3S14I

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription/rna/dna
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s14I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s14I02
3VMIA 3VMGA 4NBGA 4NB9A 1K83I 3GTJI 3HOVI 1QYPA 1N2FA 4BBRI 2AKLA 5C44I 5CM2M 3GTGI 3LUSA 2JS4A 5IP9I 2NVQI 2JNYA 2DE5A 2J6AA 4QTUA 3HOUI 1TWCI 3RZDI 1PFTA 3RZOI 4Y52I 3GTQI 3HOYI 1TWGI 3GCFA 1ZB8A 4NB8A 1DL6A 2E2HI 4A3JI 3HOZI 4A3DI 3H0GI 3S17I 5FLMI 1R9TI 2NVXI 3S15I 4NBDA 2JA5I 2NVTI 3GTKI 1ML8A 3U50C 1TWAI 4NBBA 1VLAA 1USPB 4A3LI 4A3CI 3S2DI 3GKQA 2JR6A 2F4OA 3GTPI 3Q87A 4NBEA 2VUMI 2DE7A 3FKII 1I6HI 3S1MI 3VMHA 1X3WA 1LQLA 1RO4A 1NUIA 2F4MA 1TFIA 1Y1WI 4XX2A 3S2HI 1TWHI 4NBFA 2NVYI 1X3ZA 3I4NI 2R92I 3GTMI 3K7AI 2KPIA 4NOZA 4A3FI 2E2II 3PO3I 4BBSI 4A3MI 2JA6I 4X6AI 3HOXI 4BXXI 1I50I 3I07A 5C4XI 3I4MI 3CQZI 1SFOI 2PK7A 2R7ZI 1Y1VI 3S1NI 2YU9I 3M3YI 2P3YA 3GTMS 2E2JI 3D6WA 1YUAA 2K5RA 4QTTA 1L1OC 4A3II 5C4JI 4A3BI 4A93I 4NBHA 4A3KI 5C3EI 3VB9A 4BY1I 5IP7I 2RBLA 2JA8I 1I3QI 3GTOI 4BY7I 3HOWI 3S14I 1TWFI 3EERA 2HF1A 3ESWA 1WCMI 3S16I 3M4OI 1RLYA 1USPA 2DE6A 3S1RI 2B63I 1ZB9A 3S1QI 4A3GI 2R93I 4MH4A 3GTLI 4NBAA 1WW9A 4A3EI 3PO2I 1Y1VS 2JA7I 2BJOA 3PO3S 4NBCA 3H3VJ 4Y7NI
chains in the Genus database with same CATH superfamily
2E7ZA 2JUBA 3VMGA 2G2KA 1K83I 2H85A 1QYPA 4BBRI 1VQ4Z 2QR1B 4RVFA 4MONA 2LEXA 2QEXZ 3F3PC 2EGTA 4QTUA 3NDJA 3RZDI 3CCMZ 4Y52I 1Q7Y2 4MRIA 1JJ2Y 1VQL1 2QRDB 4NB8A 2E2HI 3H0GI 3S17I 3I551 2JA5I 3QWUA 3BG1B 5LL6f 3U50C 3IX0A 4NBBA 3CCJ1 3CCVZ 1Q822 1Z03A 2JIPA 2VPXA 3G6E1 1VQ9Z 3TDHB 3S2DI 2VPYA 4E2YA 2HU9A 1NP6A 3CCQZ 3G711 3Q87A 2VUMI 2DE7A 1TFIA 1RO4A 2F4MA 3KIFA 1P9NA 1YJWZ 4XX2A 1KC81 1TWHI 4E2ZA 3CCU1 2OTL1 1YIT1 3H3VJ 3GTMI 3K7AI 2E2II 2O4HA 1QVGY 2Q4ZA 3HOXI 1I50I 3I07A 5C4XI 1VQP1 3CQZI 2ZAEB 2PK7A 1VQ7Z 1Q811 4E2WA 4DQYB 1Z02A 4QTTA 5D1OA 3EEDA 4NBHA 2OTJZ 4A3KI 4RV9A 1FDOA 5IP7I 4BY7I 3S16I 2AYDA 2DE6A 4DK1A 3F3FC 2OZKA 3VTNA 3BG0B 3NDIA 3J80b 1VQM1 2QA41 2BJOA 4NFRA 1YHQ1 1YUKA 4Y7NI 3CC71 1VQPZ 3GTJI 2QEX1 1KQSZ 2AKLA 1VQMZ 3CCQ1 4TNUA 3D9XA 2RT9A 3G4SZ 3I56Z 5FLXf 2DE5A 2J6AA 1WJ2A 4NH1C 1VQK1 3GTQI 2V8IA 1TWGI 2LFUA 3HOZI 3G4S1 4RVHA 5FLMI 2V45A 1VQ71 4MXUA 2V3VA 2OTJ1 1USPB 2GTHA 2P28A 5A2Qb 3GKQA 3MONA 1QVGZ 1KRLA 4HGYA 1WIIA 3CD6Z 1YHQZ 1QVFZ 3GTPI 3JAMb 1VQO1 4E32A 3J81f 3CMA1 2Y0SA 3TE5B 3CPWY 1X3WA 1LQLA 1Y1WI 3NH8A 4S1TA 3CC41 1KD11 4RVDA 2RIQA 2V8KA 1VQ51 2NVYI 3CXCZ 4RS4A 1QXFA 2R92I 4A3MI 3CC7Z 1K9M2 3I4MI 2PMZA 2E9HA 2R7ZI 1Y1VI 3S1NI 2W03A 3GTMS 2E2JI 2K5RA 3G6EZ 5C4JI 4A93I 1Q16A 4E30A 2JA8I 3OW2Z 1TWFI 3EERA 1VQOZ 3CXCY 4MD8A 1RO2A 2B63I 1ZB9A 3S1QI 4HGZA 3CCR1 4HH4A 4MH4A 1WW9A 3PO2I 1W2BY 3PO3S 1Q7Y1 3J81b 3CD61 1VQ91 3P5JB 1Z01A 2YADA 3VMIA 2KI7B 4NBGA 4NB9A 1NJI1 3HOVI 1N2FA 3CPWZ 5CM2M 3LUSA 3CCLZ 2JS4A 1VQ81 2Q51A 2GU2A 2JNYA 2OOXB 2JIRA 1Q812 3RZOI 1VQ5Z 4CL1A 3CCE1 1M902 2K3RA 2VF1A 1N8R1 4E33A 2VUGA 1NJI2 1VQNZ 4A3JI 4A3DI 4DGLA 1R9TI 3NH5A 4NBDA 3GTKI 5T64A 1K8A2 1TWAI 2QA4Z 1VLAA 1AA6A 1VQ61 4MD7A 3I55Z 3KIHA 3G71Z 3CCRZ 1YJ91 3MZKB 3J80f 5A2Qf 1YIJ1 2M48A 3JAMf 1YJW1 1JJ2Z 1YITZ 3FKII 1I6HI 3T4NB 1JWHC 5IT9b 3S1MI 3J7A4 3NFZA 3VMHA 1NUIA 2O53A 4E2XA 3CMAZ 1X3ZA 3I4NI 2KPIA 4A3FI 5FLXb 1RO0A 4RVGA 5D1OB 2JA6I 4X6AI 2PM9A 2QKDA 1VQ8Z 1SFOI 2YU9I 3M3YI 2M6NA 3CCM1 2QREB 1L1OC 4A3BI 2WAQA 2QRCB 5C3EI 1RNIA 1SIWA 2RBLA 3GTOI 5T6BA 3CCSZ 2HF1A 3M4OI 3S1RI 1QVFY 1K8A1 2W04A 1YI2Z 3FQQA 2R93I 1Q821 3IR7A 1K732 2IZ4A 3CCJZ 3CCV1 1FDIA 1VQ41 1KD12 2OOYB 1X0TA 1YIJZ 1YI21 3CME1 1S721 5D1PA 5C44I 3GTGI 1VQLZ 1YJN1 1KC82 1VQKZ 5IP9I 1S72Z 2VPZA 3CC4Z 2WB1A 3HKZA 2NVQI 2I3CA 1K731 3CC21 3HOUI 1TWCI 1PFTA 3CCUZ 2OTLZ 3HOYI 3GCFA 1ZB8A 3CC2Z 1DL6A 2NVXI 3S15I 1KQSY 2NVTI 1ML8A 3OW2Y 3D2LA 2R6MA 4A3LI 4A3CI 3IF8A 2JR6A 2F4OA 2RHBA 3MZLB 2IZ3A 2GTIA 1ZH1A 2V8JA 4NBEA 3I561 3S2HI 4NBFA 3IFUA 5AN9F 3CCEZ 3NH4A 1M1K2 2RPRA 4NOZA 3PO3I 4BBSI 1M901 4E31A 1N8R2 2JIQA 1Y8CA 4BXXI 1Q862 1YJNZ 1VQN1 2JMOA 1WZNA 2QLVB 1QF8A 4AYBA 1VQ6Z 2P3YA 2IV2X 3FQMA 3D6WA 1YUAA 2JIOA 4A3II 1M1K1 3VB9A 4BY1I 1I3QI 3HOWI 3S14I 2LIYA 3ESWA 1WCMI 1RLYA 1USPA 1Q861 1K9M1 1RQFA 4A3GI 1W2BZ 3CMEZ 1S7MA 4MD9A 4EWCA 2VPWA 3GTLI 4NBAA 1YJ9Z 3CCS1 4A3EI 1Y1VS 2JA7I 3CCL1 5IT9f 4NBCA 2JIMA 5T67A 2NAPA
chains in the Genus database with same CATH topology
2JUBA 3VMGA 2G2KA 1K83I 2H85A 1QYPA 4BBRI 1VQ4Z 2QR1B 4RVFA 4MONA 2QEXZ 3F3PC 2EGTA 4QTUA 3NDJA 3RZDI 3CCMZ 4Y52I 1Q7Y2 4MRIA 1JJ2Y 1VQL1 2QRDB 4NB8A 2E2HI 3H0GI 3S17I 3I551 2JA5I 3QWUA 3BG1B 5LL6f 3U50C 3IX0A 4NBBA 3CCJ1 3CCVZ 1Q822 1Z03A 3G6E1 1VQ9Z 3TDHB 3S2DI 4E2YA 2HU9A 1NP6A 3CCQZ 3G711 3Q87A 2VUMI 2DE7A 1TFIA 1KC81 1RO4A 2F4MA 1P9NA 3KIFA 4XX2A 1YJWZ 1TWHI 4E2ZA 3CCU1 2OTL1 1YIT1 3GTMI 3K7AI 2E2II 2O4HA 1QVGY 2Q4ZA 3HOXI 1I50I 3I07A 5C4XI 1VQP1 3CQZI 2ZAEB 2PK7A 1VQ7Z 1Q811 4E2WA 4DQYB 1Z02A 4QTTA 5D1OA 3EEDA 4NBHA 2OTJZ 4A3KI 4RV9A 5IP7I 4BY7I 3S16I 2DE6A 4DK1A 3F3FC 2OZKA 3VTNA 3BG0B 3NDIA 3J80b 1VQM1 2QA41 2BJOA 4NFRA 1YHQ1 1YUKA 4Y7NI 3CC71 1VQPZ 3GTJI 2QEX1 1KQSZ 2AKLA 1VQMZ 3CCQ1 4TNUA 3D9XA 2RT9A 3G4SZ 3I56Z 5FLXf 2DE5A 2J6AA 1VQK1 4NH1C 3GTQI 2V8IA 1TWGI 2LFUA 3HOZI 3G4S1 4RVHA 5FLMI 1VQ71 4MXUA 2OTJ1 1USPB 2GTHA 2P28A 5A2Qb 3GKQA 3MONA 1QVGZ 1KRLA 4HGYA 1WIIA 3CD6Z 1YHQZ 1QVFZ 3GTPI 3JAMb 1VQO1 4E32A 3J81f 3CMA1 2Y0SA 3TE5B 3CPWY 1X3WA 1Y1WI 1LQLA 3NH8A 4S1TA 3CC41 1KD11 4RVDA 2RIQA 2V8KA 1VQ51 2NVYI 3CXCZ 4RS4A 2R92I 4A3MI 3CC7Z 1K9M2 3I4MI 2PMZA 2E9HA 2R7ZI 1Y1VI 3S1NI 2W03A 3GTMS 2E2JI 2K5RA 3G6EZ 5C4JI 4A93I 4E30A 2JA8I 3OW2Z 1TWFI 3EERA 1VQOZ 3CXCY 4MD8A 1RO2A 2B63I 1ZB9A 3S1QI 4HGZA 3CCR1 4HH4A 4MH4A 1WW9A 3PO2I 1W2BY 3PO3S 1Q7Y1 3J81b 3CD61 1VQ91 3P5JB 1Z01A 2YADA 3VMIA 2KI7B 4NBGA 4NB9A 1NJI1 3HOVI 1N2FA 3CPWZ 5CM2M 3LUSA 3CCLZ 2JS4A 1VQ81 2Q51A 2GU2A 2JNYA 2OOXB 1Q812 3RZOI 1VQ5Z 4CL1A 3CCE1 1M902 2K3RA 2VF1A 1N8R1 4E33A 2VUGA 1NJI2 1VQNZ 4A3JI 4A3DI 4DGLA 1R9TI 3NH5A 4NBDA 3GTKI 5T64A 1K8A2 1TWAI 2QA4Z 1VLAA 1VQ61 4MD7A 3I55Z 3KIHA 3G71Z 3CCRZ 1YJ91 3MZKB 3J80f 5A2Qf 1YIJ1 2M48A 3JAMf 1YJW1 1JJ2Z 1YITZ 3FKII 1I6HI 3T4NB 1JWHC 5IT9b 3S1MI 3J7A4 3NFZA 3VMHA 1NUIA 2O53A 4E2XA 3CMAZ 1X3ZA 3I4NI 2KPIA 4A3FI 5FLXb 1RO0A 4RVGA 5D1OB 2JA6I 4X6AI 2PM9A 2QKDA 1VQ8Z 1SFOI 2YU9I 3M3YI 2M6NA 3CCM1 2QREB 1L1OC 4A3BI 2WAQA 2QRCB 5C3EI 1RNIA 2RBLA 3GTOI 5T6BA 3CCSZ 2HF1A 3M4OI 3S1RI 1QVFY 1K8A1 2W04A 1YI2Z 3FQQA 2R93I 1Q821 1K732 2IZ4A 3CCJZ 3CCV1 1VQ41 1KD12 2OOYB 1X0TA 1YIJZ 1YI21 3CME1 1S721 5D1PA 5C44I 3GTGI 1VQLZ 1YJN1 1KC82 1VQKZ 5IP9I 1S72Z 3CC4Z 2WB1A 3HKZA 2NVQI 2I3CA 1K731 3CC21 3HOUI 1TWCI 1PFTA 3CCUZ 2OTLZ 3HOYI 3GCFA 1ZB8A 3CC2Z 1DL6A 2NVXI 3S15I 1KQSY 2NVTI 1ML8A 3OW2Y 2R6MA 4A3LI 4A3CI 3IF8A 2JR6A 2F4OA 2RHBA 3MZLB 2IZ3A 2GTIA 1ZH1A 2V8JA 4NBEA 3I561 3S2HI 4NBFA 3IFUA 5AN9F 3CCEZ 3NH4A 1M1K2 2RPRA 4NOZA 3PO3I 4BBSI 1M901 4E31A 1N8R2 4BXXI 1Q862 1YJNZ 1VQN1 2JMOA 2QLVB 1QF8A 4AYBA 1VQ6Z 2P3YA 3FQMA 3D6WA 1YUAA 4A3II 1M1K1 3VB9A 4BY1I 1I3QI 3HOWI 3S14I 2LIYA 3ESWA 1WCMI 1RLYA 1USPA 1Q861 1K9M1 1RQFA 4A3GI 1W2BZ 3CMEZ 1S7MA 4MD9A 4EWCA 3GTLI 4NBAA 1YJ9Z 3CCS1 4A3EI 1Y1VS 2JA7I 3CCL1 5IT9f 4NBCA 5T67A 3H3VJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMI A;  3VMG A;  4NBG A;  4NB9 A;  1K83 I;  3GTJ I;  3HOV I;  1QYP A;  1N2F A;  4BBR I;  2AKL A;  5C44 I;  5CM2 M;  3GTG I;  3LUS A;  2JS4 A;  5IP9 I;  2NVQ I;  2JNY A;  2DE5 A;  2J6A A;  4QTU A;  3HOU I;  1TWC I;  3RZD I;  1PFT A;  3RZO I;  4Y52 I;  3GTQ I;  3HOY I;  1TWG I;  3GCF A;  1ZB8 A;  4NB8 A;  1DL6 A;  2E2H I;  4A3J I;  3HOZ I;  4A3D I;  3H0G I;  3S17 I;  5FLM I;  1R9T I;  2NVX I;  3S15 I;  4NBD A;  2JA5 I;  2NVT I;  3GTK I;  1ML8 A;  3U50 C;  1TWA I;  4NBB A;  1VLA A;  1USP B;  4A3L I;  4A3C I;  3S2D I;  3GKQ A;  2JR6 A;  2F4O A;  3GTP I;  3Q87 A;  4NBE A;  2VUM I;  2DE7 A;  3FKI I;  1I6H I;  3S1M I;  3VMH A;  1X3W A;  1LQL A;  1RO4 A;  1NUI A;  2F4M A;  1TFI A;  1Y1W I;  4XX2 A;  3S2H I;  1TWH I;  4NBF A;  2NVY I;  1X3Z A;  3I4N I;  2R92 I;  3GTM I;  3K7A I;  2KPI A;  4NOZ A;  4A3F I;  2E2I I;  3PO3 I;  4BBS I;  4A3M I;  2JA6 I;  4X6A I;  3HOX I;  4BXX I;  1I50 I;  3I07 A;  5C4X I;  3I4M I;  3CQZ I;  1SFO I;  2PK7 A;  2R7Z I;  1Y1V I;  3S1N I;  2YU9 I;  3M3Y I;  2P3Y A;  3GTM S;  2E2J I;  3D6W A;  1YUA A;  2K5R A;  4QTT A;  1L1O C;  4A3I I;  5C4J I;  4A3B I;  4A93 I;  4NBH A;  4A3K I;  5C3E I;  3VB9 A;  4BY1 I;  5IP7 I;  2RBL A;  2JA8 I;  1I3Q I;  3GTO I;  4BY7 I;  3HOW I;  3S14 I;  1TWF I;  3EER A;  2HF1 A;  3ESW A;  1WCM I;  3S16 I;  3M4O I;  1RLY A;  1USP A;  2DE6 A;  3S1R I;  2B63 I;  1ZB9 A;  3S1Q I;  4A3G I;  2R93 I;  4MH4 A;  3GTL I;  4NBA A;  1WW9 A;  4A3E I;  3PO2 I;  1Y1V S;  2JA7 I;  2BJO A;  3PO3 S;  4NBC A;  3H3V J;  4Y7N I; 
#chains in the Genus database with same CATH topology
 2E7Z A;  2JUB A;  3VMG A;  2G2K A;  1K83 I;  2H85 A;  1QYP A;  4BBR I;  1VQ4 Z;  2QR1 B;  4RVF A;  4MON A;  2LEX A;  2QEX Z;  3F3P C;  2EGT A;  4QTU A;  3NDJ A;  3RZD I;  3CCM Z;  4Y52 I;  1Q7Y 2;  4MRI A;  1JJ2 Y;  1VQL 1;  2QRD B;  4NB8 A;  2E2H I;  3H0G I;  3S17 I;  3I55 1;  2JA5 I;  3QWU A;  3BG1 B;  5LL6 f;  3U50 C;  3IX0 A;  4NBB A;  3CCJ 1;  3CCV Z;  1Q82 2;  1Z03 A;  2JIP A;  2VPX A;  3G6E 1;  1VQ9 Z;  3TDH B;  3S2D I;  2VPY A;  4E2Y A;  2HU9 A;  1NP6 A;  3CCQ Z;  3G71 1;  3Q87 A;  2VUM I;  2DE7 A;  1TFI A;  1RO4 A;  2F4M A;  3KIF A;  1P9N A;  1YJW Z;  4XX2 A;  1KC8 1;  1TWH I;  4E2Z A;  3CCU 1;  2OTL 1;  1YIT 1;  3H3V J;  3GTM I;  3K7A I;  2E2I I;  2O4H A;  1QVG Y;  2Q4Z A;  3HOX I;  1I50 I;  3I07 A;  5C4X I;  1VQP 1;  3CQZ I;  2ZAE B;  2PK7 A;  1VQ7 Z;  1Q81 1;  4E2W A;  4DQY B;  1Z02 A;  4QTT A;  5D1O A;  3EED A;  4NBH A;  2OTJ Z;  4A3K I;  4RV9 A;  1FDO A;  5IP7 I;  4BY7 I;  3S16 I;  2AYD A;  2DE6 A;  4DK1 A;  3F3F C;  2OZK A;  3VTN A;  3BG0 B;  3NDI A;  3J80 b;  1VQM 1;  2QA4 1;  2BJO A;  4NFR A;  1YHQ 1;  1YUK A;  4Y7N I;  3CC7 1;  1VQP Z;  3GTJ I;  2QEX 1;  1KQS Z;  2AKL A;  1VQM Z;  3CCQ 1;  4TNU A;  3D9X A;  2RT9 A;  3G4S Z;  3I56 Z;  5FLX f;  2DE5 A;  2J6A A;  1WJ2 A;  4NH1 C;  1VQK 1;  3GTQ I;  2V8I A;  1TWG I;  2LFU A;  3HOZ I;  3G4S 1;  4RVH A;  5FLM I;  2V45 A;  1VQ7 1;  4MXU A;  2V3V A;  2OTJ 1;  1USP B;  2GTH A;  2P28 A;  5A2Q b;  3GKQ A;  3MON A;  1QVG Z;  1KRL A;  4HGY A;  1WII A;  3CD6 Z;  1YHQ Z;  1QVF Z;  3GTP I;  3JAM b;  1VQO 1;  4E32 A;  3J81 f;  3CMA 1;  2Y0S A;  3TE5 B;  3CPW Y;  1X3W A;  1LQL A;  1Y1W I;  3NH8 A;  4S1T A;  3CC4 1;  1KD1 1;  4RVD A;  2RIQ A;  2V8K A;  1VQ5 1;  2NVY I;  3CXC Z;  4RS4 A;  1QXF A;  2R92 I;  4A3M I;  3CC7 Z;  1K9M 2;  3I4M I;  2PMZ A;  2E9H A;  2R7Z I;  1Y1V I;  3S1N I;  2W03 A;  3GTM S;  2E2J I;  2K5R A;  3G6E Z;  5C4J I;  4A93 I;  1Q16 A;  4E30 A;  2JA8 I;  3OW2 Z;  1TWF I;  3EER A;  1VQO Z;  3CXC Y;  4MD8 A;  1RO2 A;  2B63 I;  1ZB9 A;  3S1Q I;  4HGZ A;  3CCR 1;  4HH4 A;  4MH4 A;  1WW9 A;  3PO2 I;  1W2B Y;  3PO3 S;  1Q7Y 1;  3J81 b;  3CD6 1;  1VQ9 1;  3P5J B;  1Z01 A;  2YAD A;  3VMI A;  2KI7 B;  4NBG A;  4NB9 A;  1NJI 1;  3HOV I;  1N2F A;  3CPW Z;  5CM2 M;  3LUS A;  3CCL Z;  2JS4 A;  1VQ8 1;  2Q51 A;  2GU2 A;  2JNY A;  2OOX B;  2JIR A;  1Q81 2;  3RZO I;  1VQ5 Z;  4CL1 A;  3CCE 1;  1M90 2;  2K3R A;  2VF1 A;  1N8R 1;  4E33 A;  2VUG A;  1NJI 2;  1VQN Z;  4A3J I;  4A3D I;  4DGL A;  1R9T I;  3NH5 A;  4NBD A;  3GTK I;  5T64 A;  1K8A 2;  1TWA I;  2QA4 Z;  1VLA A;  1AA6 A;  1VQ6 1;  4MD7 A;  3I55 Z;  3KIH A;  3G71 Z;  3CCR Z;  1YJ9 1;  3MZK B;  3J80 f;  5A2Q f;  1YIJ 1;  2M48 A;  3JAM f;  1YJW 1;  1JJ2 Z;  1YIT Z;  3FKI I;  1I6H I;  3T4N B;  1JWH C;  5IT9 b;  3S1M I;  3J7A 4;  3NFZ A;  3VMH A;  1NUI A;  2O53 A;  4E2X A;  3CMA Z;  1X3Z A;  3I4N I;  2KPI A;  4A3F I;  5FLX b;  1RO0 A;  4RVG A;  5D1O B;  2JA6 I;  4X6A I;  2PM9 A;  2QKD A;  1VQ8 Z;  1SFO I;  2YU9 I;  3M3Y I;  2M6N A;  3CCM 1;  2QRE B;  1L1O C;  4A3B I;  2WAQ A;  2QRC B;  5C3E I;  1RNI A;  1SIW A;  2RBL A;  3GTO I;  5T6B A;  3CCS Z;  2HF1 A;  3M4O I;  3S1R I;  1QVF Y;  1K8A 1;  2W04 A;  1YI2 Z;  3FQQ A;  2R93 I;  1Q82 1;  3IR7 A;  1K73 2;  2IZ4 A;  3CCJ Z;  3CCV 1;  1FDI A;  1VQ4 1;  1KD1 2;  2OOY B;  1X0T A;  1YIJ Z;  1YI2 1;  3CME 1;  1S72 1;  5D1P A;  5C44 I;  3GTG I;  1VQL Z;  1YJN 1;  1KC8 2;  1VQK Z;  5IP9 I;  1S72 Z;  2VPZ A;  3CC4 Z;  2WB1 A;  3HKZ A;  2NVQ I;  2I3C A;  1K73 1;  3CC2 1;  3HOU I;  1TWC I;  1PFT A;  3CCU Z;  2OTL Z;  3HOY I;  3GCF A;  1ZB8 A;  3CC2 Z;  1DL6 A;  2NVX I;  3S15 I;  1KQS Y;  2NVT I;  1ML8 A;  3OW2 Y;  3D2L A;  2R6M A;  4A3L I;  4A3C I;  3IF8 A;  2JR6 A;  2F4O A;  2RHB A;  3MZL B;  2IZ3 A;  2GTI A;  1ZH1 A;  2V8J A;  4NBE A;  3I56 1;  3S2H I;  4NBF A;  3IFU A;  5AN9 F;  3CCE Z;  3NH4 A;  1M1K 2;  2RPR A;  4NOZ A;  3PO3 I;  4BBS I;  1M90 1;  4E31 A;  1N8R 2;  2JIQ A;  1Y8C A;  4BXX I;  1Q86 2;  1YJN Z;  1VQN 1;  2JMO A;  1WZN A;  2QLV B;  1QF8 A;  4AYB A;  1VQ6 Z;  2P3Y A;  2IV2 X;  3FQM A;  3D6W A;  1YUA A;  2JIO A;  4A3I I;  1M1K 1;  3VB9 A;  4BY1 I;  1I3Q I;  3HOW I;  3S14 I;  2LIY A;  3ESW A;  1WCM I;  1RLY A;  1USP A;  1Q86 1;  1K9M 1;  1RQF A;  4A3G I;  1W2B Z;  3CME Z;  1S7M A;  4MD9 A;  4EWC A;  2VPW A;  3GTL I;  4NBA A;  1YJ9 Z;  3CCS 1;  4A3E I;  1Y1V S;  2JA7 I;  3CCL 1;  5IT9 f;  4NBC A;  2JIM A;  5T67 A;  2NAP A; 
#chains in the Genus database with same CATH homology
 2JUB A;  3VMG A;  2G2K A;  1K83 I;  2H85 A;  1QYP A;  4BBR I;  1VQ4 Z;  2QR1 B;  4RVF A;  4MON A;  2QEX Z;  3F3P C;  2EGT A;  4QTU A;  3NDJ A;  3RZD I;  3CCM Z;  4Y52 I;  1Q7Y 2;  4MRI A;  1JJ2 Y;  1VQL 1;  2QRD B;  4NB8 A;  2E2H I;  3H0G I;  3S17 I;  3I55 1;  2JA5 I;  3QWU A;  3BG1 B;  5LL6 f;  3U50 C;  3IX0 A;  4NBB A;  3CCJ 1;  3CCV Z;  1Q82 2;  1Z03 A;  3G6E 1;  1VQ9 Z;  3TDH B;  3S2D I;  4E2Y A;  2HU9 A;  1NP6 A;  3CCQ Z;  3G71 1;  3Q87 A;  2VUM I;  2DE7 A;  1TFI A;  1KC8 1;  1RO4 A;  2F4M A;  1P9N A;  3KIF A;  4XX2 A;  1YJW Z;  1TWH I;  4E2Z A;  3CCU 1;  2OTL 1;  1YIT 1;  3GTM I;  3K7A I;  2E2I I;  2O4H A;  1QVG Y;  2Q4Z A;  3HOX I;  1I50 I;  3I07 A;  5C4X I;  1VQP 1;  3CQZ I;  2ZAE B;  2PK7 A;  1VQ7 Z;  1Q81 1;  4E2W A;  4DQY B;  1Z02 A;  4QTT A;  5D1O A;  3EED A;  4NBH A;  2OTJ Z;  4A3K I;  4RV9 A;  5IP7 I;  4BY7 I;  3S16 I;  2DE6 A;  4DK1 A;  3F3F C;  2OZK A;  3VTN A;  3BG0 B;  3NDI A;  3J80 b;  1VQM 1;  2QA4 1;  2BJO A;  4NFR A;  1YHQ 1;  1YUK A;  4Y7N I;  3CC7 1;  1VQP Z;  3GTJ I;  2QEX 1;  1KQS Z;  2AKL A;  1VQM Z;  3CCQ 1;  4TNU A;  3D9X A;  2RT9 A;  3G4S Z;  3I56 Z;  5FLX f;  2DE5 A;  2J6A A;  1VQK 1;  4NH1 C;  3GTQ I;  2V8I A;  1TWG I;  2LFU A;  3HOZ I;  3G4S 1;  4RVH A;  5FLM I;  1VQ7 1;  4MXU A;  2OTJ 1;  1USP B;  2GTH A;  2P28 A;  5A2Q b;  3GKQ A;  3MON A;  1QVG Z;  1KRL A;  4HGY A;  1WII A;  3CD6 Z;  1YHQ Z;  1QVF Z;  3GTP I;  3JAM b;  1VQO 1;  4E32 A;  3J81 f;  3CMA 1;  2Y0S A;  3TE5 B;  3CPW Y;  1X3W A;  1Y1W I;  1LQL A;  3NH8 A;  4S1T A;  3CC4 1;  1KD1 1;  4RVD A;  2RIQ A;  2V8K A;  1VQ5 1;  2NVY I;  3CXC Z;  4RS4 A;  2R92 I;  4A3M I;  3CC7 Z;  1K9M 2;  3I4M I;  2PMZ A;  2E9H A;  2R7Z I;  1Y1V I;  3S1N I;  2W03 A;  3GTM S;  2E2J I;  2K5R A;  3G6E Z;  5C4J I;  4A93 I;  4E30 A;  2JA8 I;  3OW2 Z;  1TWF I;  3EER A;  1VQO Z;  3CXC Y;  4MD8 A;  1RO2 A;  2B63 I;  1ZB9 A;  3S1Q I;  4HGZ A;  3CCR 1;  4HH4 A;  4MH4 A;  1WW9 A;  3PO2 I;  1W2B Y;  3PO3 S;  1Q7Y 1;  3J81 b;  3CD6 1;  1VQ9 1;  3P5J B;  1Z01 A;  2YAD A;  3VMI A;  2KI7 B;  4NBG A;  4NB9 A;  1NJI 1;  3HOV I;  1N2F A;  3CPW Z;  5CM2 M;  3LUS A;  3CCL Z;  2JS4 A;  1VQ8 1;  2Q51 A;  2GU2 A;  2JNY A;  2OOX B;  1Q81 2;  3RZO I;  1VQ5 Z;  4CL1 A;  3CCE 1;  1M90 2;  2K3R A;  2VF1 A;  1N8R 1;  4E33 A;  2VUG A;  1NJI 2;  1VQN Z;  4A3J I;  4A3D I;  4DGL A;  1R9T I;  3NH5 A;  4NBD A;  3GTK I;  5T64 A;  1K8A 2;  1TWA I;  2QA4 Z;  1VLA A;  1VQ6 1;  4MD7 A;  3I55 Z;  3KIH A;  3G71 Z;  3CCR Z;  1YJ9 1;  3MZK B;  3J80 f;  5A2Q f;  1YIJ 1;  2M48 A;  3JAM f;  1YJW 1;  1JJ2 Z;  1YIT Z;  3FKI I;  1I6H I;  3T4N B;  1JWH C;  5IT9 b;  3S1M I;  3J7A 4;  3NFZ A;  3VMH A;  1NUI A;  2O53 A;  4E2X A;  3CMA Z;  1X3Z A;  3I4N I;  2KPI A;  4A3F I;  5FLX b;  1RO0 A;  4RVG A;  5D1O B;  2JA6 I;  4X6A I;  2PM9 A;  2QKD A;  1VQ8 Z;  1SFO I;  2YU9 I;  3M3Y I;  2M6N A;  3CCM 1;  2QRE B;  1L1O C;  4A3B I;  2WAQ A;  2QRC B;  5C3E I;  1RNI A;  2RBL A;  3GTO I;  5T6B A;  3CCS Z;  2HF1 A;  3M4O I;  3S1R I;  1QVF Y;  1K8A 1;  2W04 A;  1YI2 Z;  3FQQ A;  2R93 I;  1Q82 1;  1K73 2;  2IZ4 A;  3CCJ Z;  3CCV 1;  1VQ4 1;  1KD1 2;  2OOY B;  1X0T A;  1YIJ Z;  1YI2 1;  3CME 1;  1S72 1;  5D1P A;  5C44 I;  3GTG I;  1VQL Z;  1YJN 1;  1KC8 2;  1VQK Z;  5IP9 I;  1S72 Z;  3CC4 Z;  2WB1 A;  3HKZ A;  2NVQ I;  2I3C A;  1K73 1;  3CC2 1;  3HOU I;  1TWC I;  1PFT A;  3CCU Z;  2OTL Z;  3HOY I;  3GCF A;  1ZB8 A;  3CC2 Z;  1DL6 A;  2NVX I;  3S15 I;  1KQS Y;  2NVT I;  1ML8 A;  3OW2 Y;  2R6M A;  4A3L I;  4A3C I;  3IF8 A;  2JR6 A;  2F4O A;  2RHB A;  3MZL B;  2IZ3 A;  2GTI A;  1ZH1 A;  2V8J A;  4NBE A;  3I56 1;  3S2H I;  4NBF A;  3IFU A;  5AN9 F;  3CCE Z;  3NH4 A;  1M1K 2;  2RPR A;  4NOZ A;  3PO3 I;  4BBS I;  1M90 1;  4E31 A;  1N8R 2;  4BXX I;  1Q86 2;  1YJN Z;  1VQN 1;  2JMO A;  2QLV B;  1QF8 A;  4AYB A;  1VQ6 Z;  2P3Y A;  3FQM A;  3D6W A;  1YUA A;  4A3I I;  1M1K 1;  3VB9 A;  4BY1 I;  1I3Q I;  3HOW I;  3S14 I;  2LIY A;  3ESW A;  1WCM I;  1RLY A;  1USP A;  1Q86 1;  1K9M 1;  1RQF A;  4A3G I;  1W2B Z;  3CME Z;  1S7M A;  4MD9 A;  4EWC A;  3GTL I;  4NBA A;  1YJ9 Z;  3CCS 1;  4A3E I;  1Y1V S;  2JA7 I;  3CCL 1;  5IT9 f;  4NBC A;  5T67 A;  3H3V J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...