3S14I

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s14I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s14I02
1RO4A 1TWFI 2BJOA 2JA8I 1USPA 2NVTI 1PFTA 3RZOI 3VMIA 2AKLA 3GTKI 1ZB9A 3S1MI 1USPB 3HOXI 1TWCI 4A3LI 1ML8A 4MH4A 4NB9A 3M4OI 1TWHI 3S1RI 1LQLA 3PO3I 2E2JI 3S2HI 2NVXI 1I6HI 1TFIA 2DE7A 5C44I 4Y7NI 3M3YI 4NBCA 3GTLI 2B63I 3HOYI 2F4OA 3GKQA 4BY7I 5IP9I 2P3YA 4A3FI 2R7ZI 3PO2I 3GTOI 3GTMS 3GTJI 3S15I 3VB9A 1TWAI 5C4JI 2JS4A 3I07A 4QTUA 4NOZA 3VMHA 1TWGI 1Y1VS 2PK7A 4A3CI 4A3DI 1DL6A 2JR6A 2K5RA 2HF1A 1K83I 1WW9A 2NVQI 2J6AA 3S1QI 4QTTA 3HOUI 3D6WA 1N2FA 1RLYA 3RZDI 3K7AI 2E2HI 3H0GI 3HOVI 3S1NI 3GTMI 1QYPA 3Q87A 3I4NI 4NBGA 5IP7I 1ZB8A 1NUIA 3CQZI 4A93I 2DE5A 4BBRI 2VUMI 3S2DI 4BY1I 2YU9I 1Y1VI 3ESWA 1Y1WI 3EERA 2JA7I 4A3BI 1I50I 4NBEA 3VMGA 3S16I 4NBAA 1SFOI 1YUAA 1VLAA 3GTGI 1I3QI 4NBHA 5C4XI 4X6AI 5FLMI 2JNYA 2DE6A 4A3MI 4A3GI 3FKII 3U50C 4A3EI 2KPIA 4Y52I 3H3VJ 1X3ZA 4A3II 4A3KI 4BXXI 3S14I 4BBSI 4NBDA 5CM2M 3LUSA 2R93I 1R9TI 2RBLA 2JA6I 3I4MI 5C3EI 3GCFA 4A3JI 4NB8A 2R92I 2F4MA 3GTQI 3HOZI 3PO3S 1L1OC 4NBFA 3GTPI 3S17I 1WCMI 2NVYI 2E2II 4NBBA 1X3WA 3HOWI 2JA5I 4XX2A
chains in the Genus database with same CATH superfamily
1P9NA 1RO4A 1TWFI 1K9M1 2JA8I 3CXCY 3VMIA 1S7MA 3CCR1 2Q51A 1QVGZ 1LQLA 3G6E1 3CXCZ 3CME1 5C44I 3M3YI 1FDOA 3CCQZ 1K9M2 2YADA 1N8R1 5IT9f 1W2BY 2JIMA 3CC71 3PO2I 1M901 3GTOI 3GTJI 1VQ9Z 1NP6A 3G711 5C4JI 1W2BZ 1N8R2 1M1K1 1TWGI 3CCJZ 1YIJ1 1Q821 2K5RA 3CC7Z 2OTL1 1M902 3J80b 4QTTA 3S1NI 1YIJZ 2QKDA 4MXUA 3KIHA 3Q87A 1M1K2 3I4NI 1Q822 1ZB8A 3EEDA 4BBRI 1YHQ1 2OTLZ 2YU9I 5T67A 4E2ZA 2JA7I 1I50I 3VMGA 1YJW1 4HGYA 4RVGA 3S16I 1SFOI 1KQSY 3IX0A 1YUKA 1KC81 1VQ51 1YHQZ 3U50C 4A3KI 1KQSZ 1YJWZ 3S14I 2ZAEB 1R9TI 3I4MI 5C3EI 4NB8A 2R92I 5IT9b 4NBFA 3S17I 1VQ5Z 1AA6A 1KC82 2NVYI 5D1OA 3CD6Z 2JMOA 2M48A 4E33A 4RVFA 3CCL1 2V8IA 2PM9A 2RPRA 1YJN1 3S1MI 3QWUA 1TWCI 4DGLA 3MONA 4A3LI 1ML8A 1YITZ 2QRCB 3M4OI 1TWHI 3S1RI 2E2JI 1VQO1 3CC4Z 1VQ41 3CCLZ 4NBCA 3IR7A 1YJNZ 4BY7I 2P3YA 4A3FI 1VQ7Z 2QA4Z 4DQYB 3J7A4 3VB9A 1VQ4Z 2W04A 1VQLZ 3F3FC 3P5JB 3I07A 3VMHA 4A3CI 2PK7A 1DL6A 1RNIA 1JJ2Y 2HF1A 3CCV1 1VQMZ 1YI21 1VQ81 1YJ91 1WW9A 3CPWY 2RHBA 2O4HA 2VUGA 3HOUI 3CCRZ 1KD11 5FLXf 4MD8A 3NH5A 3K7AI 2E2HI 2VF1A 1JJ2Z 5LL6f 1QYPA 2IV2X 3CPWZ 3G6EZ 5IP7I 3CCVZ 3CMEZ 1YJ9Z 3S2DI 1Y1VI 3ESWA 4NBEA 3D2LA 1KD12 5AN9F 2KI7B 4E2YA 1I3QI 2JUBA 4X6AI 2QREB 2DE6A 3G71Z 4A3GI 1S721 2OTJ1 3H3VJ 2WB1A 4BXXI 2E7ZA 3CCS1 4BBSI 4HGZA 5CM2M 3CCE1 2VPXA 5A2Qf 2RBLA 2JA6I 2AYDA 3GTQI 1QF8A 3KIFA 1Z01A 3CMA1 1L1OC 1RQFA 3HKZA 1K731 3GTPI 4RVDA 2JIOA 4S1TA 2E2II 1Z03A 1Q861 3CCSZ 2VPWA 4EWCA 2NVTI 3CCU1 2AKLA 3GTKI 4TNUA 1ZB9A 4RV9A 3HOXI 1K732 4MH4A 3D9XA 4NFRA 2QEX1 3BG1B 5FLXb 3PO3I 1Q862 2K3RA 1TFIA 2DE7A 2B63I 4RVHA 3HOYI 3CCUZ 3JAMf 3GKQA 5IP9I 2R7ZI 1RO2A 5D1OB 1VQ61 2RIQA 1TWAI 2VPYA 3NH4A 1NJI1 4QTUA 4NOZA 1Y1VS 1Q7Y1 1VQN1 2JR6A 1VQK1 3G4S1 4AYBA 2J6AA 1VQ6Z 2W03A 3S1QI 3VTNA 3NH8A 4E2XA 2V8KA 3D6WA 1N2FA 5A2Qb 1RLYA 3I561 2RT9A 3HOVI 1NJI2 2IZ4A 3GTMI 4MONA 1Q7Y2 4NBGA 1VQOZ 3CQZI 4A93I 3G4SZ 4MD7A 2LFUA 4DK1A 3I551 3EERA 3IF8A 3NDJA 4NBAA 3I56Z 1YUAA 2GU2A 3FQMA 3GTGI 5C4XI 5FLMI 2JNYA 2NAPA 3CCQ1 3I55Z 3FKII 1Q811 4A3EI 1X3ZA 2LIYA 2EGTA 4NBDA 3LUSA 2E9HA 1VQ8Z 3JAMb 1YI2Z 2HU9A 3NFZA 4E30A 4A3JI 1VQ91 3IFUA 3HOZI 3PO3S 4MD9A 4E31A 2QR1B 2QLVB 1KRLA 3CCJ1 2JIRA 4MRIA 4E2WA 2LEXA 1Q812 3BG0B 5D1PA 2M6NA 4Y52I 2BJOA 2WAQA 1USPA 1PFTA 3RZOI 2Q4ZA 1USPB 1QXFA 3OW2Y 3J81f 1Z02A 4NB9A 1K8A1 3TE5B 3S2HI 2NVXI 1I6HI 4Y7NI 3FQQA 3GTLI 2I3CA 2OOXB 2F4OA 1Y8CA 3OW2Z 1S72Z 2OTJZ 4HH4A 1WJ2A 3CCEZ 3F3PC 3GTMS 3S15I 1K8A2 3CCM1 3CMAZ 2JS4A 4A3DI 1QVFY 1FDIA 1VQP1 1K83I 2NVQI 2R6MA 3TDHB 3CC21 2V45A 3CCMZ 5T64A 2JIQA 3RZDI 1QVFZ 2OOYB 1ZH1A 3H0GI 2JIPA 2VPZA 3CD61 1X0TA 4NH1C 1SIWA 2QEXZ 1VQPZ 1NUIA 2DE5A 2QRDB 2OZKA 2VUMI 2P28A 2V8JA 4BY1I 3CC2Z 2IZ3A 1Y1WI 4A3BI 2PMZA 2Y0SA 5T6BA 1Q16A 2G2KA 1YIT1 1VLAA 2O53A 1WIIA 4NBHA 3CC41 1JWHC 3MZLB 3J81b 1RO0A 4A3MI 2H85A 2GTIA 3MZKB 4CL1A 2KPIA 4A3II 1WZNA 1VQNZ 3J80f 1VQ71 2R93I 3NDIA 1VQKZ 2QA41 3GCFA 2F4MA 1VQL1 1WCMI 3T4NB 2V3VA 4NBBA 2GTHA 4RS4A 1QVGY 1X3WA 4E32A 3HOWI 2JA5I 1VQM1 4XX2A
chains in the Genus database with same CATH topology
1P9NA 1RO4A 1TWFI 1K9M1 2JA8I 3CXCY 3VMIA 1S7MA 3CCR1 2Q51A 1QVGZ 1LQLA 3G6E1 3CXCZ 3CME1 5C44I 3M3YI 3CCQZ 1K9M2 2YADA 1N8R1 5IT9f 1W2BY 3CC71 3PO2I 1M901 3GTOI 3GTJI 1VQ9Z 1NP6A 3G711 5C4JI 1W2BZ 1N8R2 1M1K1 1TWGI 3CCJZ 1YIJ1 1Q821 2K5RA 3CC7Z 2OTL1 1M902 3J80b 4QTTA 3S1NI 1YIJZ 2QKDA 4MXUA 3KIHA 3Q87A 1M1K2 3I4NI 1Q822 1ZB8A 3EEDA 4BBRI 1YHQ1 2OTLZ 2YU9I 5T67A 4E2ZA 2JA7I 1I50I 3VMGA 1YJW1 4HGYA 4RVGA 3S16I 1SFOI 1KQSY 3IX0A 1YUKA 1KC81 1VQ51 1YHQZ 3U50C 4A3KI 1KQSZ 1YJWZ 3S14I 2ZAEB 1R9TI 3I4MI 5C3EI 4NB8A 2R92I 5IT9b 4NBFA 3S17I 1VQ5Z 1KC82 2NVYI 5D1OA 3CD6Z 2JMOA 2M48A 4E33A 4RVFA 3CCL1 2V8IA 2PM9A 2RPRA 1YJN1 3S1MI 3QWUA 1TWCI 4DGLA 3MONA 4A3LI 1ML8A 1YITZ 2QRCB 3M4OI 1TWHI 3S1RI 2E2JI 1VQO1 3CC4Z 1VQ41 3CCLZ 4NBCA 1YJNZ 4BY7I 2P3YA 4A3FI 1VQ7Z 2QA4Z 4DQYB 3J7A4 3VB9A 1VQ4Z 2W04A 1VQLZ 3F3FC 3P5JB 3I07A 3VMHA 4A3CI 2PK7A 1DL6A 1RNIA 1JJ2Y 2HF1A 3CCV1 1VQMZ 1YI21 1VQ81 1YJ91 1WW9A 3CPWY 2RHBA 2O4HA 2VUGA 3HOUI 3CCRZ 1KD11 5FLXf 4MD8A 3NH5A 3K7AI 2E2HI 2VF1A 1JJ2Z 5LL6f 1QYPA 3CPWZ 3G6EZ 5IP7I 3CCVZ 3CMEZ 1YJ9Z 3S2DI 1Y1VI 3ESWA 4NBEA 1KD12 5AN9F 2KI7B 4E2YA 1I3QI 2JUBA 4X6AI 2QREB 2DE6A 3G71Z 4A3GI 1S721 2OTJ1 3H3VJ 2WB1A 4BXXI 3CCS1 4BBSI 4HGZA 5CM2M 3CCE1 5A2Qf 2RBLA 2JA6I 3GTQI 1QF8A 3KIFA 1Z01A 3CMA1 1L1OC 1RQFA 3HKZA 1K731 3GTPI 4RVDA 2E2II 4S1TA 1Z03A 1Q861 3CCSZ 4EWCA 2NVTI 3CCU1 2AKLA 3GTKI 4TNUA 1ZB9A 4RV9A 3HOXI 1K732 4MH4A 3D9XA 4NFRA 2QEX1 3BG1B 5FLXb 3PO3I 1Q862 2K3RA 1TFIA 2DE7A 2B63I 4RVHA 3HOYI 3CCUZ 3JAMf 3GKQA 5IP9I 2R7ZI 1RO2A 5D1OB 1VQ61 2RIQA 1TWAI 3NH4A 1NJI1 4QTUA 4NOZA 1Y1VS 1Q7Y1 1VQN1 2JR6A 1VQK1 3G4S1 4AYBA 2J6AA 1VQ6Z 2W03A 3S1QI 3VTNA 3NH8A 4E2XA 2V8KA 3D6WA 1N2FA 5A2Qb 1RLYA 3I561 2RT9A 3HOVI 1NJI2 2IZ4A 3GTMI 4MONA 1Q7Y2 1VQOZ 4NBGA 3CQZI 4A93I 3G4SZ 4MD7A 2LFUA 4DK1A 3I551 3EERA 3IF8A 3NDJA 4NBAA 3I56Z 1YUAA 2GU2A 3FQMA 3GTGI 5C4XI 5FLMI 2JNYA 3CCQ1 3I55Z 3FKII 1Q811 4A3EI 1X3ZA 2LIYA 2EGTA 4NBDA 3LUSA 2E9HA 1VQ8Z 3JAMb 1YI2Z 2HU9A 3NFZA 4E30A 4A3JI 1VQ91 3IFUA 3HOZI 3PO3S 4MD9A 2QR1B 2QLVB 4E31A 1KRLA 3CCJ1 1Q812 4MRIA 4E2WA 3BG0B 5D1PA 2M6NA 4Y52I 2BJOA 2WAQA 1USPA 1PFTA 3RZOI 2Q4ZA 1USPB 3OW2Y 3J81f 1Z02A 4NB9A 1K8A1 3TE5B 3S2HI 2NVXI 1I6HI 4Y7NI 3FQQA 3GTLI 2I3CA 2OOXB 2F4OA 3OW2Z 1S72Z 2OTJZ 4HH4A 3CCEZ 3F3PC 3GTMS 3S15I 1K8A2 3CCM1 3CMAZ 2JS4A 4A3DI 1QVFY 1VQP1 1K83I 2NVQI 2R6MA 3TDHB 3CC21 3CCMZ 5T64A 1QVFZ 3RZDI 2OOYB 1ZH1A 3H0GI 3CD61 1X0TA 4NH1C 2QEXZ 1VQPZ 1NUIA 2DE5A 2QRDB 2OZKA 2VUMI 2P28A 2V8JA 4BY1I 3CC2Z 2IZ3A 1Y1WI 4A3BI 2PMZA 2Y0SA 5T6BA 2G2KA 1YIT1 1VLAA 2O53A 1WIIA 4NBHA 3CC41 1JWHC 3MZLB 3J81b 1RO0A 4A3MI 2H85A 2GTIA 3MZKB 4CL1A 2KPIA 4A3II 1VQNZ 3J80f 1VQ71 2R93I 3NDIA 1VQKZ 2QA41 3GCFA 2F4MA 1VQL1 1WCMI 3T4NB 4NBBA 2GTHA 4RS4A 1QVGY 1X3WA 4E32A 3HOWI 2JA5I 1VQM1 4XX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO4 A;  1TWF I;  2BJO A;  2JA8 I;  1USP A;  2NVT I;  1PFT A;  3RZO I;  3VMI A;  2AKL A;  3GTK I;  1ZB9 A;  3S1M I;  1USP B;  3HOX I;  1TWC I;  4A3L I;  1ML8 A;  4MH4 A;  4NB9 A;  3M4O I;  1TWH I;  3S1R I;  1LQL A;  3PO3 I;  2E2J I;  3S2H I;  2NVX I;  1I6H I;  1TFI A;  2DE7 A;  5C44 I;  4Y7N I;  3M3Y I;  4NBC A;  3GTL I;  2B63 I;  3HOY I;  2F4O A;  3GKQ A;  4BY7 I;  5IP9 I;  2P3Y A;  4A3F I;  2R7Z I;  3PO2 I;  3GTO I;  3GTM S;  3GTJ I;  3S15 I;  3VB9 A;  1TWA I;  5C4J I;  2JS4 A;  3I07 A;  4QTU A;  4NOZ A;  3VMH A;  1TWG I;  1Y1V S;  2PK7 A;  4A3C I;  4A3D I;  1DL6 A;  2JR6 A;  2K5R A;  2HF1 A;  1K83 I;  1WW9 A;  2NVQ I;  2J6A A;  3S1Q I;  4QTT A;  3HOU I;  3D6W A;  1N2F A;  1RLY A;  3RZD I;  3K7A I;  2E2H I;  3H0G I;  3HOV I;  3S1N I;  3GTM I;  1QYP A;  3Q87 A;  3I4N I;  4NBG A;  5IP7 I;  1ZB8 A;  1NUI A;  3CQZ I;  4A93 I;  2DE5 A;  4BBR I;  2VUM I;  3S2D I;  4BY1 I;  2YU9 I;  1Y1V I;  3ESW A;  1Y1W I;  3EER A;  2JA7 I;  4A3B I;  1I50 I;  4NBE A;  3VMG A;  3S16 I;  4NBA A;  1SFO I;  1YUA A;  1VLA A;  3GTG I;  1I3Q I;  4NBH A;  5C4X I;  4X6A I;  5FLM I;  2JNY A;  2DE6 A;  4A3M I;  4A3G I;  3FKI I;  3U50 C;  4A3E I;  2KPI A;  4Y52 I;  3H3V J;  1X3Z A;  4A3I I;  4A3K I;  4BXX I;  3S14 I;  4BBS I;  4NBD A;  5CM2 M;  3LUS A;  2R93 I;  1R9T I;  2RBL A;  2JA6 I;  3I4M I;  5C3E I;  3GCF A;  4A3J I;  4NB8 A;  2R92 I;  2F4M A;  3GTQ I;  3HOZ I;  3PO3 S;  1L1O C;  4NBF A;  3GTP I;  3S17 I;  1WCM I;  2NVY I;  2E2I I;  4NBB A;  1X3W A;  3HOW I;  2JA5 I;  4XX2 A; 
#chains in the Genus database with same CATH topology
 1P9N A;  1RO4 A;  1TWF I;  1K9M 1;  2JA8 I;  3CXC Y;  3VMI A;  1S7M A;  3CCR 1;  2Q51 A;  1QVG Z;  1LQL A;  3G6E 1;  3CXC Z;  3CME 1;  5C44 I;  3M3Y I;  1FDO A;  3CCQ Z;  1K9M 2;  2YAD A;  1N8R 1;  5IT9 f;  1W2B Y;  2JIM A;  3CC7 1;  3PO2 I;  1M90 1;  3GTO I;  3GTJ I;  1VQ9 Z;  1NP6 A;  3G71 1;  5C4J I;  1W2B Z;  1N8R 2;  1M1K 1;  1TWG I;  3CCJ Z;  1YIJ 1;  1Q82 1;  2K5R A;  3CC7 Z;  2OTL 1;  1M90 2;  3J80 b;  4QTT A;  3S1N I;  1YIJ Z;  2QKD A;  4MXU A;  3KIH A;  3Q87 A;  1M1K 2;  3I4N I;  1Q82 2;  1ZB8 A;  3EED A;  4BBR I;  1YHQ 1;  2OTL Z;  2YU9 I;  5T67 A;  4E2Z A;  2JA7 I;  1I50 I;  3VMG A;  1YJW 1;  4HGY A;  4RVG A;  3S16 I;  1SFO I;  1KQS Y;  3IX0 A;  1YUK A;  1KC8 1;  1VQ5 1;  1YHQ Z;  3U50 C;  4A3K I;  1KQS Z;  1YJW Z;  3S14 I;  2ZAE B;  1R9T I;  3I4M I;  5C3E I;  4NB8 A;  2R92 I;  5IT9 b;  4NBF A;  3S17 I;  1VQ5 Z;  1AA6 A;  1KC8 2;  2NVY I;  5D1O A;  3CD6 Z;  2JMO A;  2M48 A;  4E33 A;  4RVF A;  3CCL 1;  2V8I A;  2PM9 A;  2RPR A;  1YJN 1;  3S1M I;  3QWU A;  1TWC I;  4DGL A;  3MON A;  4A3L I;  1ML8 A;  1YIT Z;  2QRC B;  3M4O I;  1TWH I;  3S1R I;  2E2J I;  1VQO 1;  3CC4 Z;  1VQ4 1;  3CCL Z;  4NBC A;  3IR7 A;  1YJN Z;  4BY7 I;  2P3Y A;  4A3F I;  1VQ7 Z;  2QA4 Z;  4DQY B;  3J7A 4;  3VB9 A;  1VQ4 Z;  2W04 A;  1VQL Z;  3F3F C;  3P5J B;  3I07 A;  3VMH A;  4A3C I;  2PK7 A;  1DL6 A;  1RNI A;  1JJ2 Y;  2HF1 A;  3CCV 1;  1VQM Z;  1YI2 1;  1VQ8 1;  1YJ9 1;  1WW9 A;  3CPW Y;  2RHB A;  2O4H A;  2VUG A;  3HOU I;  3CCR Z;  1KD1 1;  5FLX f;  4MD8 A;  3NH5 A;  3K7A I;  2E2H I;  2VF1 A;  1JJ2 Z;  5LL6 f;  1QYP A;  2IV2 X;  3CPW Z;  3G6E Z;  5IP7 I;  3CCV Z;  3CME Z;  1YJ9 Z;  3S2D I;  1Y1V I;  3ESW A;  4NBE A;  3D2L A;  1KD1 2;  5AN9 F;  2KI7 B;  4E2Y A;  1I3Q I;  2JUB A;  4X6A I;  2QRE B;  2DE6 A;  3G71 Z;  4A3G I;  1S72 1;  2OTJ 1;  3H3V J;  2WB1 A;  4BXX I;  2E7Z A;  3CCS 1;  4BBS I;  4HGZ A;  5CM2 M;  3CCE 1;  2VPX A;  5A2Q f;  2RBL A;  2JA6 I;  2AYD A;  3GTQ I;  1QF8 A;  3KIF A;  1Z01 A;  3CMA 1;  1L1O C;  1RQF A;  3HKZ A;  1K73 1;  3GTP I;  4RVD A;  2JIO A;  4S1T A;  2E2I I;  1Z03 A;  1Q86 1;  3CCS Z;  2VPW A;  4EWC A;  2NVT I;  3CCU 1;  2AKL A;  3GTK I;  4TNU A;  1ZB9 A;  4RV9 A;  3HOX I;  1K73 2;  4MH4 A;  3D9X A;  4NFR A;  2QEX 1;  3BG1 B;  5FLX b;  3PO3 I;  1Q86 2;  2K3R A;  1TFI A;  2DE7 A;  2B63 I;  4RVH A;  3HOY I;  3CCU Z;  3JAM f;  3GKQ A;  5IP9 I;  2R7Z I;  1RO2 A;  5D1O B;  1VQ6 1;  2RIQ A;  1TWA I;  2VPY A;  3NH4 A;  1NJI 1;  4QTU A;  4NOZ A;  1Y1V S;  1Q7Y 1;  1VQN 1;  2JR6 A;  1VQK 1;  3G4S 1;  4AYB A;  2J6A A;  1VQ6 Z;  2W03 A;  3S1Q I;  3VTN A;  3NH8 A;  4E2X A;  2V8K A;  3D6W A;  1N2F A;  5A2Q b;  1RLY A;  3I56 1;  2RT9 A;  3HOV I;  1NJI 2;  2IZ4 A;  3GTM I;  4MON A;  1Q7Y 2;  4NBG A;  1VQO Z;  3CQZ I;  4A93 I;  3G4S Z;  4MD7 A;  2LFU A;  4DK1 A;  3I55 1;  3EER A;  3IF8 A;  3NDJ A;  4NBA A;  3I56 Z;  1YUA A;  2GU2 A;  3FQM A;  3GTG I;  5C4X I;  5FLM I;  2JNY A;  2NAP A;  3CCQ 1;  3I55 Z;  3FKI I;  1Q81 1;  4A3E I;  1X3Z A;  2LIY A;  2EGT A;  4NBD A;  3LUS A;  2E9H A;  1VQ8 Z;  3JAM b;  1YI2 Z;  2HU9 A;  3NFZ A;  4E30 A;  4A3J I;  1VQ9 1;  3IFU A;  3HOZ I;  3PO3 S;  4MD9 A;  4E31 A;  2QR1 B;  2QLV B;  1KRL A;  3CCJ 1;  2JIR A;  4MRI A;  4E2W A;  2LEX A;  1Q81 2;  3BG0 B;  5D1P A;  2M6N A;  4Y52 I;  2BJO A;  2WAQ A;  1USP A;  1PFT A;  3RZO I;  2Q4Z A;  1USP B;  1QXF A;  3OW2 Y;  3J81 f;  1Z02 A;  4NB9 A;  1K8A 1;  3TE5 B;  3S2H I;  2NVX I;  1I6H I;  4Y7N I;  3FQQ A;  3GTL I;  2I3C A;  2OOX B;  2F4O A;  1Y8C A;  3OW2 Z;  1S72 Z;  2OTJ Z;  4HH4 A;  1WJ2 A;  3CCE Z;  3F3P C;  3GTM S;  3S15 I;  1K8A 2;  3CCM 1;  3CMA Z;  2JS4 A;  4A3D I;  1QVF Y;  1FDI A;  1VQP 1;  1K83 I;  2NVQ I;  2R6M A;  3TDH B;  3CC2 1;  2V45 A;  3CCM Z;  5T64 A;  2JIQ A;  3RZD I;  1QVF Z;  2OOY B;  1ZH1 A;  3H0G I;  2JIP A;  2VPZ A;  3CD6 1;  1X0T A;  4NH1 C;  1SIW A;  2QEX Z;  1VQP Z;  1NUI A;  2DE5 A;  2QRD B;  2OZK A;  2VUM I;  2P28 A;  2V8J A;  4BY1 I;  3CC2 Z;  2IZ3 A;  1Y1W I;  4A3B I;  2PMZ A;  2Y0S A;  5T6B A;  1Q16 A;  2G2K A;  1YIT 1;  1VLA A;  2O53 A;  1WII A;  4NBH A;  3CC4 1;  1JWH C;  3MZL B;  3J81 b;  1RO0 A;  4A3M I;  2H85 A;  2GTI A;  3MZK B;  4CL1 A;  2KPI A;  4A3I I;  1WZN A;  1VQN Z;  3J80 f;  1VQ7 1;  2R93 I;  3NDI A;  1VQK Z;  2QA4 1;  3GCF A;  2F4M A;  1VQL 1;  1WCM I;  3T4N B;  2V3V A;  4NBB A;  2GTH A;  4RS4 A;  1QVG Y;  1X3W A;  4E32 A;  3HOW I;  2JA5 I;  1VQM 1;  4XX2 A; 
#chains in the Genus database with same CATH homology
 1P9N A;  1RO4 A;  1TWF I;  1K9M 1;  2JA8 I;  3CXC Y;  3VMI A;  1S7M A;  3CCR 1;  2Q51 A;  1QVG Z;  1LQL A;  3G6E 1;  3CXC Z;  3CME 1;  5C44 I;  3M3Y I;  3CCQ Z;  1K9M 2;  2YAD A;  1N8R 1;  5IT9 f;  1W2B Y;  3CC7 1;  3PO2 I;  1M90 1;  3GTO I;  3GTJ I;  1VQ9 Z;  1NP6 A;  3G71 1;  5C4J I;  1W2B Z;  1N8R 2;  1M1K 1;  1TWG I;  3CCJ Z;  1YIJ 1;  1Q82 1;  2K5R A;  3CC7 Z;  2OTL 1;  1M90 2;  3J80 b;  4QTT A;  3S1N I;  1YIJ Z;  2QKD A;  4MXU A;  3KIH A;  3Q87 A;  1M1K 2;  3I4N I;  1Q82 2;  1ZB8 A;  3EED A;  4BBR I;  1YHQ 1;  2OTL Z;  2YU9 I;  5T67 A;  4E2Z A;  2JA7 I;  1I50 I;  3VMG A;  1YJW 1;  4HGY A;  4RVG A;  3S16 I;  1SFO I;  1KQS Y;  3IX0 A;  1YUK A;  1KC8 1;  1VQ5 1;  1YHQ Z;  3U50 C;  4A3K I;  1KQS Z;  1YJW Z;  3S14 I;  2ZAE B;  1R9T I;  3I4M I;  5C3E I;  4NB8 A;  2R92 I;  5IT9 b;  4NBF A;  3S17 I;  1VQ5 Z;  1KC8 2;  2NVY I;  5D1O A;  3CD6 Z;  2JMO A;  2M48 A;  4E33 A;  4RVF A;  3CCL 1;  2V8I A;  2PM9 A;  2RPR A;  1YJN 1;  3S1M I;  3QWU A;  1TWC I;  4DGL A;  3MON A;  4A3L I;  1ML8 A;  1YIT Z;  2QRC B;  3M4O I;  1TWH I;  3S1R I;  2E2J I;  1VQO 1;  3CC4 Z;  1VQ4 1;  3CCL Z;  4NBC A;  1YJN Z;  4BY7 I;  2P3Y A;  4A3F I;  1VQ7 Z;  2QA4 Z;  4DQY B;  3J7A 4;  3VB9 A;  1VQ4 Z;  2W04 A;  1VQL Z;  3F3F C;  3P5J B;  3I07 A;  3VMH A;  4A3C I;  2PK7 A;  1DL6 A;  1RNI A;  1JJ2 Y;  2HF1 A;  3CCV 1;  1VQM Z;  1YI2 1;  1VQ8 1;  1YJ9 1;  1WW9 A;  3CPW Y;  2RHB A;  2O4H A;  2VUG A;  3HOU I;  3CCR Z;  1KD1 1;  5FLX f;  4MD8 A;  3NH5 A;  3K7A I;  2E2H I;  2VF1 A;  1JJ2 Z;  5LL6 f;  1QYP A;  3CPW Z;  3G6E Z;  5IP7 I;  3CCV Z;  3CME Z;  1YJ9 Z;  3S2D I;  1Y1V I;  3ESW A;  4NBE A;  1KD1 2;  5AN9 F;  2KI7 B;  4E2Y A;  1I3Q I;  2JUB A;  4X6A I;  2QRE B;  2DE6 A;  3G71 Z;  4A3G I;  1S72 1;  2OTJ 1;  3H3V J;  2WB1 A;  4BXX I;  3CCS 1;  4BBS I;  4HGZ A;  5CM2 M;  3CCE 1;  5A2Q f;  2RBL A;  2JA6 I;  3GTQ I;  1QF8 A;  3KIF A;  1Z01 A;  3CMA 1;  1L1O C;  1RQF A;  3HKZ A;  1K73 1;  3GTP I;  4RVD A;  2E2I I;  4S1T A;  1Z03 A;  1Q86 1;  3CCS Z;  4EWC A;  2NVT I;  3CCU 1;  2AKL A;  3GTK I;  4TNU A;  1ZB9 A;  4RV9 A;  3HOX I;  1K73 2;  4MH4 A;  3D9X A;  4NFR A;  2QEX 1;  3BG1 B;  5FLX b;  3PO3 I;  1Q86 2;  2K3R A;  1TFI A;  2DE7 A;  2B63 I;  4RVH A;  3HOY I;  3CCU Z;  3JAM f;  3GKQ A;  5IP9 I;  2R7Z I;  1RO2 A;  5D1O B;  1VQ6 1;  2RIQ A;  1TWA I;  3NH4 A;  1NJI 1;  4QTU A;  4NOZ A;  1Y1V S;  1Q7Y 1;  1VQN 1;  2JR6 A;  1VQK 1;  3G4S 1;  4AYB A;  2J6A A;  1VQ6 Z;  2W03 A;  3S1Q I;  3VTN A;  3NH8 A;  4E2X A;  2V8K A;  3D6W A;  1N2F A;  5A2Q b;  1RLY A;  3I56 1;  2RT9 A;  3HOV I;  1NJI 2;  2IZ4 A;  3GTM I;  4MON A;  1Q7Y 2;  1VQO Z;  4NBG A;  3CQZ I;  4A93 I;  3G4S Z;  4MD7 A;  2LFU A;  4DK1 A;  3I55 1;  3EER A;  3IF8 A;  3NDJ A;  4NBA A;  3I56 Z;  1YUA A;  2GU2 A;  3FQM A;  3GTG I;  5C4X I;  5FLM I;  2JNY A;  3CCQ 1;  3I55 Z;  3FKI I;  1Q81 1;  4A3E I;  1X3Z A;  2LIY A;  2EGT A;  4NBD A;  3LUS A;  2E9H A;  1VQ8 Z;  3JAM b;  1YI2 Z;  2HU9 A;  3NFZ A;  4E30 A;  4A3J I;  1VQ9 1;  3IFU A;  3HOZ I;  3PO3 S;  4MD9 A;  2QR1 B;  2QLV B;  4E31 A;  1KRL A;  3CCJ 1;  1Q81 2;  4MRI A;  4E2W A;  3BG0 B;  5D1P A;  2M6N A;  4Y52 I;  2BJO A;  2WAQ A;  1USP A;  1PFT A;  3RZO I;  2Q4Z A;  1USP B;  3OW2 Y;  3J81 f;  1Z02 A;  4NB9 A;  1K8A 1;  3TE5 B;  3S2H I;  2NVX I;  1I6H I;  4Y7N I;  3FQQ A;  3GTL I;  2I3C A;  2OOX B;  2F4O A;  3OW2 Z;  1S72 Z;  2OTJ Z;  4HH4 A;  3CCE Z;  3F3P C;  3GTM S;  3S15 I;  1K8A 2;  3CCM 1;  3CMA Z;  2JS4 A;  4A3D I;  1QVF Y;  1VQP 1;  1K83 I;  2NVQ I;  2R6M A;  3TDH B;  3CC2 1;  3CCM Z;  5T64 A;  1QVF Z;  3RZD I;  2OOY B;  1ZH1 A;  3H0G I;  3CD6 1;  1X0T A;  4NH1 C;  2QEX Z;  1VQP Z;  1NUI A;  2DE5 A;  2QRD B;  2OZK A;  2VUM I;  2P28 A;  2V8J A;  4BY1 I;  3CC2 Z;  2IZ3 A;  1Y1W I;  4A3B I;  2PMZ A;  2Y0S A;  5T6B A;  2G2K A;  1YIT 1;  1VLA A;  2O53 A;  1WII A;  4NBH A;  3CC4 1;  1JWH C;  3MZL B;  3J81 b;  1RO0 A;  4A3M I;  2H85 A;  2GTI A;  3MZK B;  4CL1 A;  2KPI A;  4A3I I;  1VQN Z;  3J80 f;  1VQ7 1;  2R93 I;  3NDI A;  1VQK Z;  2QA4 1;  3GCF A;  2F4M A;  1VQL 1;  1WCM I;  3T4N B;  4NBB A;  2GTH A;  4RS4 A;  1QVG Y;  1X3W A;  4E32 A;  3HOW I;  2JA5 I;  1VQM 1;  4XX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...