1;  1VQ9 Z;  3KIF A;  4A3C I;  3I4M I;  1YHQ 1;  2LEX A;  2I3C A;  1TWF I;  3H0G I;  3M4O I;  2VPY A;  2O53 A;  1TWH I;  1NJI 1;  1YIJ Z;  2E2I I;  1M90 1;  1VQ8 1;  1M90 2;  3VTN A;  2RT9 A;  2RHB A;  3GTO I;  1ZH1 A;  4NB9 A;  2DE6 A;  1KC8 1;  1KC8 2;  2NAP A;  2JMO A;  2R6M A;  2P28 A;  3CCE Z;  4E33 A;  1Y1W I;  2JIO A;  1JJ2 Z;  2EGT A;  1VQ9 1;  3I56 1;  4RS4 A;  1TWG I;  2K3R A;  4MD9 A;  1Q16 A;  4RVG A;  1ZB8 A;  3G6E Z;  1K8A 1;  5AN9 F;  2E7Z A;  4A3M I;  5LL6 f;  1YIJ 1;  1K8A 2;  3PO3 I;  2V45 A;  1WZN A;  2JIM A;  2V8K A;  3NH8 A;  1VQM Z;  2Y0S A;  3CCM 1;  1VQ7 1;  2AKL A;  2W03 A;  1KD1 1;  4TNU A;  1KD1 2;  2O4H A;  1VQL Z;  3CCU Z;  2WB1 A;  2JUB A;  1Q86 1;  3S15 I;  1Q86 2;  3VMG A;  3CCQ Z;  2QR1 B;  2QRD B;  3GCF A;  4RVF A;  3S16 I;  1X3Z A;  2JIP A;  4E30 A;  3CCL 1;  3NH4 A;  2Q51 A;  4A3B I;  3G6E 1;  1K73 1;  1USP A;  2V8J A;  1K73 2;  3CCR Z;  4XX2 A;  1JJ2 Y;  3RZO I;  1QVG Z;  1X3W A;  3S1N I;  2QRE B;  2V3V A;  3HOV I;  3IR7 A;  1ML8 A;  1VQL 1;  3CCU 1;  2LFU A;  3MZK B;  5D1P A;  3CQZ I;  1K9M 2;  3CCQ 1;  1Q82 1;  3S17 I;  3EED A;  1Q82 2;  4E2Y A;  3GTK I;  2W04 A;  4DGL A;  3CC4 1;  3HOU I;  3K7A I;  2PK7 A;  3JAM f;  3CCV Z;  4BBR I;  3GTP I;  4BY1 I;  1USP B;  3VMI A;  4NBE A;  3D6W A;  2PM9 A;  5IT9 f;  2F4O A;  2OTJ Z;  1S72 1;  3CCR 1;  2Q4Z A;  3CCJ Z;  2V8I A;  3MZL B;  3J80 f;  3H3V J;  3GTM S;  4HGZ A;  1YJ9 1;  1Z01 A;  2JA5 I;  4DK1 A;  4AYB A;  1YUA A;  1X0T A;  1QVG Y;  2JIR A;  1YJW Z;  4A3E I;  1PFT A;  3CC2 1;  3CCV 1;  3IFU A;  1W2B Z;  2R92 I;  2OOX B;  2ZAE B;  4A3F I;  2AYD A;  4A3D I;  3D2L A;  4E31 A;  1NJI 2;  2VF1 A;  1YUK A;  1KQS Z;  3I55 1;  4A3I I;  1Q81 1;  3CD6 1;  1Q81 2;  3S14 I;  1VQP Z;  2QEX Z;  3CMA Z;  3J7A 4;  3M3Y I;  1VQ6 Z;  2VUG A;  3HOX I;  3I07 A;  5FLX f;  4NBB A;  3CC7 Z;  3FQM A;  3IX0 A;  3CCS Z;  1VQ4 Z;  4MD7 A;  1RLY A;  1WW9 A;  4NOZ A;  5IP7 I;  4A3J I;  3GTQ I;  1VQO Z;  4NBC A;  3CXC Z;  1Z02 A;  1SIW A;  5C4X I;  2PMZ A;  4NBF A;  3I4N I;  1VQP 1;  5T64 A;  2QEX 1;  1W2B Y;  3CMA 1;  2GTH A;  4Y7N I;  2QLV B;  2YAD A;  1TWC I;  2NVY I;  3CCE 1;  4NB8 A;  1KQS Y;  5T67 A;  3CC7 1;  1Q7Y 1;  1Q7Y 2;  5C44 I;  2IV2 X;  1VQN Z;  1Y1V I;  1I6H I;  2WAQ A;  2GU2 A;  3NDJ A;  3JAM b;  2J6A A;  4HH4 A;  3S2D I;  1VQM 1;  4NBA A;  3G71 Z;  4NBG A;  5IT9 b;  3KIH A;  3CME Z;  4RVD A;  1YJN Z;  1DL6 A;  3J80 b;  1SFO I;  3G4S Z;  3CXC Y;  2OZK A;  1QXF A;  5FLM I;  1AA6 A;  2E9H A;  2F4M A;  2KPI A;  1TWA I;  2BJO A;  2R7Z I;  2GTI A;  3FQQ A;  4RVH A;  3BG0 B;  4MON A;  1QVF Z;  3PO2 I;  2QRC B;  3QWU A;  2VUM I;  1I3Q I;  1VQ5 Z;  2VPW A;  2M48 A;  3HOZ I;  1KRL A;  2G2K A;  1VQK Z; 
#chains in the Genus database with same CATH homology
 5A2Q f;  3Q87 A;  2QA4 Z;  4BXX I;  2DE5 A;  3GTL I;  3PO3 S;  3U50 C;  2LIY A;  2E2H I;  2OTL Z;  1RNI A;  1QYP A;  2NVT I;  1K83 I;  4NH1 C;  4NFR A;  4E2X A;  1VQ8 Z;  1N2F A;  1TFI A;  2E2J I;  1NP6 A;  5FLX b;  1NUI A;  5CM2 M;  3CPW Z;  2DE7 A;  2OTJ 1;  3CCJ 1;  3MON A;  3GTJ I;  3ESW A;  5C3E I;  5IP9 I;  3NFZ A;  4A3K I;  3NDI A;  3I56 Z;  1QVF Y;  3D9X A;  4NBH A;  2K5R A;  1VLA A;  2OTL 1;  1YJW 1;  1YIT Z;  2R93 I;  3TE5 B;  1YI2 Z;  4S1T A;  3FKI I;  3CCM Z;  1VQ7 Z;  2JR6 A;  2IZ4 A;  3P5J B;  4MRI A;  3F3F C;  2NVQ I;  2B63 I;  3VMH A;  2JA8 I;  5C4J I;  3OW2 Z;  3IF8 A;  2JA7 I;  4E32 A;  3GTM I;  4QTT A;  3CPW Y;  1VQ6 1;  3HKZ A;  2M6N A;  3CCL Z;  4E2Z A;  1P9N A;  1YIT 1;  4A3G I;  2RBL A;  4E2W A;  1VQ4 1;  3CCS 1;  1YI2 1;  3EER A;  4X6A I;  4RV9 A;  4MD8 A;  4A93 I;  4Y52 I;  1VQO 1;  3RZD I;  3S1R I;  5D1O A;  2HF1 A;  4EWC A;  3T4N B;  1RO2 A;  1QF8 A;  1RO4 A;  3NH5 A;  1RQF A;  2RIQ A;  4BY7 I;  2QKD A;  2NVX I;  3CC4 Z;  4NBD A;  5A2Q b;  3J81 b;  2JA6 I;  2YU9 I;  1Z03 A;  3OW2 Y;  1LQL A;  4MXU A;  1S72 Z;  3TDH B;  2RPR A;  2P3Y A;  4CL1 A;  1VQN 1;  3HOW I;  3HOY I;  1YJ9 Z;  2H85 A;  1M1K 1;  2HU9 A;  5D1O B;  1M1K 2;  4MH4 A;  3LUS A;  4A3L I;  1JWH C;  1K9M 1;  5T6B A;  2OOY B;  3G71 1;  3J81 f;  1R9T I;  3GKQ A;  1S7M A;  1ZB9 A;  2KI7 B;  3VB9 A;  3CME 1;  4DQY B;  1YJN 1;  3CC2 Z;  3S2H I;  1YHQ Z;  3G4S 1;  2IZ3 A;  4QTU A;  4BBS I;  3GTG I;  1L1O C;  1WII A;  2JS4 A;  1RO0 A;  3BG1 B;  3S1Q I;  3I55 Z;  3CD6 Z;  3S1M I;  3F3P C;  1VQ5 1;  1WCM I;  1VQK 1;  1I50 I;  4HGY A;  1N8R 1;  1N8R 2;  1Y1V S;  2JNY A;  2QA4 1;  1VQ9 Z;  3KIF A;  4A3C I;  3I4M I;  1YHQ 1;  2I3C A;  1TWF I;  3H0G I;  3M4O I;  2O53 A;  1TWH I;  1NJI 1;  1YIJ Z;  2E2I I;  1M90 1;  1VQ8 1;  1M90 2;  3VTN A;  2RT9 A;  2RHB A;  3GTO I;  1ZH1 A;  4NB9 A;  2DE6 A;  1KC8 1;  1KC8 2;  2JMO A;  2R6M A;  2P28 A;  3CCE Z;  4E33 A;  1Y1W I;  1JJ2 Z;  2EGT A;  1VQ9 1;  3I56 1;  4RS4 A;  1TWG I;  2K3R A;  4MD9 A;  4RVG A;  1ZB8 A;  3G6E Z;  1K8A 1;  5AN9 F;  4A3M I;  5LL6 f;  1YIJ 1;  1K8A 2;  3PO3 I;  2V8K A;  3NH8 A;  1VQM Z;  2Y0S A;  3CCM 1;  1VQ7 1;  2AKL A;  2W03 A;  1KD1 1;  4TNU A;  1KD1 2;  2O4H A;  1VQL Z;  3CCU Z;  2WB1 A;  2JUB A;  1Q86 1;  3S15 I;  1Q86 2;  3VMG A;  3CCQ Z;  2QR1 B;  2QRD B;  3GCF A;  4RVF A;  3S16 I;  1X3Z A;  3CCL 1;  4E30 A;  3NH4 A;  2Q51 A;  4A3B I;  3G6E 1;  1K73 1;  1USP A;  2V8J A;  1K73 2;  3CCR Z;  4XX2 A;  1JJ2 Y;  3RZO I;  1QVG Z;  1X3W A;  3S1N I;  2QRE B;  3HOV I;  1ML8 A;  1VQL 1;  3CCU 1;  2LFU A;  3MZK B;  5D1P A;  3CQZ I;  1K9M 2;  3CCQ 1;  1Q82 1;  3S17 I;  3EED A;  1Q82 2;  4E2Y A;  3GTK I;  2W04 A;  4DGL A;  3CC4 1;  3HOU I;  3K7A I;  2PK7 A;  3JAM f;  3CCV Z;  4BBR I;  3GTP I;  4BY1 I;  1USP B;  3VMI A;  4NBE A;  3D6W A;  2PM9 A;  5IT9 f;  2F4O A;  2OTJ Z;  1S72 1;  3CCR 1;  2Q4Z A;  3CCJ Z;  2V8I A;  3MZL B;  3J80 f;  3H3V J;  3GTM S;  4HGZ A;  1YJ9 1;  1Z01 A;  2JA5 I;  4DK1 A;  4AYB A;  1YUA A;  1X0T A;  1QVG Y;  1YJW Z;  4A3E I;  1PFT A;  3CC2 1;  3CCV 1;  3IFU A;  1W2B Z;  2R92 I;  2OOX B;  2ZAE B;  4A3F I;  4A3D I;  4E31 A;  1NJI 2;  2VF1 A;  1YUK A;  1KQS Z;  3I55 1;  4A3I I;  1Q81 1;  3CD6 1;  1Q81 2;  3S14 I;  1VQP Z;  2QEX Z;  3CMA Z;  3J7A 4;  3M3Y I;  1VQ6 Z;  2VUG A;  3HOX I;  3I07 A;  5FLX f;  4NBB A;  3CC7 Z;  3FQM A;  3IX0 A;  3CCS Z;  1VQ4 Z;  4MD7 A;  1RLY A;  1WW9 A;  4NOZ A;  5IP7 I;  4A3J I;  3GTQ I;  1VQO Z;  4NBC A;  3CXC Z;  1Z02 A;  5C4X I;  2PMZ A;  4NBF A;  3I4N I;  1VQP 1;  5T64 A;  2QEX 1;  1W2B Y;  3CMA 1;  2GTH A;  4Y7N I;  2QLV B;  2YAD A;  1TWC I;  2NVY I;  3CCE 1;  4NB8 A;  1KQS Y;  5T67 A;  3CC7 1;  1Q7Y 1;  1Q7Y 2;  5C44 I;  1VQN Z;  1Y1V I;  1I6H I;  2WAQ A;  2GU2 A;  3NDJ A;  3JAM b;  2J6A A;  4HH4 A;  3S2D I;  1VQM 1;  4NBA A;  3G71 Z;  4NBG A;  5IT9 b;  3KIH A;  3CME Z;  4RVD A;  1YJN Z;  1DL6 A;  3J80 b;  1SFO I;  3G4S Z;  3CXC Y;  2OZK A;  5FLM I;  2E9H A;  2F4M A;  2KPI A;  1TWA I;  2BJO A;  2R7Z I;  2GTI A;  3FQQ A;  4RVH A;  3BG0 B;  4MON A;  1QVF Z;  3PO2 I;  2QRC B;  3QWU A;  2VUM I;  1I3Q I;  1VQ5 Z;  2M48 A;  3HOZ I;  1KRL A;  2G2K A;  1VQK Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...