3S14I

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s14I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s14I02
5IP9I 4A3GI 3I07A 1TWCI 3GTJI 3HOUI 4XX2A 4A3KI 1R9TI 3CQZI 2BJOA 1X3ZA 1K83I 3S1MI 3PO3I 4NBFA 4A3II 3ESWA 1PFTA 2JS4A 3S14I 3I4NI 2NVTI 4BY7I 2HF1A 3GTQI 3GTOI 2R93I 4BXXI 3FKII 1TWGI 3S16I 5CM2M 3VB9A 3GTMI 1RLYA 2JA8I 2E2JI 1I6HI 4Y7NI 2NVXI 3H0GI 3S2DI 4QTUA 3H3VJ 1TWFI 4A3BI 2K5RA 4QTTA 2P3YA 2JR6A 4A3EI 3HOYI 2VUMI 1DL6A 3U50C 2RBLA 3VMGA 2JNYA 2NVYI 2DE5A 2NVQI 4A3FI 4A3JI 1SFOI 4A93I 3HOVI 3Q87A 1Y1VS 1TWHI 3S1QI 3M3YI 1Y1WI 3RZDI 3S1NI 2KPIA 4NBEA 2J6AA 3S15I 4NBDA 4Y52I 1RO4A 2E2HI 3S1RI 4NBBA 1QYPA 1N2FA 2PK7A 3VMHA 3RZOI 5FLMI 4A3DI 1VLAA 3GTGI 3PO3S 4MH4A 4NB9A 2DE6A 2F4MA 2JA7I 3I4MI 1ZB9A 3GTKI 2YU9I 1I50I 4X6AI 1ZB8A 2DE7A 5C4XI 2JA6I 4BY1I 5C3EI 5C4JI 4A3CI 3GTMS 3HOXI 1ML8A 5C44I 1NUIA 3K7AI 3HOZI 3GTLI 2F4OA 2E2II 3M4OI 1LQLA 2R7ZI 4NBAA 3PO2I 3LUSA 1TFIA 2B63I 2R92I 3GTPI 4BBRI 5IP7I 3S2HI 2AKLA 1X3WA 4NBCA 3HOWI 4BBSI 1L1OC 1USPB 2JA5I 4NOZA 3VMIA 3D6WA 3GKQA 4A3MI 1TWAI 4A3LI 1WW9A 1Y1VI 4NBGA 3S17I 1WCMI 1I3QI 1YUAA 4NBHA 3GCFA 4NB8A 1USPA 3EERA
chains in the Genus database with same CATH superfamily
1RNIA 1Z01A 2ZAEB 1R9TI 1M901 3PO3I 3T4NB 3I4NI 2QA4Z 3CCRZ 3CCQZ 3GTOI 3I55Z 3OW2Y 3CMEZ 3CMAZ 4BXXI 4RVFA 3FKII 1W2BY 2NAPA 1X0TA 2OOYB 3TE5B 2NVXI 3S2DI 4RVGA 2GTHA 3CC41 2VUMI 1VQO1 3G4S1 5D1PA 3BG0B 2RBLA 3VMGA 1YITZ 4A3FI 4A3JI 1SFOI 2VF1A 3CC7Z 2JMOA 3M3YI 3G71Z 1RO2A 2QR1B 2KPIA 2V8JA 2E2HI 1N2FA 1WZNA 4A3DI 4DQYB 1VLAA 3GTGI 3CCR1 2YADA 4E31A 3KIFA 3CCQ1 1VQ9Z 2F4MA 3I551 3CME1 3CMA1 1VQMZ 2HU9A 2G2KA 3CXCZ 1W2BZ 3J81b 5C3EI 1M1K2 1JJ2Z 1YJWZ 4A3CI 3HKZA 2VUGA 4EWCA 3J81f 3HOZI 3GTLI 4NBAA 2OTJZ 1P9NA 3PO2I 1YJNZ 2GU2A 1K9M2 2KI7B 1K8A2 5IP7I 3IF8A 1N8R1 1YIT1 3MZLB 3J80b 3CC71 4MXUA 3J80f 3G711 2E7ZA 2IZ4A 5FLXf 5LL6f 4A3MI 3CCMZ 1I3QI 4NBHA 4NB8A 4CL1A 3MZKB 5IP9I 3NDIA 3I07A 1TWCI 3GTJI 3HOUI 4XX2A 5A2Qb 1VQM1 2P28A 2IZ3A 1X3ZA 1K83I 1YHQZ 3CPWZ 4NBFA 1YJW1 3ESWA 4RS4A 3S14I 5A2Qf 2Y0SA 3G4SZ 2NVTI 3JAMb 2WB1A 4S1TA 3GTQI 4HGZA 3CCVZ 3S16I 1M902 5CM2M 2OTJ1 3VB9A 3G6EZ 1YJN1 2JA8I 2I3CA 4E32A 3H0GI 2QRCB 3CCJZ 4A3BI 2JNYA 1KQSY 3FQQA 4NH1C 4A93I 1Y8CA 3HOVI 2OOXB 3CCM1 4HH4A 1TWHI 2K3RA 1QVGZ 3S15I 1KD11 3FQMA 1ZH1A 3S1RI 1WJ2A 2O4HA 1YHQ1 4NB9A 1QVFZ 1NJI1 2E9HA 2WAQA 3I4MI 1I50I 1JWHC 1K731 1ZB8A 2DE7A 2H85A 3CCV1 5C4JI 3G6E1 3HOXI 4MD7A 1VQN1 4DK1A 2JIOA 2F4OA 4E33A 1KRLA 1Q811 1LQLA 3CCJ1 3J7A4 2M48A 3D9XA 1FDOA 1TFIA 4AYBA 1S7MA 1AA6A 3S2HI 2AKLA 4NBCA 3D2LA 4NFRA 3OW2Z 2VPXA 2JA5I 4E30A 2IV2X 2LIYA 1N8R2 1WW9A 3CCEZ 4NBGA 3CC2Z 4A3GI 1QXFA 5D1OA 1VQ6Z 2W03A 2BJOA 2QREB 2VPYA 4A3II 1RO0A 2JS4A 2AYDA 1VQ51 2V8IA 5AN9F 5FLXb 1S72Z 3EEDA 1NP6A 1TWGI 2EGTA 3CCLZ 1VQ7Z 2E2JI 4Y7NI 1Q821 2Q4ZA 5T6BA 1M1K1 4MD9A 3HOYI 2P3YA 2JR6A 1QF8A 1FDIA 3U50C 1Q16A 5T64A 2PMZA 3Q87A 3CCE1 2QEXZ 1Q7Y1 2JIRA 3IFUA 3RZDI 1Y1WI 3CC21 1VQPZ 4NBEA 2JIPA 2J6AA 1Q861 4NBDA 1RO4A 3NH8A 1VQLZ 2QKDA 1VQNZ 4NBBA 3CCSZ 3RZOI 2PK7A 3VMHA 1VQ61 4MH4A 3QWUA 2LEXA 2RIQA 2DE6A 2JA7I 1ZB9A 3GTKI 2YU9I 1S721 1SIWA 4X6AI 2JA6I 3CCL1 4MRIA 1VQ71 3GTMS 1ML8A 5C44I 1KC81 1NUIA 2GTIA 1NJI2 3M4OI 2R7ZI 1K732 1YI21 3I56Z 3LUSA 2B63I 3GTPI 4HGYA 1YUKA 3IX0A 1X3WA 1Q812 1VQKZ 2QEX1 3NH5A 1VQP1 4NOZA 5D1OB 3D6WA 1VQL1 3CXCY 3GKQA 2RHBA 3CCS1 1JJ2Y 3VTNA 1VQ5Z 1WCMI 1YUAA 4E2YA 3GCFA 1USPA 2W04A 3CD6Z 2V45A 1KQSZ 4MONA 4A3KI 3CQZI 3NH4A 3S1MI 2JIMA 4RVDA 1PFTA 3NDJA 4BY7I 2HF1A 2OZKA 2OTLZ 2R93I 1VQ8Z 3NFZA 3I561 3GTMI 1RLYA 1I6HI 4QTUA 3TDHB 3H3VJ 2PM9A 1TWFI 2K5RA 4QTTA 4A3EI 1VQ4Z 1VQK1 1DL6A 2QA41 1YJ9Z 1WIIA 2NVYI 2DE5A 2NVQI 2V8KA 4TNUA 1Q822 3CPWY 2V3VA 2Q51A 1Y1VS 3S1QI 3S1NI 4Y52I 3CD61 4RVHA 4E2WA 3P5JB 1YIJZ 1QYPA 2QLVB 5FLMI 3KIHA 3PO3S 1Q7Y2 3CCUZ 3F3FC 2JUBA 1YI2Z 1Q862 2OTL1 2RT9A 2VPWA 1VQ81 5C4XI 4BY1I 3IR7A 1K9M1 1K8A1 1Z03A 4DGLA 1RQFA 2LFUA 3K7AI 4RV9A 2E2II 2VPZA 1VQ41 4MD8A 2JIQA 1YJ91 4E2ZA 1QVGY 4E2XA 1VQ91 2R92I 3MONA 4BBRI 1KC82 2RPRA 3CC4Z 3HOWI 4BBSI 1L1OC 1VQOZ 1USPB 5IT9b 1Z02A 1KD12 1QVFY 2R6MA 3VMIA 5IT9f 2M6NA 2O53A 3JAMf 1YIJ1 1TWAI 4A3LI 1Y1VI 3S17I 2QRDB 3CCU1 3BG1B 3EERA 3F3PC 5T67A
chains in the Genus database with same CATH topology
1RNIA 1Z01A 2ZAEB 1R9TI 1M901 3PO3I 3T4NB 3I4NI 2QA4Z 3CCRZ 3CCQZ 3GTOI 3I55Z 3OW2Y 3CMEZ 3CMAZ 4BXXI 4RVFA 3FKII 1W2BY 2OOYB 1X0TA 3TE5B 2NVXI 3S2DI 4RVGA 2GTHA 3CC41 2VUMI 1VQO1 3G4S1 5D1PA 3BG0B 2RBLA 3VMGA 1YITZ 4A3FI 4A3JI 1SFOI 2VF1A 3CC7Z 2JMOA 3M3YI 3G71Z 1RO2A 2QR1B 2KPIA 2V8JA 2E2HI 1N2FA 4A3DI 4DQYB 1VLAA 3GTGI 3CCR1 2YADA 4E31A 3KIFA 3CCQ1 1VQ9Z 2F4MA 3I551 3CME1 3CMA1 1VQMZ 2HU9A 2G2KA 3CXCZ 1W2BZ 3J81b 5C3EI 1M1K2 1JJ2Z 1YJWZ 4A3CI 3HKZA 2VUGA 4EWCA 3J81f 3HOZI 3GTLI 4NBAA 2OTJZ 1P9NA 3PO2I 1YJNZ 2GU2A 1K9M2 2KI7B 1K8A2 5IP7I 3IF8A 1N8R1 1YIT1 3MZLB 3J80b 3CC71 4MXUA 3J80f 3G711 2IZ4A 5FLXf 5LL6f 4A3MI 3CCMZ 1I3QI 4NBHA 4NB8A 4CL1A 3MZKB 5IP9I 3NDIA 3I07A 1TWCI 3GTJI 3HOUI 4XX2A 5A2Qb 1VQM1 2P28A 2IZ3A 1X3ZA 1K83I 1YHQZ 3CPWZ 4NBFA 1YJW1 3ESWA 4RS4A 3S14I 5A2Qf 2Y0SA 3G4SZ 2NVTI 3JAMb 2WB1A 4S1TA 3GTQI 4HGZA 3CCVZ 3S16I 1M902 5CM2M 2OTJ1 3VB9A 3G6EZ 1YJN1 2JA8I 2I3CA 4E32A 3H0GI 2QRCB 3CCJZ 4A3BI 2JNYA 1KQSY 3FQQA 4NH1C 4A93I 3HOVI 2OOXB 3CCM1 4HH4A 1TWHI 2K3RA 1QVGZ 3S15I 1KD11 3FQMA 1ZH1A 3S1RI 2O4HA 1YHQ1 4NB9A 1QVFZ 1NJI1 2E9HA 2WAQA 3I4MI 1I50I 1JWHC 1K731 1ZB8A 2DE7A 2H85A 3CCV1 5C4JI 3G6E1 3HOXI 4MD7A 1VQN1 4DK1A 2F4OA 4E33A 1KRLA 1Q811 1LQLA 3CCJ1 3J7A4 2M48A 3D9XA 1TFIA 4AYBA 1S7MA 3S2HI 2AKLA 4NBCA 4NFRA 3OW2Z 2JA5I 4E30A 2LIYA 1N8R2 1WW9A 3CCEZ 4NBGA 3CC2Z 4A3GI 5D1OA 1VQ6Z 2W03A 2BJOA 2QREB 4A3II 1RO0A 2JS4A 1VQ51 2V8IA 5AN9F 5FLXb 1S72Z 3EEDA 1NP6A 1TWGI 2EGTA 3CCLZ 1VQ7Z 2E2JI 4Y7NI 1Q821 2Q4ZA 5T6BA 1M1K1 4MD9A 3HOYI 2P3YA 2JR6A 1QF8A 3U50C 5T64A 2PMZA 3Q87A 3CCE1 2QEXZ 1Q7Y1 3IFUA 3RZDI 1Y1WI 3CC21 1VQPZ 4NBEA 2J6AA 1Q861 4NBDA 1RO4A 3NH8A 1VQLZ 2QKDA 1VQNZ 4NBBA 3CCSZ 3RZOI 2PK7A 3VMHA 1VQ61 4MH4A 3QWUA 2RIQA 2DE6A 2JA7I 1ZB9A 3GTKI 2YU9I 1S721 4X6AI 2JA6I 3CCL1 4MRIA 1VQ71 3GTMS 1ML8A 5C44I 1KC81 1NUIA 2GTIA 1NJI2 3M4OI 2R7ZI 1K732 1YI21 3I56Z 3LUSA 2B63I 3GTPI 4HGYA 1YUKA 3IX0A 1X3WA 1Q812 1VQKZ 2QEX1 3NH5A 1VQP1 4NOZA 5D1OB 3D6WA 1VQL1 3CXCY 3GKQA 2RHBA 3CCS1 1JJ2Y 3VTNA 1VQ5Z 1WCMI 1YUAA 4E2YA 3GCFA 1USPA 2W04A 3CD6Z 1KQSZ 4MONA 4A3KI 3CQZI 3NH4A 3S1MI 4RVDA 1PFTA 3NDJA 4BY7I 2HF1A 2OZKA 2OTLZ 2R93I 1VQ8Z 3NFZA 3I561 3GTMI 1RLYA 1I6HI 4QTUA 3TDHB 3H3VJ 2PM9A 1TWFI 2K5RA 4QTTA 4A3EI 1VQ4Z 1VQK1 1DL6A 2QA41 1YJ9Z 1WIIA 2NVYI 2DE5A 2NVQI 2V8KA 4TNUA 1Q822 3CPWY 2Q51A 1Y1VS 3S1QI 3S1NI 4Y52I 3CD61 4RVHA 4E2WA 3P5JB 1YIJZ 1QYPA 2QLVB 5FLMI 3KIHA 3PO3S 1Q7Y2 3CCUZ 3F3FC 2JUBA 1YI2Z 1Q862 2OTL1 2RT9A 1VQ81 5C4XI 4BY1I 1K9M1 1K8A1 1Z03A 4DGLA 1RQFA 2LFUA 3K7AI 4RV9A 2E2II 1VQ41 4MD8A 1YJ91 1QVGY 4E2ZA 4E2XA 1VQ91 2R92I 3MONA 4BBRI 1KC82 2RPRA 3CC4Z 3HOWI 4BBSI 1L1OC 1VQOZ 1USPB 5IT9b 1Z02A 1KD12 1QVFY 2R6MA 3VMIA 5IT9f 2M6NA 2O53A 3JAMf 1YIJ1 1TWAI 4A3LI 1Y1VI 3S17I 2QRDB 3CCU1 3BG1B 3EERA 3F3PC 5T67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP9 I;  4A3G I;  3I07 A;  1TWC I;  3GTJ I;  3HOU I;  4XX2 A;  4A3K I;  1R9T I;  3CQZ I;  2BJO A;  1X3Z A;  1K83 I;  3S1M I;  3PO3 I;  4NBF A;  4A3I I;  3ESW A;  1PFT A;  2JS4 A;  3S14 I;  3I4N I;  2NVT I;  4BY7 I;  2HF1 A;  3GTQ I;  3GTO I;  2R93 I;  4BXX I;  3FKI I;  1TWG I;  3S16 I;  5CM2 M;  3VB9 A;  3GTM I;  1RLY A;  2JA8 I;  2E2J I;  1I6H I;  4Y7N I;  2NVX I;  3H0G I;  3S2D I;  4QTU A;  3H3V J;  1TWF I;  4A3B I;  2K5R A;  4QTT A;  2P3Y A;  2JR6 A;  4A3E I;  3HOY I;  2VUM I;  1DL6 A;  3U50 C;  2RBL A;  3VMG A;  2JNY A;  2NVY I;  2DE5 A;  2NVQ I;  4A3F I;  4A3J I;  1SFO I;  4A93 I;  3HOV I;  3Q87 A;  1Y1V S;  1TWH I;  3S1Q I;  3M3Y I;  1Y1W I;  3RZD I;  3S1N I;  2KPI A;  4NBE A;  2J6A A;  3S15 I;  4NBD A;  4Y52 I;  1RO4 A;  2E2H I;  3S1R I;  4NBB A;  1QYP A;  1N2F A;  2PK7 A;  3VMH A;  3RZO I;  5FLM I;  4A3D I;  1VLA A;  3GTG I;  3PO3 S;  4MH4 A;  4NB9 A;  2DE6 A;  2F4M A;  2JA7 I;  3I4M I;  1ZB9 A;  3GTK I;  2YU9 I;  1I50 I;  4X6A I;  1ZB8 A;  2DE7 A;  5C4X I;  2JA6 I;  4BY1 I;  5C3E I;  5C4J I;  4A3C I;  3GTM S;  3HOX I;  1ML8 A;  5C44 I;  1NUI A;  3K7A I;  3HOZ I;  3GTL I;  2F4O A;  2E2I I;  3M4O I;  1LQL A;  2R7Z I;  4NBA A;  3PO2 I;  3LUS A;  1TFI A;  2B63 I;  2R92 I;  3GTP I;  4BBR I;  5IP7 I;  3S2H I;  2AKL A;  1X3W A;  4NBC A;  3HOW I;  4BBS I;  1L1O C;  1USP B;  2JA5 I;  4NOZ A;  3VMI A;  3D6W A;  3GKQ A;  4A3M I;  1TWA I;  4A3L I;  1WW9 A;  1Y1V I;  4NBG A;  3S17 I;  1WCM I;  1I3Q I;  1YUA A;  4NBH A;  3GCF A;  4NB8 A;  1USP A;  3EER A; 
#chains in the Genus database with same CATH topology
 1RNI A;  1Z01 A;  2ZAE B;  1R9T I;  1M90 1;  3PO3 I;  3T4N B;  3I4N I;  2QA4 Z;  3CCR Z;  3CCQ Z;  3GTO I;  3I55 Z;  3OW2 Y;  3CME Z;  3CMA Z;  4BXX I;  4RVF A;  3FKI I;  1W2B Y;  2NAP A;  1X0T A;  2OOY B;  3TE5 B;  2NVX I;  3S2D I;  4RVG A;  2GTH A;  3CC4 1;  2VUM I;  1VQO 1;  3G4S 1;  5D1P A;  3BG0 B;  2RBL A;  3VMG A;  1YIT Z;  4A3F I;  4A3J I;  1SFO I;  2VF1 A;  3CC7 Z;  2JMO A;  3M3Y I;  3G71 Z;  1RO2 A;  2QR1 B;  2KPI A;  2V8J A;  2E2H I;  1N2F A;  1WZN A;  4A3D I;  4DQY B;  1VLA A;  3GTG I;  3CCR 1;  2YAD A;  4E31 A;  3KIF A;  3CCQ 1;  1VQ9 Z;  2F4M A;  3I55 1;  3CME 1;  3CMA 1;  1VQM Z;  2HU9 A;  2G2K A;  3CXC Z;  1W2B Z;  3J81 b;  5C3E I;  1M1K 2;  1JJ2 Z;  1YJW Z;  4A3C I;  3HKZ A;  2VUG A;  4EWC A;  3J81 f;  3HOZ I;  3GTL I;  4NBA A;  2OTJ Z;  1P9N A;  3PO2 I;  1YJN Z;  2GU2 A;  1K9M 2;  2KI7 B;  1K8A 2;  5IP7 I;  3IF8 A;  1N8R 1;  1YIT 1;  3MZL B;  3J80 b;  3CC7 1;  4MXU A;  3J80 f;  3G71 1;  2E7Z A;  2IZ4 A;  5FLX f;  5LL6 f;  4A3M I;  3CCM Z;  1I3Q I;  4NBH A;  4NB8 A;  4CL1 A;  3MZK B;  5IP9 I;  3NDI A;  3I07 A;  1TWC I;  3GTJ I;  3HOU I;  4XX2 A;  5A2Q b;  1VQM 1;  2P28 A;  2IZ3 A;  1X3Z A;  1K83 I;  1YHQ Z;  3CPW Z;  4NBF A;  1YJW 1;  3ESW A;  4RS4 A;  3S14 I;  5A2Q f;  2Y0S A;  3G4S Z;  2NVT I;  3JAM b;  2WB1 A;  4S1T A;  3GTQ I;  4HGZ A;  3CCV Z;  3S16 I;  1M90 2;  5CM2 M;  2OTJ 1;  3VB9 A;  3G6E Z;  1YJN 1;  2JA8 I;  2I3C A;  4E32 A;  3H0G I;  2QRC B;  3CCJ Z;  4A3B I;  2JNY A;  1KQS Y;  3FQQ A;  4NH1 C;  4A93 I;  1Y8C A;  3HOV I;  2OOX B;  3CCM 1;  4HH4 A;  1TWH I;  2K3R A;  1QVG Z;  3S15 I;  1KD1 1;  3FQM A;  1ZH1 A;  3S1R I;  1WJ2 A;  2O4H A;  1YHQ 1;  4NB9 A;  1QVF Z;  1NJI 1;  2E9H A;  2WAQ A;  3I4M I;  1I50 I;  1JWH C;  1K73 1;  1ZB8 A;  2DE7 A;  2H85 A;  3CCV 1;  5C4J I;  3G6E 1;  3HOX I;  4MD7 A;  1VQN 1;  4DK1 A;  2JIO A;  2F4O A;  4E33 A;  1KRL A;  1Q81 1;  1LQL A;  3CCJ 1;  3J7A 4;  2M48 A;  3D9X A;  1FDO A;  1TFI A;  4AYB A;  1S7M A;  1AA6 A;  3S2H I;  2AKL A;  4NBC A;  3D2L A;  4NFR A;  3OW2 Z;  2VPX A;  2JA5 I;  4E30 A;  2IV2 X;  2LIY A;  1N8R 2;  1WW9 A;  3CCE Z;  4NBG A;  3CC2 Z;  4A3G I;  1QXF A;  5D1O A;  1VQ6 Z;  2W03 A;  2BJO A;  2QRE B;  2VPY A;  4A3I I;  1RO0 A;  2JS4 A;  2AYD A;  1VQ5 1;  2V8I A;  5AN9 F;  5FLX b;  1S72 Z;  3EED A;  1NP6 A;  1TWG I;  2EGT A;  3CCL Z;  1VQ7 Z;  2E2J I;  4Y7N I;  1Q82 1;  2Q4Z A;  5T6B A;  1M1K 1;  4MD9 A;  3HOY I;  2P3Y A;  2JR6 A;  1QF8 A;  1FDI A;  3U50 C;  1Q16 A;  5T64 A;  2PMZ A;  3Q87 A;  3CCE 1;  2QEX Z;  1Q7Y 1;  2JIR A;  3IFU A;  3RZD I;  1Y1W I;  3CC2 1;  1VQP Z;  4NBE A;  2JIP A;  2J6A A;  1Q86 1;  4NBD A;  1RO4 A;  3NH8 A;  1VQL Z;  2QKD A;  1VQN Z;  4NBB A;  3CCS Z;  3RZO I;  2PK7 A;  3VMH A;  1VQ6 1;  4MH4 A;  3QWU A;  2LEX A;  2RIQ A;  2DE6 A;  2JA7 I;  1ZB9 A;  3GTK I;  2YU9 I;  1S72 1;  1SIW A;  4X6A I;  2JA6 I;  3CCL 1;  4MRI A;  1VQ7 1;  3GTM S;  1ML8 A;  5C44 I;  1KC8 1;  1NUI A;  2GTI A;  1NJI 2;  3M4O I;  2R7Z I;  1K73 2;  1YI2 1;  3I56 Z;  3LUS A;  2B63 I;  3GTP I;  4HGY A;  1YUK A;  3IX0 A;  1X3W A;  1Q81 2;  1VQK Z;  2QEX 1;  3NH5 A;  1VQP 1;  4NOZ A;  5D1O B;  3D6W A;  1VQL 1;  3CXC Y;  3GKQ A;  2RHB A;  3CCS 1;  1JJ2 Y;  3VTN A;  1VQ5 Z;  1WCM I;  1YUA A;  4E2Y A;  3GCF A;  1USP A;  2W04 A;  3CD6 Z;  2V45 A;  1KQS Z;  4MON A;  4A3K I;  3CQZ I;  3NH4 A;  3S1M I;  2JIM A;  4RVD A;  1PFT A;  3NDJ A;  4BY7 I;  2HF1 A;  2OZK A;  2OTL Z;  2R93 I;  1VQ8 Z;  3NFZ A;  3I56 1;  3GTM I;  1RLY A;  1I6H I;  4QTU A;  3TDH B;  3H3V J;  2PM9 A;  1TWF I;  2K5R A;  4QTT A;  4A3E I;  1VQ4 Z;  1VQK 1;  1DL6 A;  2QA4 1;  1YJ9 Z;  1WII A;  2NVY I;  2DE5 A;  2NVQ I;  2V8K A;  4TNU A;  1Q82 2;  3CPW Y;  2V3V A;  2Q51 A;  1Y1V S;  3S1Q I;  3S1N I;  4Y52 I;  3CD6 1;  4RVH A;  4E2W A;  3P5J B;  1YIJ Z;  1QYP A;  2QLV B;  5FLM I;  3KIH A;  3PO3 S;  1Q7Y 2;  3CCU Z;  3F3F C;  2JUB A;  1YI2 Z;  1Q86 2;  2OTL 1;  2RT9 A;  2VPW A;  1VQ8 1;  5C4X I;  4BY1 I;  3IR7 A;  1K9M 1;  1K8A 1;  1Z03 A;  4DGL A;  1RQF A;  2LFU A;  3K7A I;  4RV9 A;  2E2I I;  2VPZ A;  1VQ4 1;  4MD8 A;  2JIQ A;  1YJ9 1;  4E2Z A;  1QVG Y;  4E2X A;  1VQ9 1;  2R92 I;  3MON A;  4BBR I;  1KC8 2;  2RPR A;  3CC4 Z;  3HOW I;  4BBS I;  1L1O C;  1VQO Z;  1USP B;  5IT9 b;  1Z02 A;  1KD1 2;  1QVF Y;  2R6M A;  3VMI A;  5IT9 f;  2M6N A;  2O53 A;  3JAM f;  1YIJ 1;  1TWA I;  4A3L I;  1Y1V I;  3S17 I;  2QRD B;  3CCU 1;  3BG1 B;  3EER A;  3F3P C;  5T67 A; 
#chains in the Genus database with same CATH homology
 1RNI A;  1Z01 A;  2ZAE B;  1R9T I;  1M90 1;  3PO3 I;  3T4N B;  3I4N I;  2QA4 Z;  3CCR Z;  3CCQ Z;  3GTO I;  3I55 Z;  3OW2 Y;  3CME Z;  3CMA Z;  4BXX I;  4RVF A;  3FKI I;  1W2B Y;  2OOY B;  1X0T A;  3TE5 B;  2NVX I;  3S2D I;  4RVG A;  2GTH A;  3CC4 1;  2VUM I;  1VQO 1;  3G4S 1;  5D1P A;  3BG0 B;  2RBL A;  3VMG A;  1YIT Z;  4A3F I;  4A3J I;  1SFO I;  2VF1 A;  3CC7 Z;  2JMO A;  3M3Y I;  3G71 Z;  1RO2 A;  2QR1 B;  2KPI A;  2V8J A;  2E2H I;  1N2F A;  4A3D I;  4DQY B;  1VLA A;  3GTG I;  3CCR 1;  2YAD A;  4E31 A;  3KIF A;  3CCQ 1;  1VQ9 Z;  2F4M A;  3I55 1;  3CME 1;  3CMA 1;  1VQM Z;  2HU9 A;  2G2K A;  3CXC Z;  1W2B Z;  3J81 b;  5C3E I;  1M1K 2;  1JJ2 Z;  1YJW Z;  4A3C I;  3HKZ A;  2VUG A;  4EWC A;  3J81 f;  3HOZ I;  3GTL I;  4NBA A;  2OTJ Z;  1P9N A;  3PO2 I;  1YJN Z;  2GU2 A;  1K9M 2;  2KI7 B;  1K8A 2;  5IP7 I;  3IF8 A;  1N8R 1;  1YIT 1;  3MZL B;  3J80 b;  3CC7 1;  4MXU A;  3J80 f;  3G71 1;  2IZ4 A;  5FLX f;  5LL6 f;  4A3M I;  3CCM Z;  1I3Q I;  4NBH A;  4NB8 A;  4CL1 A;  3MZK B;  5IP9 I;  3NDI A;  3I07 A;  1TWC I;  3GTJ I;  3HOU I;  4XX2 A;  5A2Q b;  1VQM 1;  2P28 A;  2IZ3 A;  1X3Z A;  1K83 I;  1YHQ Z;  3CPW Z;  4NBF A;  1YJW 1;  3ESW A;  4RS4 A;  3S14 I;  5A2Q f;  2Y0S A;  3G4S Z;  2NVT I;  3JAM b;  2WB1 A;  4S1T A;  3GTQ I;  4HGZ A;  3CCV Z;  3S16 I;  1M90 2;  5CM2 M;  2OTJ 1;  3VB9 A;  3G6E Z;  1YJN 1;  2JA8 I;  2I3C A;  4E32 A;  3H0G I;  2QRC B;  3CCJ Z;  4A3B I;  2JNY A;  1KQS Y;  3FQQ A;  4NH1 C;  4A93 I;  3HOV I;  2OOX B;  3CCM 1;  4HH4 A;  1TWH I;  2K3R A;  1QVG Z;  3S15 I;  1KD1 1;  3FQM A;  1ZH1 A;  3S1R I;  2O4H A;  1YHQ 1;  4NB9 A;  1QVF Z;  1NJI 1;  2E9H A;  2WAQ A;  3I4M I;  1I50 I;  1JWH C;  1K73 1;  1ZB8 A;  2DE7 A;  2H85 A;  3CCV 1;  5C4J I;  3G6E 1;  3HOX I;  4MD7 A;  1VQN 1;  4DK1 A;  2F4O A;  4E33 A;  1KRL A;  1Q81 1;  1LQL A;  3CCJ 1;  3J7A 4;  2M48 A;  3D9X A;  1TFI A;  4AYB A;  1S7M A;  3S2H I;  2AKL A;  4NBC A;  4NFR A;  3OW2 Z;  2JA5 I;  4E30 A;  2LIY A;  1N8R 2;  1WW9 A;  3CCE Z;  4NBG A;  3CC2 Z;  4A3G I;  5D1O A;  1VQ6 Z;  2W03 A;  2BJO A;  2QRE B;  4A3I I;  1RO0 A;  2JS4 A;  1VQ5 1;  2V8I A;  5AN9 F;  5FLX b;  1S72 Z;  3EED A;  1NP6 A;  1TWG I;  2EGT A;  3CCL Z;  1VQ7 Z;  2E2J I;  4Y7N I;  1Q82 1;  2Q4Z A;  5T6B A;  1M1K 1;  4MD9 A;  3HOY I;  2P3Y A;  2JR6 A;  1QF8 A;  3U50 C;  5T64 A;  2PMZ A;  3Q87 A;  3CCE 1;  2QEX Z;  1Q7Y 1;  3IFU A;  3RZD I;  1Y1W I;  3CC2 1;  1VQP Z;  4NBE A;  2J6A A;  1Q86 1;  4NBD A;  1RO4 A;  3NH8 A;  1VQL Z;  2QKD A;  1VQN Z;  4NBB A;  3CCS Z;  3RZO I;  2PK7 A;  3VMH A;  1VQ6 1;  4MH4 A;  3QWU A;  2RIQ A;  2DE6 A;  2JA7 I;  1ZB9 A;  3GTK I;  2YU9 I;  1S72 1;  4X6A I;  2JA6 I;  3CCL 1;  4MRI A;  1VQ7 1;  3GTM S;  1ML8 A;  5C44 I;  1KC8 1;  1NUI A;  2GTI A;  1NJI 2;  3M4O I;  2R7Z I;  1K73 2;  1YI2 1;  3I56 Z;  3LUS A;  2B63 I;  3GTP I;  4HGY A;  1YUK A;  3IX0 A;  1X3W A;  1Q81 2;  1VQK Z;  2QEX 1;  3NH5 A;  1VQP 1;  4NOZ A;  5D1O B;  3D6W A;  1VQL 1;  3CXC Y;  3GKQ A;  2RHB A;  3CCS 1;  1JJ2 Y;  3VTN A;  1VQ5 Z;  1WCM I;  1YUA A;  4E2Y A;  3GCF A;  1USP A;  2W04 A;  3CD6 Z;  1KQS Z;  4MON A;  4A3K I;  3CQZ I;  3NH4 A;  3S1M I;  4RVD A;  1PFT A;  3NDJ A;  4BY7 I;  2HF1 A;  2OZK A;  2OTL Z;  2R93 I;  1VQ8 Z;  3NFZ A;  3I56 1;  3GTM I;  1RLY A;  1I6H I;  4QTU A;  3TDH B;  3H3V J;  2PM9 A;  1TWF I;  2K5R A;  4QTT A;  4A3E I;  1VQ4 Z;  1VQK 1;  1DL6 A;  2QA4 1;  1YJ9 Z;  1WII A;  2NVY I;  2DE5 A;  2NVQ I;  2V8K A;  4TNU A;  1Q82 2;  3CPW Y;  2Q51 A;  1Y1V S;  3S1Q I;  3S1N I;  4Y52 I;  3CD6 1;  4RVH A;  4E2W A;  3P5J B;  1YIJ Z;  1QYP A;  2QLV B;  5FLM I;  3KIH A;  3PO3 S;  1Q7Y 2;  3CCU Z;  3F3F C;  2JUB A;  1YI2 Z;  1Q86 2;  2OTL 1;  2RT9 A;  1VQ8 1;  5C4X I;  4BY1 I;  1K9M 1;  1K8A 1;  1Z03 A;  4DGL A;  1RQF A;  2LFU A;  3K7A I;  4RV9 A;  2E2I I;  1VQ4 1;  4MD8 A;  1YJ9 1;  1QVG Y;  4E2Z A;  4E2X A;  1VQ9 1;  2R92 I;  3MON A;  4BBR I;  1KC8 2;  2RPR A;  3CC4 Z;  3HOW I;  4BBS I;  1L1O C;  1VQO Z;  1USP B;  5IT9 b;  1Z02 A;  1KD1 2;  1QVF Y;  2R6M A;  3VMI A;  5IT9 f;  2M6N A;  2O53 A;  3JAM f;  1YIJ 1;  1TWA I;  4A3L I;  1Y1V I;  3S17 I;  2QRD B;  3CCU 1;  3BG1 B;  3EER A;  3F3P C;  5T67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...