3G6EZ

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g6eZ00
1KD11 3CC41 1YJWZ 1VQMZ 1YHQ1 1VQM1 3CCL1 3CPWZ 3CD6Z 3CCS1 1VQ71 3CCQZ 3CD61 1S72Z 1KC81 3CCQ1 3CME1 3CCU1 1JJ2Z 1K731 1QVFZ 3CCRZ 1Q821 1M1K2 1VQ8Z 1Q812 1VQ81 1YIJZ 3I56Z 2OTLZ 3I561 2QEXZ 1Q7Y2 3CXCZ 1YI21 1KC82 3CCMZ 3OW2Z 3CCM1 3CCEZ 3G6E1 3CCE1 1QVGY 3G71Z 3CC4Z 3G711 1YJNZ 1YJN1 1YHQZ 3CCLZ 3CCSZ 1VQ7Z 1NJI1 1KD12 3CMEZ 3CCUZ 1K9M1 3CC71 1VQN1 1YJ91 1Q861 1VQ5Z 1K8A1 3CMA1 1M901 1VQ51 3CC2Z 1W2BZ 1N8R1 3CC21 3CPWY 1NJI2 1YI2Z 1VQKZ 1VQK1 1JJ2Y 3G6EZ 1K732 1QVFY 1Q822 1N8R2 3CXCY 1KQSZ 3OW2Y 2OTJZ 2OTJ1 1YIT1 1VQ41 3I55Z 3I551 3CC7Z 1VQNZ 1YJ9Z 1VQOZ 3CMAZ 1VQO1 1VQLZ 3CCJZ 1VQL1 3CCJ1 1K9M2 1VQ9Z 1VQ91 1Q862 1K8A2 1M902 1M1K1 1YJW1 1W2BY 1Q811 1Q7Y1 2QA4Z 2QA41 1YITZ 1S721 1VQ4Z 3G4SZ 1QVGZ 3G4S1 3CCR1 1VQPZ 1VQP1 1YIJ1 2OTL1 3CCVZ 1KQSY 2QEX1 3CCV1 1VQ6Z 1VQ61
chains in the Genus database with same CATH superfamily
1ZH1A 3EERA 2LFUA 3NH5A 1RQFA 2O4HA 4E33A 3MONA 3S1MI 4S1TA 1KC81 3GTMS 1JJ2Z 5FLMI 1QVFZ 1TFIA 2HF1A 4A3KI 1Q812 3I561 2QEXZ 1DL6A 2V8KA 4RV9A 1KC82 2QRDB 3CCM1 2I3CA 4DGLA 3JAMb 2VUGA 3CC4Z 1WCMI 1X0TA 1USPA 1YJN1 2IZ4A 2QLVB 2QR1B 2JUBA 4A3JI 1YUAA 1X3WA 1VQ7Z 1NJI1 3NH4A 3D6WA 3CMA1 3CPWY 1NJI2 1YI2Z 5T64A 4RS4A 2IV2X 1K732 1QYPA 1Q822 1TWAI 4E2ZA 3KIHA 4MH4A 4DQYB 1L1OC 4BY1I 2OTJZ 4HGYA 4MD9A 2JIRA 2KPIA 4NBFA 4NBEA 3CC7Z 3NFZA 1YJ9Z 1VQO1 2P3YA 4NOZA 4A3EI 3GCFA 1VQLZ 3CCJZ 2JIQA 2M6NA 4Y52I 3FQQA 3M3YI 4MD7A 1QF8A 2E7ZA 3I4NI 2JA5I 4NBCA 4CL1A 2QA4Z 1ML8A 1YITZ 1VQ4Z 4BY7I 4RVHA 3G4S1 3I4MI 3CCVZ 1KQSY 2QEX1 2JA8I 1VQ6Z 1RO4A 4E2XA 2RPRA 1I50I 3CC41 1Y1WI 1WJ2A 3HOYI 2NVYI 4NB8A 4RVFA 1VQM1 1VQ71 3VMIA 3CD61 3CCQ1 2K3RA 3NDJA 3PO3S 3CCRZ 1M1K2 1WZNA 1VQ8Z 3U50C 1FDIA 1PFTA 2IZ3A 1Q7Y2 2EGTA 1YI21 3S1QI 5C44I 2W04A 3CCE1 1QVGY 2W03A 4Y7NI 4NBBA 4QTTA 3CQZI 3RZDI 2K5RA 4HGZA 3G71Z 2Y0SA 4A3CI 2JIOA 1YUKA 2AKLA 3FQMA 3P5JB 2ZAEB 3IFUA 1I3QI 3GKQA 3VB9A 1K9M1 2KI7B 2QRCB 3CC71 1YJ91 3NH8A 1Q861 1VQ5Z 1K8A1 1AA6A 3CC2Z 1W2BZ 1N8R1 3GTJI 1KRLA 4NBAA 1VQKZ 3TDHB 4MRIA 3J80f 3S1RI 2RHBA 1N8R2 2VPYA 3CXCY 2F4MA 5C3EI 2DE5A 3OW2Y 1YIT1 1Y8CA 2R92I 1VQ41 1JWHC 1WIIA 3F3FC 3TE5B 3I55Z 5IT9b 4NFRA 4QTUA 2HU9A 1P9NA 2RIQA 3GTKI 3FKII 1TWFI 2JA7I 1VQ91 2B63I 3GTQI 2NVXI 3ESWA 1Y1VI 4E32A 2LIYA 4RVDA 2M48A 2YADA 3CCR1 1VQP1 2RT9A 2NVQI 3IF8A 5CM2M 2F4OA 2H85A 1KD11 3T4NB 2E2II 1YJWZ 4BBRI 4BBSI 2PK7A 3CPWZ 2BJOA 2LEXA 2E2HI 1YIJZ 3I56Z 2OTLZ 5IT9f 4NB9A 2E2JI 3CCMZ 3S2DI 2JA6I 1SFOI 2DE6A 3J80b 3H3VJ 4HH4A 1YJNZ 4MD8A 3PO2I 4MXUA 1YHQZ 3QWUA 2GTHA 3CCLZ 3VMGA 3CCSZ 5LL6f 1SIWA 4NBDA 3CMEZ 3CCUZ 3S15I 3HOXI 1RNIA 1M901 5AN9F 3S2HI 3D9XA 4NBGA 2VPZA 1JJ2Y 3G6EZ 3GTPI 4A3MI 1QVFY 2VPXA 4X6AI 2YU9I 3HOVI 5A2Qb 2R93I 4DK1A 3LUSA 3GTGI 2JMOA 3HOZI 1KQSZ 3J7A4 2OTJ1 1TWGI 3S1NI 2G2KA 1WW9A 2VF1A 3MZKB 3EEDA 3GTOI 1VQNZ 3GTLI 1VQOZ 1NUIA 3HKZA 1NP6A 2NAPA 2GU2A 1VQL1 4E30A 3CCJ1 3S16I 1K83I 4E2WA 1K9M2 1QXFA 3GTMI 2J6AA 1VLAA 3F3PC 1Q862 1K8A2 1YJW1 3RZOI 1Q811 5D1PA 2OOXB 5FLXf 4A3FI 2QA41 4TNUA 3G4SZ 1QVGZ 2DE7A 1FDOA 1ZB9A 4A3LI 3VMHA 1TWCI 3D2LA 1YIJ1 2OTL1 1Z02A 3CCV1 3K7AI 1X3ZA 1VQ61 2JR6A 3BG1B 3KIFA 2JIMA 3J81f 3HOWI 3MZLB 2QREB 3I07A 5A2Qf 5D1OB 1VQMZ 3IR7A 1YHQ1 3CCL1 3CD6Z 3CCS1 3CCQZ 1S72Z 3CME1 3CCU1 2Q4ZA 1K731 2PMZA 2WB1A 1Q821 1VQ81 2WAQA 1Y1VS 1TWHI 2RBLA 3CXCZ 5T67A 3OW2Z 3CCEZ 2R6MA 1S7MA 3G6E1 4RVGA 3G711 2AYDA 4A3DI 2OZKA 2R7ZI 1Z03A 1KD12 2V8JA 2V3VA 1RO2A 5IP7I 5C4JI 3VTNA 1VQN1 1N2FA 1Z01A 2V8IA 1VQ51 3H0GI 1RO0A 2V45A 2JNYA 3CC21 3M4OI 3S14I 1VQK1 2Q51A 2GTIA 2PM9A 1RLYA 4NH1C 5D1OA 4E31A 1I6HI 4A3II 3JAMf 4A3GI 5FLXb 3NDIA 2OOYB 1LQLA 2VUMI 2VPWA 2E9HA 3I551 2JS4A 4XX2A 3CMAZ 2QKDA 3S17I 4AYBA 4A93I 2O53A 2P28A 4EWCA 1Q16A 4BXXI 3J81b 1VQ9Z 3PO3I 1M902 4A3BI 1M1K1 3Q87A 5T6BA 1W2BY 4E2YA 5IP9I 1Q7Y1 1USPB 1S721 1ZB8A 4NBHA 2JIPA 3HOUI 3IX0A 1VQPZ 5C4XI 1R9TI 3BG0B 4MONA 2NVTI
chains in the Genus database with same CATH topology
1ZH1A 3EERA 2LFUA 3NH5A 1RQFA 2O4HA 4E33A 3MONA 3S1MI 4S1TA 1KC81 3GTMS 1JJ2Z 5FLMI 1QVFZ 1TFIA 2HF1A 4A3KI 1Q812 3I561 2QEXZ 1DL6A 2V8KA 4RV9A 1KC82 2QRDB 3CCM1 2I3CA 4DGLA 3JAMb 2VUGA 3CC4Z 1WCMI 1X0TA 1USPA 1YJN1 2IZ4A 2QLVB 2QR1B 2JUBA 4A3JI 1YUAA 1X3WA 1VQ7Z 1NJI1 3NH4A 3D6WA 3CMA1 3CPWY 1NJI2 1YI2Z 5T64A 4RS4A 1K732 1QYPA 1Q822 1TWAI 4E2ZA 3KIHA 4MH4A 4DQYB 1L1OC 4BY1I 2OTJZ 4HGYA 4MD9A 2KPIA 4NBFA 4NBEA 3CC7Z 3NFZA 1YJ9Z 1VQO1 2P3YA 4NOZA 4A3EI 3GCFA 1VQLZ 3CCJZ 4Y52I 2M6NA 3FQQA 3M3YI 4MD7A 1QF8A 3I4NI 2JA5I 4NBCA 4CL1A 2QA4Z 1ML8A 1YITZ 1VQ4Z 4BY7I 4RVHA 3G4S1 3I4MI 3CCVZ 1KQSY 2QEX1 2JA8I 1VQ6Z 1RO4A 4E2XA 2RPRA 1I50I 3CC41 1Y1WI 3HOYI 2NVYI 4NB8A 4RVFA 1VQM1 1VQ71 3VMIA 3CD61 3CCQ1 2K3RA 3NDJA 3PO3S 3CCRZ 1M1K2 1VQ8Z 3U50C 1PFTA 2IZ3A 1Q7Y2 2EGTA 1YI21 3S1QI 5C44I 2W04A 3CCE1 1QVGY 2W03A 4Y7NI 4NBBA 4QTTA 3CQZI 3RZDI 2K5RA 4HGZA 3G71Z 2Y0SA 4A3CI 1YUKA 2AKLA 3FQMA 3P5JB 2ZAEB 3IFUA 1I3QI 3GKQA 3VB9A 1K9M1 2KI7B 2QRCB 3CC71 1YJ91 3NH8A 1Q861 1VQ5Z 1K8A1 3CC2Z 1W2BZ 1N8R1 3GTJI 1KRLA 4NBAA 1VQKZ 3TDHB 4MRIA 3J80f 3S1RI 2RHBA 1N8R2 3CXCY 2F4MA 5C3EI 2DE5A 3OW2Y 1YIT1 2R92I 1VQ41 1JWHC 1WIIA 3F3FC 3TE5B 3I55Z 5IT9b 4NFRA 4QTUA 2HU9A 1P9NA 2RIQA 3GTKI 3FKII 1TWFI 2JA7I 1VQ91 2B63I 3GTQI 2NVXI 3ESWA 1Y1VI 4E32A 2LIYA 4RVDA 2M48A 2YADA 3CCR1 1VQP1 2RT9A 2NVQI 3IF8A 5CM2M 2F4OA 2H85A 1KD11 3T4NB 2E2II 1YJWZ 4BBRI 4BBSI 2PK7A 3CPWZ 2BJOA 2E2HI 1YIJZ 3I56Z 2OTLZ 5IT9f 4NB9A 2E2JI 3CCMZ 3S2DI 2JA6I 1SFOI 2DE6A 3J80b 3H3VJ 4HH4A 1YJNZ 4MD8A 3PO2I 4MXUA 1YHQZ 3QWUA 2GTHA 3CCLZ 3VMGA 3CCSZ 5LL6f 4NBDA 3CMEZ 3CCUZ 3S15I 3HOXI 1RNIA 1M901 5AN9F 3S2HI 3D9XA 4NBGA 1JJ2Y 3G6EZ 3GTPI 4A3MI 1QVFY 4X6AI 2YU9I 3HOVI 5A2Qb 2R93I 4DK1A 3LUSA 3GTGI 2JMOA 3HOZI 1KQSZ 3J7A4 2OTJ1 1TWGI 3S1NI 2G2KA 1WW9A 2VF1A 3MZKB 3EEDA 3GTOI 1VQNZ 3GTLI 1VQOZ 1NUIA 3HKZA 1NP6A 2GU2A 1VQL1 4E30A 3CCJ1 3S16I 1K83I 4E2WA 1K9M2 3GTMI 2J6AA 1VLAA 3F3PC 1Q862 1K8A2 1YJW1 3RZOI 1Q811 5D1PA 2OOXB 5FLXf 4A3FI 2QA41 4TNUA 3G4SZ 1QVGZ 2DE7A 1ZB9A 4A3LI 3VMHA 1TWCI 1YIJ1 2OTL1 1Z02A 3CCV1 3K7AI 1X3ZA 1VQ61 2JR6A 3BG1B 3KIFA 3J81f 3HOWI 3MZLB 2QREB 3I07A 5A2Qf 5D1OB 1VQMZ 1YHQ1 3CCL1 3CD6Z 3CCS1 3CCQZ 1S72Z 3CME1 3CCU1 2Q4ZA 1K731 2PMZA 2WB1A 1Q821 1VQ81 2WAQA 1Y1VS 1TWHI 2RBLA 3CXCZ 5T67A 3OW2Z 3CCEZ 2R6MA 1S7MA 3G6E1 4RVGA 3G711 4A3DI 2OZKA 2R7ZI 1Z03A 1KD12 2V8JA 1RO2A 5IP7I 5C4JI 3VTNA 1VQN1 1N2FA 1Z01A 2V8IA 1VQ51 3H0GI 1RO0A 3CC21 2JNYA 3M4OI 3S14I 1VQK1 2Q51A 2GTIA 2PM9A 1RLYA 4NH1C 5D1OA 4E31A 1I6HI 4A3II 3JAMf 4A3GI 5FLXb 3NDIA 2OOYB 1LQLA 2VUMI 2E9HA 3I551 2JS4A 4XX2A 3CMAZ 2QKDA 3S17I 4AYBA 4A93I 2O53A 2P28A 4EWCA 4BXXI 3J81b 1VQ9Z 3PO3I 1M902 4A3BI 1M1K1 3Q87A 5T6BA 1W2BY 4E2YA 5IP9I 1Q7Y1 1USPB 1S721 1ZB8A 4NBHA 3HOUI 3IX0A 1VQPZ 5C4XI 1R9TI 3BG0B 4MONA 2NVTI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 1;  3CC4 1;  1YJW Z;  1VQM Z;  1YHQ 1;  1VQM 1;  3CCL 1;  3CPW Z;  3CD6 Z;  3CCS 1;  1VQ7 1;  3CCQ Z;  3CD6 1;  1S72 Z;  1KC8 1;  3CCQ 1;  3CME 1;  3CCU 1;  1JJ2 Z;  1K73 1;  1QVF Z;  3CCR Z;  1Q82 1;  1M1K 2;  1VQ8 Z;  1Q81 2;  1VQ8 1;  1YIJ Z;  3I56 Z;  2OTL Z;  3I56 1;  2QEX Z;  1Q7Y 2;  3CXC Z;  1YI2 1;  1KC8 2;  3CCM Z;  3OW2 Z;  3CCM 1;  3CCE Z;  3G6E 1;  3CCE 1;  1QVG Y;  3G71 Z;  3CC4 Z;  3G71 1;  1YJN Z;  1YJN 1;  1YHQ Z;  3CCL Z;  3CCS Z;  1VQ7 Z;  1NJI 1;  1KD1 2;  3CME Z;  3CCU Z;  1K9M 1;  3CC7 1;  1VQN 1;  1YJ9 1;  1Q86 1;  1VQ5 Z;  1K8A 1;  3CMA 1;  1M90 1;  1VQ5 1;  3CC2 Z;  1W2B Z;  1N8R 1;  3CC2 1;  3CPW Y;  1NJI 2;  1YI2 Z;  1VQK Z;  1VQK 1;  1JJ2 Y;  3G6E Z;  1K73 2;  1QVF Y;  1Q82 2;  1N8R 2;  3CXC Y;  1KQS Z;  3OW2 Y;  2OTJ Z;  2OTJ 1;  1YIT 1;  1VQ4 1;  3I55 Z;  3I55 1;  3CC7 Z;  1VQN Z;  1YJ9 Z;  1VQO Z;  3CMA Z;  1VQO 1;  1VQL Z;  3CCJ Z;  1VQL 1;  3CCJ 1;  1K9M 2;  1VQ9 Z;  1VQ9 1;  1Q86 2;  1K8A 2;  1M90 2;  1M1K 1;  1YJW 1;  1W2B Y;  1Q81 1;  1Q7Y 1;  2QA4 Z;  2QA4 1;  1YIT Z;  1S72 1;  1VQ4 Z;  3G4S Z;  1QVG Z;  3G4S 1;  3CCR 1;  1VQP Z;  1VQP 1;  1YIJ 1;  2OTL 1;  3CCV Z;  1KQS Y;  2QEX 1;  3CCV 1;  1VQ6 Z;  1VQ6 1; 
#chains in the Genus database with same CATH topology
 1ZH1 A;  3EER A;  2LFU A;  3NH5 A;  1RQF A;  2O4H A;  4E33 A;  3MON A;  3S1M I;  4S1T A;  1KC8 1;  3GTM S;  1JJ2 Z;  5FLM I;  1QVF Z;  1TFI A;  2HF1 A;  4A3K I;  1Q81 2;  3I56 1;  2QEX Z;  1DL6 A;  2V8K A;  4RV9 A;  1KC8 2;  2QRD B;  3CCM 1;  2I3C A;  4DGL A;  3JAM b;  2VUG A;  3CC4 Z;  1WCM I;  1X0T A;  1USP A;  1YJN 1;  2IZ4 A;  2QLV B;  2QR1 B;  2JUB A;  4A3J I;  1YUA A;  1X3W A;  1VQ7 Z;  1NJI 1;  3NH4 A;  3D6W A;  3CMA 1;  3CPW Y;  1NJI 2;  1YI2 Z;  5T64 A;  4RS4 A;  2IV2 X;  1K73 2;  1QYP A;  1Q82 2;  1TWA I;  4E2Z A;  3KIH A;  4MH4 A;  4DQY B;  1L1O C;  4BY1 I;  2OTJ Z;  4HGY A;  4MD9 A;  2JIR A;  2KPI A;  4NBF A;  4NBE A;  3CC7 Z;  3NFZ A;  1YJ9 Z;  1VQO 1;  2P3Y A;  4NOZ A;  4A3E I;  3GCF A;  1VQL Z;  3CCJ Z;  2JIQ A;  2M6N A;  4Y52 I;  3FQQ A;  3M3Y I;  4MD7 A;  1QF8 A;  2E7Z A;  3I4N I;  2JA5 I;  4NBC A;  4CL1 A;  2QA4 Z;  1ML8 A;  1YIT Z;  1VQ4 Z;  4BY7 I;  4RVH A;  3G4S 1;  3I4M I;  3CCV Z;  1KQS Y;  2QEX 1;  2JA8 I;  1VQ6 Z;  1RO4 A;  4E2X A;  2RPR A;  1I50 I;  3CC4 1;  1Y1W I;  1WJ2 A;  3HOY I;  2NVY I;  4NB8 A;  4RVF A;  1VQM 1;  1VQ7 1;  3VMI A;  3CD6 1;  3CCQ 1;  2K3R A;  3NDJ A;  3PO3 S;  3CCR Z;  1M1K 2;  1WZN A;  1VQ8 Z;  3U50 C;  1FDI A;  1PFT A;  2IZ3 A;  1Q7Y 2;  2EGT A;  1YI2 1;  3S1Q I;  5C44 I;  2W04 A;  3CCE 1;  1QVG Y;  2W03 A;  4Y7N I;  4NBB A;  4QTT A;  3CQZ I;  3RZD I;  2K5R A;  4HGZ A;  3G71 Z;  2Y0S A;  4A3C I;  2JIO A;  1YUK A;  2AKL A;  3FQM A;  3P5J B;  2ZAE B;  3IFU A;  1I3Q I;  3GKQ A;  3VB9 A;  1K9M 1;  2KI7 B;  2QRC B;  3CC7 1;  1YJ9 1;  3NH8 A;  1Q86 1;  1VQ5 Z;  1K8A 1;  1AA6 A;  3CC2 Z;  1W2B Z;  1N8R 1;  3GTJ I;  1KRL A;  4NBA A;  1VQK Z;  3TDH B;  4MRI A;  3J80 f;  3S1R I;  2RHB A;  1N8R 2;  2VPY A;  3CXC Y;  2F4M A;  5C3E I;  2DE5 A;  3OW2 Y;  1YIT 1;  1Y8C A;  2R92 I;  1VQ4 1;  1JWH C;  1WII A;  3F3F C;  3TE5 B;  3I55 Z;  5IT9 b;  4NFR A;  4QTU A;  2HU9 A;  1P9N A;  2RIQ A;  3GTK I;  3FKI I;  1TWF I;  2JA7 I;  1VQ9 1;  2B63 I;  3GTQ I;  2NVX I;  3ESW A;  1Y1V I;  4E32 A;  2LIY A;  4RVD A;  2M48 A;  2YAD A;  3CCR 1;  1VQP 1;  2RT9 A;  2NVQ I;  3IF8 A;  5CM2 M;  2F4O A;  2H85 A;  1KD1 1;  3T4N B;  2E2I I;  1YJW Z;  4BBR I;  4BBS I;  2PK7 A;  3CPW Z;  2BJO A;  2LEX A;  2E2H I;  1YIJ Z;  3I56 Z;  2OTL Z;  5IT9 f;  4NB9 A;  2E2J I;  3CCM Z;  3S2D I;  2JA6 I;  1SFO I;  2DE6 A;  3J80 b;  3H3V J;  4HH4 A;  1YJN Z;  4MD8 A;  3PO2 I;  4MXU A;  1YHQ Z;  3QWU A;  2GTH A;  3CCL Z;  3VMG A;  3CCS Z;  5LL6 f;  1SIW A;  4NBD A;  3CME Z;  3CCU Z;  3S15 I;  3HOX I;  1RNI A;  1M90 1;  5AN9 F;  3S2H I;  3D9X A;  4NBG A;  2VPZ A;  1JJ2 Y;  3G6E Z;  3GTP I;  4A3M I;  1QVF Y;  2VPX A;  4X6A I;  2YU9 I;  3HOV I;  5A2Q b;  2R93 I;  4DK1 A;  3LUS A;  3GTG I;  2JMO A;  3HOZ I;  1KQS Z;  3J7A 4;  2OTJ 1;  1TWG I;  3S1N I;  2G2K A;  1WW9 A;  2VF1 A;  3MZK B;  3EED A;  3GTO I;  1VQN Z;  3GTL I;  1VQO Z;  1NUI A;  3HKZ A;  1NP6 A;  2NAP A;  2GU2 A;  1VQL 1;  4E30 A;  3CCJ 1;  3S16 I;  1K83 I;  4E2W A;  1K9M 2;  1QXF A;  3GTM I;  2J6A A;  1VLA A;  3F3P C;  1Q86 2;  1K8A 2;  1YJW 1;  3RZO I;  1Q81 1;  5D1P A;  2OOX B;  5FLX f;  4A3F I;  2QA4 1;  4TNU A;  3G4S Z;  1QVG Z;  2DE7 A;  1FDO A;  1ZB9 A;  4A3L I;  3VMH A;  1TWC I;  3D2L A;  1YIJ 1;  2OTL 1;  1Z02 A;  3CCV 1;  3K7A I;  1X3Z A;  1VQ6 1;  2JR6 A;  3BG1 B;  3KIF A;  2JIM A;  3J81 f;  3HOW I;  3MZL B;  2QRE B;  3I07 A;  5A2Q f;  5D1O B;  1VQM Z;  3IR7 A;  1YHQ 1;  3CCL 1;  3CD6 Z;  3CCS 1;  3CCQ Z;  1S72 Z;  3CME 1;  3CCU 1;  2Q4Z A;  1K73 1;  2PMZ A;  2WB1 A;  1Q82 1;  1VQ8 1;  2WAQ A;  1Y1V S;  1TWH I;  2RBL A;  3CXC Z;  5T67 A;  3OW2 Z;  3CCE Z;  2R6M A;  1S7M A;  3G6E 1;  4RVG A;  3G71 1;  2AYD A;  4A3D I;  2OZK A;  2R7Z I;  1Z03 A;  1KD1 2;  2V8J A;  2V3V A;  1RO2 A;  5IP7 I;  5C4J I;  3VTN A;  1VQN 1;  1N2F A;  1Z01 A;  2V8I A;  1VQ5 1;  3H0G I;  1RO0 A;  2V45 A;  2JNY A;  3CC2 1;  3M4O I;  3S14 I;  1VQK 1;  2Q51 A;  2GTI A;  2PM9 A;  1RLY A;  4NH1 C;  5D1O A;  4E31 A;  1I6H I;  4A3I I;  3JAM f;  4A3G I;  5FLX b;  3NDI A;  2OOY B;  1LQL A;  2VUM I;  2VPW A;  2E9H A;  3I55 1;  2JS4 A;  4XX2 A;  3CMA Z;  2QKD A;  3S17 I;  4AYB A;  4A93 I;  2O53 A;  2P28 A;  4EWC A;  1Q16 A;  4BXX I;  3J81 b;  1VQ9 Z;  3PO3 I;  1M90 2;  4A3B I;  1M1K 1;  3Q87 A;  5T6B A;  1W2B Y;  4E2Y A;  5IP9 I;  1Q7Y 1;  1USP B;  1S72 1;  1ZB8 A;  4NBH A;  2JIP A;  3HOU I;  3IX0 A;  1VQP Z;  5C4X I;  1R9T I;  3BG0 B;  4MON A;  2NVT I; 
#chains in the Genus database with same CATH homology
 1ZH1 A;  3EER A;  2LFU A;  3NH5 A;  1RQF A;  2O4H A;  4E33 A;  3MON A;  3S1M I;  4S1T A;  1KC8 1;  3GTM S;  1JJ2 Z;  5FLM I;  1QVF Z;  1TFI A;  2HF1 A;  4A3K I;  1Q81 2;  3I56 1;  2QEX Z;  1DL6 A;  2V8K A;  4RV9 A;  1KC8 2;  2QRD B;  3CCM 1;  2I3C A;  4DGL A;  3JAM b;  2VUG A;  3CC4 Z;  1WCM I;  1X0T A;  1USP A;  1YJN 1;  2IZ4 A;  2QLV B;  2QR1 B;  2JUB A;  4A3J I;  1YUA A;  1X3W A;  1VQ7 Z;  1NJI 1;  3NH4 A;  3D6W A;  3CMA 1;  3CPW Y;  1NJI 2;  1YI2 Z;  5T64 A;  4RS4 A;  1K73 2;  1QYP A;  1Q82 2;  1TWA I;  4E2Z A;  3KIH A;  4MH4 A;  4DQY B;  1L1O C;  4BY1 I;  2OTJ Z;  4HGY A;  4MD9 A;  2KPI A;  4NBF A;  4NBE A;  3CC7 Z;  3NFZ A;  1YJ9 Z;  1VQO 1;  2P3Y A;  4NOZ A;  4A3E I;  3GCF A;  1VQL Z;  3CCJ Z;  4Y52 I;  2M6N A;  3FQQ A;  3M3Y I;  4MD7 A;  1QF8 A;  3I4N I;  2JA5 I;  4NBC A;  4CL1 A;  2QA4 Z;  1ML8 A;  1YIT Z;  1VQ4 Z;  4BY7 I;  4RVH A;  3G4S 1;  3I4M I;  3CCV Z;  1KQS Y;  2QEX 1;  2JA8 I;  1VQ6 Z;  1RO4 A;  4E2X A;  2RPR A;  1I50 I;  3CC4 1;  1Y1W I;  3HOY I;  2NVY I;  4NB8 A;  4RVF A;  1VQM 1;  1VQ7 1;  3VMI A;  3CD6 1;  3CCQ 1;  2K3R A;  3NDJ A;  3PO3 S;  3CCR Z;  1M1K 2;  1VQ8 Z;  3U50 C;  1PFT A;  2IZ3 A;  1Q7Y 2;  2EGT A;  1YI2 1;  3S1Q I;  5C44 I;  2W04 A;  3CCE 1;  1QVG Y;  2W03 A;  4Y7N I;  4NBB A;  4QTT A;  3CQZ I;  3RZD I;  2K5R A;  4HGZ A;  3G71 Z;  2Y0S A;  4A3C I;  1YUK A;  2AKL A;  3FQM A;  3P5J B;  2ZAE B;  3IFU A;  1I3Q I;  3GKQ A;  3VB9 A;  1K9M 1;  2KI7 B;  2QRC B;  3CC7 1;  1YJ9 1;  3NH8 A;  1Q86 1;  1VQ5 Z;  1K8A 1;  3CC2 Z;  1W2B Z;  1N8R 1;  3GTJ I;  1KRL A;  4NBA A;  1VQK Z;  3TDH B;  4MRI A;  3J80 f;  3S1R I;  2RHB A;  1N8R 2;  3CXC Y;  2F4M A;  5C3E I;  2DE5 A;  3OW2 Y;  1YIT 1;  2R92 I;  1VQ4 1;  1JWH C;  1WII A;  3F3F C;  3TE5 B;  3I55 Z;  5IT9 b;  4NFR A;  4QTU A;  2HU9 A;  1P9N A;  2RIQ A;  3GTK I;  3FKI I;  1TWF I;  2JA7 I;  1VQ9 1;  2B63 I;  3GTQ I;  2NVX I;  3ESW A;  1Y1V I;  4E32 A;  2LIY A;  4RVD A;  2M48 A;  2YAD A;  3CCR 1;  1VQP 1;  2RT9 A;  2NVQ I;  3IF8 A;  5CM2 M;  2F4O A;  2H85 A;  1KD1 1;  3T4N B;  2E2I I;  1YJW Z;  4BBR I;  4BBS I;  2PK7 A;  3CPW Z;  2BJO A;  2E2H I;  1YIJ Z;  3I56 Z;  2OTL Z;  5IT9 f;  4NB9 A;  2E2J I;  3CCM Z;  3S2D I;  2JA6 I;  1SFO I;  2DE6 A;  3J80 b;  3H3V J;  4HH4 A;  1YJN Z;  4MD8 A;  3PO2 I;  4MXU A;  1YHQ Z;  3QWU A;  2GTH A;  3CCL Z;  3VMG A;  3CCS Z;  5LL6 f;  4NBD A;  3CME Z;  3CCU Z;  3S15 I;  3HOX I;  1RNI A;  1M90 1;  5AN9 F;  3S2H I;  3D9X A;  4NBG A;  1JJ2 Y;  3G6E Z;  3GTP I;  4A3M I;  1QVF Y;  4X6A I;  2YU9 I;  3HOV I;  5A2Q b;  2R93 I;  4DK1 A;  3LUS A;  3GTG I;  2JMO A;  3HOZ I;  1KQS Z;  3J7A 4;  2OTJ 1;  1TWG I;  3S1N I;  2G2K A;  1WW9 A;  2VF1 A;  3MZK B;  3EED A;  3GTO I;  1VQN Z;  3GTL I;  1VQO Z;  1NUI A;  3HKZ A;  1NP6 A;  2GU2 A;  1VQL 1;  4E30 A;  3CCJ 1;  3S16 I;  1K83 I;  4E2W A;  1K9M 2;  3GTM I;  2J6A A;  1VLA A;  3F3P C;  1Q86 2;  1K8A 2;  1YJW 1;  3RZO I;  1Q81 1;  5D1P A;  2OOX B;  5FLX f;  4A3F I;  2QA4 1;  4TNU A;  3G4S Z;  1QVG Z;  2DE7 A;  1ZB9 A;  4A3L I;  3VMH A;  1TWC I;  1YIJ 1;  2OTL 1;  1Z02 A;  3CCV 1;  3K7A I;  1X3Z A;  1VQ6 1;  2JR6 A;  3BG1 B;  3KIF A;  3J81 f;  3HOW I;  3MZL B;  2QRE B;  3I07 A;  5A2Q f;  5D1O B;  1VQM Z;  1YHQ 1;  3CCL 1;  3CD6 Z;  3CCS 1;  3CCQ Z;  1S72 Z;  3CME 1;  3CCU 1;  2Q4Z A;  1K73 1;  2PMZ A;  2WB1 A;  1Q82 1;  1VQ8 1;  2WAQ A;  1Y1V S;  1TWH I;  2RBL A;  3CXC Z;  5T67 A;  3OW2 Z;  3CCE Z;  2R6M A;  1S7M A;  3G6E 1;  4RVG A;  3G71 1;  4A3D I;  2OZK A;  2R7Z I;  1Z03 A;  1KD1 2;  2V8J A;  1RO2 A;  5IP7 I;  5C4J I;  3VTN A;  1VQN 1;  1N2F A;  1Z01 A;  2V8I A;  1VQ5 1;  3H0G I;  1RO0 A;  3CC2 1;  2JNY A;  3M4O I;  3S14 I;  1VQK 1;  2Q51 A;  2GTI A;  2PM9 A;  1RLY A;  4NH1 C;  5D1O A;  4E31 A;  1I6H I;  4A3I I;  3JAM f;  4A3G I;  5FLX b;  3NDI A;  2OOY B;  1LQL A;  2VUM I;  2E9H A;  3I55 1;  2JS4 A;  4XX2 A;  3CMA Z;  2QKD A;  3S17 I;  4AYB A;  4A93 I;  2O53 A;  2P28 A;  4EWC A;  4BXX I;  3J81 b;  1VQ9 Z;  3PO3 I;  1M90 2;  4A3B I;  1M1K 1;  3Q87 A;  5T6B A;  1W2B Y;  4E2Y A;  5IP9 I;  1Q7Y 1;  1USP B;  1S72 1;  1ZB8 A;  4NBH A;  3HOU I;  3IX0 A;  1VQP Z;  5C4X I;  1R9T I;  3BG0 B;  4MON A;  2NVT I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...