3G6EZ

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g6eZ00
1M1K2 1N8R1 1K8A1 3CCVZ 2QA4Z 1KQSZ 1VQO1 1M901 3CCEZ 1VQNZ 1Q812 3CMA1 1VQ81 3CCS1 1VQ6Z 3CPWY 2QEXZ 1VQKZ 1YJN1 1K731 1QVFZ 1Q861 1Q7Y1 1VQ7Z 1VQ4Z 3CXCY 1VQP1 1K9M1 1VQOZ 1M1K1 1W2BZ 3CCM1 3CMAZ 1VQ8Z 1QVGY 1NJI2 1YHQ1 1YJNZ 1KC82 1YIT1 1Q822 3G6E1 1VQPZ 3CPWZ 3CCMZ 1YHQZ 3I551 1S721 1JJ2Y 1VQM1 1YITZ 3OW2Z 2OTJ1 3G6EZ 1KQSY 3CD61 2OTL1 3CCJ1 3CCQ1 1N8R2 1Q811 1K8A2 3G4S1 1QVFY 3CC71 3CCU1 3CCRZ 3I55Z 1S72Z 1VQMZ 1KD12 1K732 1Q862 2OTJZ 3G711 3CC21 1YJW1 1VQ51 3CD6Z 1W2BY 2OTLZ 3CCJZ 3CCR1 3CXCZ 3CCQZ 1YI21 3CC41 1K9M2 1NJI1 3G4SZ 3CC7Z 3CCUZ 1KC81 1YIJ1 1Q821 3I561 3CCL1 1QVGZ 1YJ91 1VQ91 3CME1 3G71Z 3CC2Z 1YJWZ 1VQL1 1VQ5Z 1KD11 1M902 1YI2Z 3CCV1 2QA41 3CC4Z 3CCE1 1VQN1 3OW2Y 1Q7Y2 1VQ61 1YIJZ 3I56Z 2QEX1 1VQK1 3CCLZ 1YJ9Z 1VQ9Z 1VQ41 1VQ71 3CMEZ 1VQLZ 3CCSZ 1JJ2Z
chains in the Genus database with same CATH superfamily
2NVTI 2VPXA 1N8R1 3CCVZ 2NVQI 1X0TA 1Q812 3CMA1 2NVYI 3CCS1 1VQ6Z 1QVFZ 3PO3S 4HGZA 1NUIA 1VQ7Z 1Q7Y1 4DK1A 2IV2X 3KIHA 2VUMI 2JIPA 4A3LI 4NBDA 1VQOZ 1W2BZ 2E2II 4BBRI 3EERA 3MZKB 3S1QI 3P5JB 3KIFA 3GTQI 1USPA 4MONA 3QWUA 4NBGA 3G6E1 2K5RA 2DE6A 3CPWZ 4EWCA 5FLXb 4Y52I 3D9XA 3J80b 2OZKA 3I551 3VMIA 3FKII 1VQM1 2OTJ1 3IF8A 3JAMf 1ZH1A 3S1NI 2PM9A 4A3DI 1NP6A 5T6BA 1WJ2A 1KD12 3S2HI 1X3ZA 1SFOI 5C44I 3G711 4A3EI 2OTLZ 5D1OA 3CCQZ 4NBCA 2PK7A 4E32A 3CC7Z 4RS4A 5LL6f 3CCUZ 4NOZA 1Q821 4A3FI 3S14I 1USPB 1YJWZ 1VQ5Z 1KD11 2Y0SA 3CQZI 4BXXI 3J81f 2QRCB 2E2JI 1WZNA 4E2YA 1TFIA 5A2Qf 4A3MI 1RO2A 2VPZA 3I56Z 2QEX1 3FQQA 2OOYB 4NBFA 1VQ9Z 2QKDA 2B63I 1VQLZ 2NVXI 1JJ2Z 1PFTA 2P28A 5T64A 1M1K2 1I6HI 5IT9b 1ML8A 3BG1B 1KQSZ 4A3BI 2JIQA 1VQ81 2DE5A 1N2FA 2V8KA 1YJN1 1K731 2QR1B 4A3II 2M6NA 4E2XA 1Q861 1R9TI 3M3YI 4A93I 5C4JI 2R7ZI 3CXCY 5IP7I 5D1OB 1KRLA 2H85A 5FLMI 2VF1A 2JUBA 1M1K1 3CMAZ 1QVGY 1NJI2 1YHQ1 4MD7A 1KC82 2WB1A 2K3RA 3GTJI 1FDOA 4BY1I 3S1MI 2WAQA 3S17I 2RIQA 3IR7A 2GU2A 1QF8A 3D2LA 3GTGI 3S1RI 2W04A 1S721 4E2WA 2JIMA 3OW2Z 2F4MA 2VPWA 3TE5B 3NH8A 3G6EZ 1L1OC 3Q87A 3CD61 3CCJ1 1I50I 1Q811 3J7A4 1K8A2 1QVFY 3I55Z 1VQMZ 1Y8CA 3M4OI 2OTJZ 4MXUA 4XX2A 1W2BY 2YU9I 2GTIA 2V45A 3IX0A 3CC41 1K9M2 2JNYA 2JIOA 1RLYA 5FLXf 4NBBA 2JS4A 3GCFA 3H0GI 3CME1 3G71Z 1X3WA 2RPRA 1M902 2QA41 4CL1A 3CCE1 1VQN1 4X6AI 1DL6A 1VQK1 2QLVB 3GTMI 4BY7I 1VQ41 2JR6A 3VB9A 3NDIA 3MZLB 4RVFA 2E7ZA 4NB8A 3HOWI 1RO4A 4A3CI 5CM2M 3HKZA 1M901 1TWCI 3GTOI 4MD9A 2QEXZ 1Y1VI 2YADA 3GTMS 1WCMI 5C4XI 2IZ3A 2Q51A 1WIIA 1ZB8A 1VQP1 4A3JI 4Y7NI 2P3YA 3GTKI 2DE7A 3F3FC 3CCM1 1VQ8Z 3S2DI 1YUKA 3U50C 2E9HA 4NBAA 1Y1VS 1YJNZ 3I07A 3BG0B 2R6MA 1YIT1 3RZOI 1AA6A 4E31A 3NFZA 2PMZA 2V3VA 1TWGI 3PO2I 4E2ZA 1YHQZ 5IP9I 1JJ2Y 2LEXA 1QYPA 3H3VJ 2RT9A 1KQSY 2JIRA 1ZB9A 1N8R2 4NBEA 3G4S1 3GTPI 3CCRZ 1S72Z 2JMOA 2JA6I 1SIWA 1LQLA 3CC21 3NH4A 5AN9F 3CD6Z 4AYBA 4NH1C 3CCJZ 3CCR1 2LFUA 1YI21 4DQYB 1NJI1 3HOUI 2GTHA 1KC81 1YIJ1 1VLAA 4E33A 3CCL1 2V8JA 4MD8A 1YJ91 4RVHA 2G2KA 2JA7I 5D1PA 2LIYA 2O4HA 1Z03A 3IFUA 3VTNA 1RNIA 3CCV1 2R92I 3CC4Z 3S16I 1JWHC 3OW2Y 5T67A 1VQ61 2KPIA 1TWAI 1VQ71 3CMEZ 2VPYA 3NDJA 1WW9A 4E30A 2F4OA 3J80f 4NB9A 2NAPA 1K8A1 3K7AI 1S7MA 1QXFA 2QA4Z 1VQO1 1RO0A 3CCEZ 1VQNZ 3GKQA 2VUGA 1Y1WI 4A3GI 3CPWY 1YUAA 2J6AA 1VQKZ 2E2HI 3GTLI 3S15I 1VQ4Z 2O53A 3JAMb 3TDHB 1K9M1 4RVGA 2Q4ZA 2RBLA 4S1TA 3VMGA 2RHBA 5C3EI 1Q822 3FQMA 4A3KI 4HGYA 4NBHA 1VQPZ 3RZDI 2HF1A 2ZAEB 2KI7B 3CCMZ 1RQFA 2IZ4A 4DGLA 3D6WA 1Q16A 2BJOA 4TNUA 1YITZ 1Z02A 2OTL1 4RVDA 3CCQ1 3J81b 2AYDA 2M48A 3CC71 5A2Qb 3CCU1 3MONA 3HOVI 1K83I 4MH4A 3HOXI 3NH5A 4RV9A 5IT9f 3HOZI 1K732 2QREB 1Q862 1YJW1 3HOYI 1VQ51 2JA8I 3VMHA 2R93I 2EGTA 3CXCZ 2HU9A 1FDIA 4NFRA 3F3PC 1I3QI 3ESWA 3G4SZ 4HH4A 4MRIA 4QTUA 3I561 2OOXB 1TWHI 1Z01A 1QVGZ 1VQ91 3I4NI 3I4MI 3CC2Z 4QTTA 1VQL1 3EEDA 2W03A 1P9NA 2QRDB 2JA5I 4BBSI 2AKLA 1YI2Z 2I3CA 1Q7Y2 1YIJZ 3LUSA 3CCLZ 1YJ9Z 3PO3I 2V8IA 1TWFI 3T4NB 3CCSZ
chains in the Genus database with same CATH topology
2NVTI 1N8R1 3CCVZ 2NVQI 1X0TA 1Q812 3CMA1 2NVYI 3CCS1 1VQ6Z 1QVFZ 3PO3S 4HGZA 1NUIA 1VQ7Z 1Q7Y1 4DK1A 3KIHA 2VUMI 4A3LI 4NBDA 1VQOZ 1W2BZ 2E2II 4BBRI 3EERA 3MZKB 3S1QI 3P5JB 3KIFA 3GTQI 1USPA 4MONA 3QWUA 4NBGA 3G6E1 2K5RA 2DE6A 3CPWZ 4EWCA 5FLXb 4Y52I 3D9XA 3J80b 2OZKA 3I551 3VMIA 3FKII 1VQM1 2OTJ1 3IF8A 3JAMf 1ZH1A 3S1NI 2PM9A 4A3DI 1NP6A 5T6BA 1KD12 3S2HI 1X3ZA 1SFOI 5C44I 3G711 4A3EI 2OTLZ 5D1OA 3CCQZ 4NBCA 2PK7A 4E32A 3CC7Z 4RS4A 5LL6f 3CCUZ 4NOZA 1Q821 4A3FI 3S14I 1USPB 1YJWZ 1VQ5Z 1KD11 2Y0SA 3CQZI 4BXXI 3J81f 2QRCB 2E2JI 4E2YA 1TFIA 5A2Qf 4A3MI 1RO2A 3I56Z 2QEX1 3FQQA 2OOYB 4NBFA 1VQ9Z 2QKDA 2B63I 1VQLZ 2NVXI 1JJ2Z 1PFTA 2P28A 5T64A 1M1K2 1I6HI 5IT9b 1ML8A 3BG1B 1KQSZ 4A3BI 1VQ81 2DE5A 1N2FA 2V8KA 1YJN1 1K731 2QR1B 4A3II 2M6NA 4E2XA 1Q861 1R9TI 3M3YI 4A93I 5C4JI 2R7ZI 3CXCY 5IP7I 5D1OB 1KRLA 2H85A 5FLMI 2VF1A 2JUBA 1M1K1 3CMAZ 1QVGY 1NJI2 1YHQ1 4MD7A 1KC82 2WB1A 2K3RA 3GTJI 4BY1I 3S1MI 2WAQA 3S17I 2RIQA 2GU2A 1QF8A 3GTGI 3S1RI 2W04A 1S721 4E2WA 3OW2Z 2F4MA 3TE5B 3NH8A 3G6EZ 1L1OC 3Q87A 3CD61 3CCJ1 1I50I 1Q811 3J7A4 1K8A2 1QVFY 3I55Z 1VQMZ 3M4OI 2OTJZ 4MXUA 4XX2A 1W2BY 2YU9I 2GTIA 3IX0A 3CC41 1K9M2 2JNYA 1RLYA 5FLXf 4NBBA 2JS4A 3GCFA 3H0GI 3CME1 3G71Z 1X3WA 2RPRA 1M902 2QA41 4CL1A 3CCE1 1VQN1 4X6AI 1DL6A 1VQK1 2QLVB 3GTMI 4BY7I 1VQ41 2JR6A 3VB9A 3NDIA 3MZLB 4RVFA 3HOWI 4NB8A 1RO4A 4A3CI 5CM2M 3HKZA 1M901 1TWCI 3GTOI 4MD9A 2QEXZ 1Y1VI 2YADA 3GTMS 1WCMI 5C4XI 2IZ3A 2Q51A 1WIIA 1ZB8A 1VQP1 4A3JI 4Y7NI 2P3YA 3GTKI 2DE7A 3F3FC 3CCM1 1VQ8Z 3S2DI 1YUKA 3U50C 2E9HA 4NBAA 1Y1VS 1YJNZ 3I07A 3BG0B 2R6MA 1YIT1 3RZOI 4E31A 3NFZA 2PMZA 1TWGI 3PO2I 4E2ZA 1YHQZ 5IP9I 1JJ2Y 1QYPA 3H3VJ 2RT9A 1KQSY 1ZB9A 1N8R2 4NBEA 3G4S1 3GTPI 3CCRZ 1S72Z 2JMOA 2JA6I 1LQLA 3CC21 3NH4A 5AN9F 3CD6Z 4AYBA 4NH1C 3CCJZ 3CCR1 2LFUA 1YI21 4DQYB 1NJI1 3HOUI 2GTHA 1KC81 1YIJ1 1VLAA 4E33A 3CCL1 2V8JA 4MD8A 1YJ91 4RVHA 2G2KA 2JA7I 5D1PA 2LIYA 2O4HA 1Z03A 3IFUA 3VTNA 1RNIA 3CCV1 2R92I 3CC4Z 3S16I 1JWHC 3OW2Y 5T67A 1VQ61 2KPIA 1TWAI 1VQ71 3CMEZ 3NDJA 1WW9A 4E30A 2F4OA 3J80f 4NB9A 1K8A1 3K7AI 1S7MA 2QA4Z 1VQO1 1RO0A 3CCEZ 1VQNZ 3GKQA 2VUGA 1Y1WI 4A3GI 3CPWY 1YUAA 2J6AA 1VQKZ 2E2HI 3GTLI 3S15I 1VQ4Z 2O53A 3JAMb 3TDHB 1K9M1 4RVGA 2Q4ZA 2RBLA 4S1TA 3VMGA 2RHBA 5C3EI 1Q822 3FQMA 4A3KI 4HGYA 4NBHA 1VQPZ 3RZDI 2HF1A 2ZAEB 2KI7B 3CCMZ 1RQFA 2IZ4A 4DGLA 3D6WA 2BJOA 4TNUA 1YITZ 1Z02A 2OTL1 4RVDA 3CCQ1 3J81b 2M48A 3CC71 5A2Qb 3CCU1 3MONA 3HOVI 1K83I 4MH4A 3HOXI 3NH5A 4RV9A 5IT9f 3HOZI 1K732 2QREB 1Q862 1YJW1 3HOYI 1VQ51 2JA8I 3VMHA 2R93I 2EGTA 3CXCZ 2HU9A 4NFRA 3F3PC 1I3QI 3ESWA 3G4SZ 4HH4A 4MRIA 4QTUA 3I561 2OOXB 1TWHI 1Z01A 1QVGZ 1VQ91 3I4NI 3I4MI 3CC2Z 4QTTA 1VQL1 3EEDA 2W03A 1P9NA 2QRDB 2JA5I 4BBSI 2AKLA 1YI2Z 2I3CA 1Q7Y2 1YIJZ 3LUSA 3CCLZ 1YJ9Z 3PO3I 2V8IA 1TWFI 3T4NB 3CCSZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 2;  1N8R 1;  1K8A 1;  3CCV Z;  2QA4 Z;  1KQS Z;  1VQO 1;  1M90 1;  3CCE Z;  1VQN Z;  1Q81 2;  3CMA 1;  1VQ8 1;  3CCS 1;  1VQ6 Z;  3CPW Y;  2QEX Z;  1VQK Z;  1YJN 1;  1K73 1;  1QVF Z;  1Q86 1;  1Q7Y 1;  1VQ7 Z;  1VQ4 Z;  3CXC Y;  1VQP 1;  1K9M 1;  1VQO Z;  1M1K 1;  1W2B Z;  3CCM 1;  3CMA Z;  1VQ8 Z;  1QVG Y;  1NJI 2;  1YHQ 1;  1YJN Z;  1KC8 2;  1YIT 1;  1Q82 2;  3G6E 1;  1VQP Z;  3CPW Z;  3CCM Z;  1YHQ Z;  3I55 1;  1S72 1;  1JJ2 Y;  1VQM 1;  1YIT Z;  3OW2 Z;  2OTJ 1;  3G6E Z;  1KQS Y;  3CD6 1;  2OTL 1;  3CCJ 1;  3CCQ 1;  1N8R 2;  1Q81 1;  1K8A 2;  3G4S 1;  1QVF Y;  3CC7 1;  3CCU 1;  3CCR Z;  3I55 Z;  1S72 Z;  1VQM Z;  1KD1 2;  1K73 2;  1Q86 2;  2OTJ Z;  3G71 1;  3CC2 1;  1YJW 1;  1VQ5 1;  3CD6 Z;  1W2B Y;  2OTL Z;  3CCJ Z;  3CCR 1;  3CXC Z;  3CCQ Z;  1YI2 1;  3CC4 1;  1K9M 2;  1NJI 1;  3G4S Z;  3CC7 Z;  3CCU Z;  1KC8 1;  1YIJ 1;  1Q82 1;  3I56 1;  3CCL 1;  1QVG Z;  1YJ9 1;  1VQ9 1;  3CME 1;  3G71 Z;  3CC2 Z;  1YJW Z;  1VQL 1;  1VQ5 Z;  1KD1 1;  1M90 2;  1YI2 Z;  3CCV 1;  2QA4 1;  3CC4 Z;  3CCE 1;  1VQN 1;  3OW2 Y;  1Q7Y 2;  1VQ6 1;  1YIJ Z;  3I56 Z;  2QEX 1;  1VQK 1;  3CCL Z;  1YJ9 Z;  1VQ9 Z;  1VQ4 1;  1VQ7 1;  3CME Z;  1VQL Z;  3CCS Z;  1JJ2 Z; 
#chains in the Genus database with same CATH topology
 2NVT I;  2VPX A;  1N8R 1;  3CCV Z;  2NVQ I;  1X0T A;  1Q81 2;  3CMA 1;  2NVY I;  3CCS 1;  1VQ6 Z;  1QVF Z;  3PO3 S;  4HGZ A;  1NUI A;  1VQ7 Z;  1Q7Y 1;  4DK1 A;  2IV2 X;  3KIH A;  2VUM I;  2JIP A;  4A3L I;  4NBD A;  1VQO Z;  1W2B Z;  2E2I I;  4BBR I;  3EER A;  3MZK B;  3S1Q I;  3P5J B;  3KIF A;  3GTQ I;  1USP A;  4MON A;  3QWU A;  4NBG A;  3G6E 1;  2K5R A;  2DE6 A;  3CPW Z;  4EWC A;  5FLX b;  4Y52 I;  3D9X A;  3J80 b;  2OZK A;  3I55 1;  3VMI A;  3FKI I;  1VQM 1;  2OTJ 1;  3IF8 A;  3JAM f;  1ZH1 A;  3S1N I;  2PM9 A;  4A3D I;  1NP6 A;  5T6B A;  1WJ2 A;  1KD1 2;  3S2H I;  1X3Z A;  1SFO I;  5C44 I;  3G71 1;  4A3E I;  2OTL Z;  5D1O A;  3CCQ Z;  4NBC A;  2PK7 A;  4E32 A;  3CC7 Z;  4RS4 A;  5LL6 f;  3CCU Z;  4NOZ A;  1Q82 1;  4A3F I;  3S14 I;  1USP B;  1YJW Z;  1VQ5 Z;  1KD1 1;  2Y0S A;  3CQZ I;  4BXX I;  3J81 f;  2QRC B;  2E2J I;  1WZN A;  4E2Y A;  1TFI A;  5A2Q f;  4A3M I;  1RO2 A;  2VPZ A;  3I56 Z;  2QEX 1;  3FQQ A;  2OOY B;  4NBF A;  1VQ9 Z;  2QKD A;  2B63 I;  1VQL Z;  2NVX I;  1JJ2 Z;  1PFT A;  2P28 A;  5T64 A;  1M1K 2;  1I6H I;  5IT9 b;  1ML8 A;  3BG1 B;  1KQS Z;  4A3B I;  2JIQ A;  1VQ8 1;  2DE5 A;  1N2F A;  2V8K A;  1YJN 1;  1K73 1;  2QR1 B;  4A3I I;  2M6N A;  4E2X A;  1Q86 1;  1R9T I;  3M3Y I;  4A93 I;  5C4J I;  2R7Z I;  3CXC Y;  5IP7 I;  5D1O B;  1KRL A;  2H85 A;  5FLM I;  2VF1 A;  2JUB A;  1M1K 1;  3CMA Z;  1QVG Y;  1NJI 2;  1YHQ 1;  4MD7 A;  1KC8 2;  2WB1 A;  2K3R A;  3GTJ I;  1FDO A;  4BY1 I;  3S1M I;  2WAQ A;  3S17 I;  2RIQ A;  3IR7 A;  2GU2 A;  1QF8 A;  3D2L A;  3GTG I;  3S1R I;  2W04 A;  1S72 1;  4E2W A;  2JIM A;  3OW2 Z;  2F4M A;  2VPW A;  3TE5 B;  3NH8 A;  3G6E Z;  1L1O C;  3Q87 A;  3CD6 1;  3CCJ 1;  1I50 I;  1Q81 1;  3J7A 4;  1K8A 2;  1QVF Y;  3I55 Z;  1VQM Z;  1Y8C A;  3M4O I;  2OTJ Z;  4MXU A;  4XX2 A;  1W2B Y;  2YU9 I;  2GTI A;  2V45 A;  3IX0 A;  3CC4 1;  1K9M 2;  2JNY A;  2JIO A;  1RLY A;  5FLX f;  4NBB A;  2JS4 A;  3GCF A;  3H0G I;  3CME 1;  3G71 Z;  1X3W A;  2RPR A;  1M90 2;  2QA4 1;  4CL1 A;  3CCE 1;  1VQN 1;  4X6A I;  1DL6 A;  1VQK 1;  2QLV B;  3GTM I;  4BY7 I;  1VQ4 1;  2JR6 A;  3VB9 A;  3NDI A;  3MZL B;  4RVF A;  2E7Z A;  4NB8 A;  3HOW I;  1RO4 A;  4A3C I;  5CM2 M;  3HKZ A;  1M90 1;  1TWC I;  3GTO I;  4MD9 A;  2QEX Z;  1Y1V I;  2YAD A;  3GTM S;  1WCM I;  5C4X I;  2IZ3 A;  2Q51 A;  1WII A;  1ZB8 A;  1VQP 1;  4A3J I;  4Y7N I;  2P3Y A;  3GTK I;  2DE7 A;  3F3F C;  3CCM 1;  1VQ8 Z;  3S2D I;  1YUK A;  3U50 C;  2E9H A;  4NBA A;  1Y1V S;  1YJN Z;  3I07 A;  3BG0 B;  2R6M A;  1YIT 1;  3RZO I;  1AA6 A;  4E31 A;  3NFZ A;  2PMZ A;  2V3V A;  1TWG I;  3PO2 I;  4E2Z A;  1YHQ Z;  5IP9 I;  1JJ2 Y;  2LEX A;  1QYP A;  3H3V J;  2RT9 A;  1KQS Y;  2JIR A;  1ZB9 A;  1N8R 2;  4NBE A;  3G4S 1;  3GTP I;  3CCR Z;  1S72 Z;  2JMO A;  2JA6 I;  1SIW A;  1LQL A;  3CC2 1;  3NH4 A;  5AN9 F;  3CD6 Z;  4AYB A;  4NH1 C;  3CCJ Z;  3CCR 1;  2LFU A;  1YI2 1;  4DQY B;  1NJI 1;  3HOU I;  2GTH A;  1KC8 1;  1YIJ 1;  1VLA A;  4E33 A;  3CCL 1;  2V8J A;  4MD8 A;  1YJ9 1;  4RVH A;  2G2K A;  2JA7 I;  5D1P A;  2LIY A;  2O4H A;  1Z03 A;  3IFU A;  3VTN A;  1RNI A;  3CCV 1;  2R92 I;  3CC4 Z;  3S16 I;  1JWH C;  3OW2 Y;  5T67 A;  1VQ6 1;  2KPI A;  1TWA I;  1VQ7 1;  3CME Z;  2VPY A;  3NDJ A;  1WW9 A;  4E30 A;  2F4O A;  3J80 f;  4NB9 A;  2NAP A;  1K8A 1;  3K7A I;  1S7M A;  1QXF A;  2QA4 Z;  1VQO 1;  1RO0 A;  3CCE Z;  1VQN Z;  3GKQ A;  2VUG A;  1Y1W I;  4A3G I;  3CPW Y;  1YUA A;  2J6A A;  1VQK Z;  2E2H I;  3GTL I;  3S15 I;  1VQ4 Z;  2O53 A;  3JAM b;  3TDH B;  1K9M 1;  4RVG A;  2Q4Z A;  2RBL A;  4S1T A;  3VMG A;  2RHB A;  5C3E I;  1Q82 2;  3FQM A;  4A3K I;  4HGY A;  4NBH A;  1VQP Z;  3RZD I;  2HF1 A;  2ZAE B;  2KI7 B;  3CCM Z;  1RQF A;  2IZ4 A;  4DGL A;  3D6W A;  1Q16 A;  2BJO A;  4TNU A;  1YIT Z;  1Z02 A;  2OTL 1;  4RVD A;  3CCQ 1;  3J81 b;  2AYD A;  2M48 A;  3CC7 1;  5A2Q b;  3CCU 1;  3MON A;  3HOV I;  1K83 I;  4MH4 A;  3HOX I;  3NH5 A;  4RV9 A;  5IT9 f;  3HOZ I;  1K73 2;  2QRE B;  1Q86 2;  1YJW 1;  3HOY I;  1VQ5 1;  2JA8 I;  3VMH A;  2R93 I;  2EGT A;  3CXC Z;  2HU9 A;  1FDI A;  4NFR A;  3F3P C;  1I3Q I;  3ESW A;  3G4S Z;  4HH4 A;  4MRI A;  4QTU A;  3I56 1;  2OOX B;  1TWH I;  1Z01 A;  1QVG Z;  1VQ9 1;  3I4N I;  3I4M I;  3CC2 Z;  4QTT A;  1VQL 1;  3EED A;  2W03 A;  1P9N A;  2QRD B;  2JA5 I;  4BBS I;  2AKL A;  1YI2 Z;  2I3C A;  1Q7Y 2;  1YIJ Z;  3LUS A;  3CCL Z;  1YJ9 Z;  3PO3 I;  2V8I A;  1TWF I;  3T4N B;  3CCS Z; 
#chains in the Genus database with same CATH homology
 2NVT I;  1N8R 1;  3CCV Z;  2NVQ I;  1X0T A;  1Q81 2;  3CMA 1;  2NVY I;  3CCS 1;  1VQ6 Z;  1QVF Z;  3PO3 S;  4HGZ A;  1NUI A;  1VQ7 Z;  1Q7Y 1;  4DK1 A;  3KIH A;  2VUM I;  4A3L I;  4NBD A;  1VQO Z;  1W2B Z;  2E2I I;  4BBR I;  3EER A;  3MZK B;  3S1Q I;  3P5J B;  3KIF A;  3GTQ I;  1USP A;  4MON A;  3QWU A;  4NBG A;  3G6E 1;  2K5R A;  2DE6 A;  3CPW Z;  4EWC A;  5FLX b;  4Y52 I;  3D9X A;  3J80 b;  2OZK A;  3I55 1;  3VMI A;  3FKI I;  1VQM 1;  2OTJ 1;  3IF8 A;  3JAM f;  1ZH1 A;  3S1N I;  2PM9 A;  4A3D I;  1NP6 A;  5T6B A;  1KD1 2;  3S2H I;  1X3Z A;  1SFO I;  5C44 I;  3G71 1;  4A3E I;  2OTL Z;  5D1O A;  3CCQ Z;  4NBC A;  2PK7 A;  4E32 A;  3CC7 Z;  4RS4 A;  5LL6 f;  3CCU Z;  4NOZ A;  1Q82 1;  4A3F I;  3S14 I;  1USP B;  1YJW Z;  1VQ5 Z;  1KD1 1;  2Y0S A;  3CQZ I;  4BXX I;  3J81 f;  2QRC B;  2E2J I;  4E2Y A;  1TFI A;  5A2Q f;  4A3M I;  1RO2 A;  3I56 Z;  2QEX 1;  3FQQ A;  2OOY B;  4NBF A;  1VQ9 Z;  2QKD A;  2B63 I;  1VQL Z;  2NVX I;  1JJ2 Z;  1PFT A;  2P28 A;  5T64 A;  1M1K 2;  1I6H I;  5IT9 b;  1ML8 A;  3BG1 B;  1KQS Z;  4A3B I;  1VQ8 1;  2DE5 A;  1N2F A;  2V8K A;  1YJN 1;  1K73 1;  2QR1 B;  4A3I I;  2M6N A;  4E2X A;  1Q86 1;  1R9T I;  3M3Y I;  4A93 I;  5C4J I;  2R7Z I;  3CXC Y;  5IP7 I;  5D1O B;  1KRL A;  2H85 A;  5FLM I;  2VF1 A;  2JUB A;  1M1K 1;  3CMA Z;  1QVG Y;  1NJI 2;  1YHQ 1;  4MD7 A;  1KC8 2;  2WB1 A;  2K3R A;  3GTJ I;  4BY1 I;  3S1M I;  2WAQ A;  3S17 I;  2RIQ A;  2GU2 A;  1QF8 A;  3GTG I;  3S1R I;  2W04 A;  1S72 1;  4E2W A;  3OW2 Z;  2F4M A;  3TE5 B;  3NH8 A;  3G6E Z;  1L1O C;  3Q87 A;  3CD6 1;  3CCJ 1;  1I50 I;  1Q81 1;  3J7A 4;  1K8A 2;  1QVF Y;  3I55 Z;  1VQM Z;  3M4O I;  2OTJ Z;  4MXU A;  4XX2 A;  1W2B Y;  2YU9 I;  2GTI A;  3IX0 A;  3CC4 1;  1K9M 2;  2JNY A;  1RLY A;  5FLX f;  4NBB A;  2JS4 A;  3GCF A;  3H0G I;  3CME 1;  3G71 Z;  1X3W A;  2RPR A;  1M90 2;  2QA4 1;  4CL1 A;  3CCE 1;  1VQN 1;  4X6A I;  1DL6 A;  1VQK 1;  2QLV B;  3GTM I;  4BY7 I;  1VQ4 1;  2JR6 A;  3VB9 A;  3NDI A;  3MZL B;  4RVF A;  3HOW I;  4NB8 A;  1RO4 A;  4A3C I;  5CM2 M;  3HKZ A;  1M90 1;  1TWC I;  3GTO I;  4MD9 A;  2QEX Z;  1Y1V I;  2YAD A;  3GTM S;  1WCM I;  5C4X I;  2IZ3 A;  2Q51 A;  1WII A;  1ZB8 A;  1VQP 1;  4A3J I;  4Y7N I;  2P3Y A;  3GTK I;  2DE7 A;  3F3F C;  3CCM 1;  1VQ8 Z;  3S2D I;  1YUK A;  3U50 C;  2E9H A;  4NBA A;  1Y1V S;  1YJN Z;  3I07 A;  3BG0 B;  2R6M A;  1YIT 1;  3RZO I;  4E31 A;  3NFZ A;  2PMZ A;  1TWG I;  3PO2 I;  4E2Z A;  1YHQ Z;  5IP9 I;  1JJ2 Y;  1QYP A;  3H3V J;  2RT9 A;  1KQS Y;  1ZB9 A;  1N8R 2;  4NBE A;  3G4S 1;  3GTP I;  3CCR Z;  1S72 Z;  2JMO A;  2JA6 I;  1LQL A;  3CC2 1;  3NH4 A;  5AN9 F;  3CD6 Z;  4AYB A;  4NH1 C;  3CCJ Z;  3CCR 1;  2LFU A;  1YI2 1;  4DQY B;  1NJI 1;  3HOU I;  2GTH A;  1KC8 1;  1YIJ 1;  1VLA A;  4E33 A;  3CCL 1;  2V8J A;  4MD8 A;  1YJ9 1;  4RVH A;  2G2K A;  2JA7 I;  5D1P A;  2LIY A;  2O4H A;  1Z03 A;  3IFU A;  3VTN A;  1RNI A;  3CCV 1;  2R92 I;  3CC4 Z;  3S16 I;  1JWH C;  3OW2 Y;  5T67 A;  1VQ6 1;  2KPI A;  1TWA I;  1VQ7 1;  3CME Z;  3NDJ A;  1WW9 A;  4E30 A;  2F4O A;  3J80 f;  4NB9 A;  1K8A 1;  3K7A I;  1S7M A;  2QA4 Z;  1VQO 1;  1RO0 A;  3CCE Z;  1VQN Z;  3GKQ A;  2VUG A;  1Y1W I;  4A3G I;  3CPW Y;  1YUA A;  2J6A A;  1VQK Z;  2E2H I;  3GTL I;  3S15 I;  1VQ4 Z;  2O53 A;  3JAM b;  3TDH B;  1K9M 1;  4RVG A;  2Q4Z A;  2RBL A;  4S1T A;  3VMG A;  2RHB A;  5C3E I;  1Q82 2;  3FQM A;  4A3K I;  4HGY A;  4NBH A;  1VQP Z;  3RZD I;  2HF1 A;  2ZAE B;  2KI7 B;  3CCM Z;  1RQF A;  2IZ4 A;  4DGL A;  3D6W A;  2BJO A;  4TNU A;  1YIT Z;  1Z02 A;  2OTL 1;  4RVD A;  3CCQ 1;  3J81 b;  2M48 A;  3CC7 1;  5A2Q b;  3CCU 1;  3MON A;  3HOV I;  1K83 I;  4MH4 A;  3HOX I;  3NH5 A;  4RV9 A;  5IT9 f;  3HOZ I;  1K73 2;  2QRE B;  1Q86 2;  1YJW 1;  3HOY I;  1VQ5 1;  2JA8 I;  3VMH A;  2R93 I;  2EGT A;  3CXC Z;  2HU9 A;  4NFR A;  3F3P C;  1I3Q I;  3ESW A;  3G4S Z;  4HH4 A;  4MRI A;  4QTU A;  3I56 1;  2OOX B;  1TWH I;  1Z01 A;  1QVG Z;  1VQ9 1;  3I4N I;  3I4M I;  3CC2 Z;  4QTT A;  1VQL 1;  3EED A;  2W03 A;  1P9N A;  2QRD B;  2JA5 I;  4BBS I;  2AKL A;  1YI2 Z;  2I3C A;  1Q7Y 2;  1YIJ Z;  3LUS A;  3CCL Z;  1YJ9 Z;  3PO3 I;  2V8I A;  1TWF I;  3T4N B;  3CCS Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...