3S14I

Rna polymerase ii initiation complex with a 6-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s14I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s14I02
3M3YI 2R92I 2K5RA 1WW9A 2DE5A 4NBDA 2E2JI 1TWFI 1I6HI 1ZB8A 1R9TI 3GTLI 3FKII 5CM2M 1Y1VS 4NBEA 3LUSA 4QTUA 3GTKI 5IP7I 3S17I 1Y1VI 3GKQA 3S1MI 4A93I 4BY7I 3S14I 1USPB 2NVXI 1I50I 1RO4A 1WCMI 3GTQI 3Q87A 3PO2I 3HOZI 2YU9I 2JA7I 3S15I 4A3DI 2P3YA 4A3II 3I07A 3K7AI 4NB9A 3HOVI 4NOZA 3VMGA 1TFIA 1I3QI 1ML8A 1TWGI 2JA6I 5C4JI 4MH4A 4Y7NI 1NUIA 3GTMI 2JS4A 4NBAA 4NBBA 4QTTA 2E2II 4BBSI 4BXXI 3GTJI 4XX2A 3S2HI 3ESWA 2KPIA 3S16I 4A3KI 1LQLA 1L1OC 1N2FA 1TWAI 3GTGI 3S1RI 2R93I 5C4XI 2E2HI 3HOUI 3HOXI 3M4OI 3D6WA 4A3JI 3GTOI 4NBHA 1K83I 4X6AI 3GCFA 2DE7A 3H3VJ 2NVQI 2VUMI 2F4MA 2HF1A 1DL6A 3EERA 3S1QI 4NBCA 1TWHI 2DE6A 4BY1I 3GTMS 1SFOI 5C3EI 3VMIA 3I4MI 2R7ZI 2JNYA 3RZDI 1VLAA 4NBFA 3GTPI 3I4NI 4A3CI 4NB8A 2B63I 3S2DI 2JA8I 1Y1WI 4A3EI 4A3FI 2AKLA 2PK7A 3H0GI 5FLMI 2JA5I 3CQZI 2JR6A 1ZB9A 3PO3S 4A3MI 5C44I 3HOWI 2F4OA 1TWCI 3PO3I 2BJOA 1USPA 3RZOI 3HOYI 1RLYA 4NBGA 1PFTA 1YUAA 4A3LI 3S1NI 1QYPA 4A3BI 2J6AA 2RBLA 3U50C 1X3ZA 2NVYI 2NVTI 1X3WA 4A3GI 4Y52I 4BBRI 3VMHA 5IP9I 3VB9A
chains in the Genus database with same CATH superfamily
1Q16A 2E7ZA 1N8R1 1WW9A 4NBDA 2ZAEB 2M6NA 1YJNZ 2QA41 1ZB8A 3GTLI 3CCLZ 1VQPZ 3IR7A 5D1OA 3NH8A 1Y1VI 3G6EZ 1VQN1 2QREB 1YI2Z 1VQ61 1YHQ1 1RO4A 3PO2I 4EWCA 1KQSY 2JA7I 1VQ7Z 2JUBA 4NB9A 2RHBA 1NJI1 2NAPA 3VMGA 1I3QI 1TWGI 3CD6Z 2IV2X 4Y7NI 1JJ2Z 3GTMI 3NFZA 1YIJZ 4BBSI 4BXXI 2QEXZ 3GTJI 4NH1C 2KPIA 3KIHA 1VQ91 2H85A 2JIPA 3HOUI 4CL1A 4E2YA 4A3JI 3GTOI 4NBHA 4X6AI 2QKDA 5D1PA 5FLXf 2VUMI 2HF1A 2GTIA 5IT9f 1KD12 1SFOI 3JAMf 3D9XA 1KQSZ 4NBFA 5IT9b 3S2DI 3JAMb 1K9M1 1VQOZ 1VQKZ 1P9NA 4MD8A 4RVHA 5A2Qf 2JA5I 4RVGA 1VQ81 1KC82 2F4OA 3CPWZ 2QRDB 3MZLB 3CCS1 4TNUA 3CCRZ 3MZKB 2GTHA 2E9HA 2OTL1 4A3BI 3I551 3CCQ1 1RNIA 2RBLA 4HGZA 2VPZA 2NVYI 3CCJZ 1X3WA 4Y52I 2RPRA 3VMHA 2IZ4A 1K8A1 2K5RA 2Y0SA 2QA4Z 3CC2Z 2OTJ1 1S7MA 2VPWA 3FKII 3CCM1 3LUSA 1VQ6Z 3CCV1 5IP7I 3GKQA 2O4HA 2V8IA 1VQM1 1WZNA 1JJ2Y 2K3RA 1YJ9Z 3HOZI 2YU9I 4A3DI 4RVFA 3I07A 5T6BA 3T4NB 1Q812 5AN9F 1TFIA 2QR1B 3G4S1 2JA6I 4MH4A 1QF8A 2JIQA 2JS4A 2WAQA 4QTTA 3CC7Z 3FQQA 3G711 3I561 2OOYB 4A3KI 2AYDA 1X0TA 1Q7Y1 2V3VA 3D2LA 1KRLA 2LFUA 1RO0A 2Q51A 3EERA 3CCUZ 2QLVB 1YIT1 3I4MI 1QXFA 1YUKA 3QWUA 4HGYA 1S721 3CPWY 4NB8A 3OW2Z 1FDOA 4A3EI 1M901 1VQ8Z 3CC41 2PK7A 3H0GI 5FLMI 1QVFY 1Q862 3PO3S 1Q822 2EGTA 1RQFA 2P28A 4HH4A 2BJOA 2OOXB 1VQ5Z 3CCL1 4DQYB 4NBGA 1PFTA 2VPXA 3CCQZ 1QYPA 3NH4A 2J6AA 1VQL1 1X3ZA 2I3CA 4A3GI 4DK1A 5IP9I 3VB9A 2IZ3A 1VQ71 4MONA 2OTJZ 1TWFI 4MXUA 4S1TA 3CCEZ 1YJW1 1N8R2 4E31A 1R9TI 3CCVZ 2OZKA 5CM2M 1Y1VS 3CD61 1W2BZ 4NBEA 3P5JB 4BY7I 1YIJ1 2M48A 3S1MI 4A93I 3TDHB 1SIWA 2QEX1 3S14I 1VQMZ 2NVXI 1QVFZ 1I50I 3BG1B 1WCMI 2WB1A 5T64A 4A3II 2Q4ZA 3K7AI 2PMZA 3G4SZ 4MD7A 1NJI2 3CMA1 1NUIA 4E2ZA 1AA6A 1NP6A 1VQNZ 3S2HI 3ESWA 1YHQZ 3S16I 1L1OC 3GTGI 5C4XI 1VQO1 1VQK1 3HOXI 1Q821 3CXCZ 1KD11 2V8JA 3J80f 1VQ41 3CME1 4E32A 3H3VJ 3OW2Y 2NVQI 1DL6A 1TWHI 2DE6A 4BY1I 2V45A 3J7A4 1M1K2 1Y8CA 2R7ZI 3J81b 3RZDI 3J80b 1VQ9Z 3MONA 2GU2A 1QVGZ 1ZH1A 4A3CI 2HU9A 3IX0A 3CCJ1 3CC4Z 1Z02A 2W04A 1KC81 4A3FI 1K9M2 2JIRA 2JR6A 1Z01A 5C44I 3CC21 2VUGA 3HKZA 1TWCI 3VTNA 3RZOI 3HOYI 1Z03A 1YUAA 4AYBA 1VQLZ 4A3LI 3U50C 3S17I 1W2BY 1YJ91 1K732 3M3YI 2R92I 1YJWZ 2RIQA 2DE5A 4RS4A 2E2JI 2V8KA 1I6HI 1K8A2 3BG0B 1YJN1 3CCSZ 4E2WA 2YADA 4QTUA 3CC71 2OTLZ 3NDIA 3GTKI 1VQP1 4E33A 3I55Z 1WJ2A 2R6MA 1USPB 3G6E1 1YI21 3GTQI 3Q87A 2W03A 3S15I 2P3YA 1Q811 3HOVI 4NOZA 1M1K1 3CMAZ 1ML8A 2JIMA 5C4JI 3CCMZ 3CCU1 4NBAA 4NBBA 4RV9A 3F3PC 3TE5B 2LIYA 3CXCY 2E2II 4E2XA 4XX2A 2JMOA 5FLXb 4NFRA 5D1OB 3F3FC 1LQLA 1TWAI 1N2FA 4RVDA 2R93I 3S1RI 2PM9A 2E2HI 3M4OI 3D6WA 1K83I 3CMEZ 1VQ4Z 3GCFA 2DE7A 1QVGY 1Q7Y2 5LL6f 2F4MA 3S1QI 4NBCA 3GTMS 5C3EI 5T67A 3NDJA 2G2KA 5A2Qb 3VMIA 1FDIA 3KIFA 1VQ51 2JNYA 2KI7B 2O53A 1RO2A 1VLAA 3G71Z 3IF8A 3I56Z 3EEDA 3GTPI 3I4NI 1K731 3IFUA 2B63I 2JA8I 2QRCB 1Y1WI 4MRIA 2RT9A 3FQMA 1Q861 4MD9A 2AKLA 1M902 3CQZI 3J81f 2VF1A 4E30A 1ZB9A 3CCE1 4A3MI 3HOWI 2JIOA 4DGLA 2VPYA 3PO3I 1USPA 1RLYA 1YITZ 3S1NI 1S72Z 2LEXA 3NH5A 3CCR1 1WIIA 2NVTI 4BBRI 1JWHC
chains in the Genus database with same CATH topology
1N8R1 1WW9A 4NBDA 2ZAEB 2M6NA 1YJNZ 2QA41 1ZB8A 3GTLI 3CCLZ 1VQPZ 5D1OA 3NH8A 1Y1VI 3G6EZ 1VQN1 2QREB 1YI2Z 1VQ61 1YHQ1 1RO4A 3PO2I 4EWCA 1KQSY 2JA7I 1VQ7Z 2JUBA 4NB9A 2RHBA 1NJI1 3VMGA 1I3QI 1TWGI 3CD6Z 4Y7NI 1JJ2Z 3GTMI 3NFZA 1YIJZ 4BBSI 4BXXI 2QEXZ 3GTJI 4NH1C 2KPIA 3KIHA 1VQ91 2H85A 3HOUI 4CL1A 4E2YA 4A3JI 3GTOI 4NBHA 4X6AI 2QKDA 5D1PA 5FLXf 2VUMI 2HF1A 2GTIA 5IT9f 1KD12 1SFOI 3JAMf 3D9XA 1KQSZ 4NBFA 5IT9b 3S2DI 3JAMb 1K9M1 1VQOZ 1VQKZ 1P9NA 4MD8A 4RVHA 5A2Qf 2JA5I 4RVGA 1VQ81 1KC82 2F4OA 3CPWZ 2QRDB 3MZLB 3CCS1 4TNUA 3CCRZ 3MZKB 2GTHA 2E9HA 2OTL1 4A3BI 3I551 3CCQ1 1RNIA 2RBLA 4HGZA 2NVYI 3CCJZ 1X3WA 4Y52I 2RPRA 3VMHA 2IZ4A 1K8A1 2K5RA 2Y0SA 2QA4Z 3CC2Z 2OTJ1 1S7MA 3FKII 3CCM1 3LUSA 1VQ6Z 3CCV1 5IP7I 3GKQA 2O4HA 2V8IA 1VQM1 1JJ2Y 2K3RA 1YJ9Z 3HOZI 2YU9I 4A3DI 4RVFA 3I07A 5T6BA 3T4NB 1Q812 5AN9F 1TFIA 2QR1B 3G4S1 2JA6I 4MH4A 1QF8A 2JS4A 2WAQA 4QTTA 3CC7Z 3FQQA 3G711 3I561 2OOYB 4A3KI 1X0TA 1Q7Y1 1KRLA 2LFUA 1RO0A 2Q51A 3EERA 3CCUZ 2QLVB 1YIT1 3I4MI 1YUKA 3QWUA 4HGYA 1S721 3CPWY 4NB8A 3OW2Z 4A3EI 1M901 1VQ8Z 3CC41 2PK7A 3H0GI 5FLMI 1QVFY 1Q862 3PO3S 1Q822 2EGTA 1RQFA 2P28A 4HH4A 2BJOA 2OOXB 1VQ5Z 3CCL1 4DQYB 4NBGA 1PFTA 3CCQZ 1QYPA 3NH4A 2J6AA 1VQL1 1X3ZA 2I3CA 4A3GI 4DK1A 5IP9I 3VB9A 2IZ3A 1VQ71 4MONA 2OTJZ 1TWFI 4MXUA 4S1TA 3CCEZ 1YJW1 1N8R2 4E31A 1R9TI 3CCVZ 2OZKA 5CM2M 1Y1VS 3CD61 1W2BZ 4NBEA 3P5JB 4BY7I 1YIJ1 2M48A 3S1MI 4A93I 3TDHB 2QEX1 3S14I 1VQMZ 2NVXI 1QVFZ 1I50I 3BG1B 1WCMI 2WB1A 5T64A 4A3II 2Q4ZA 3K7AI 2PMZA 3G4SZ 4MD7A 1NJI2 3CMA1 1NUIA 4E2ZA 1NP6A 1VQNZ 3S2HI 3ESWA 1YHQZ 3S16I 1L1OC 3GTGI 5C4XI 1VQO1 1VQK1 3HOXI 1Q821 3CXCZ 1KD11 2V8JA 3J80f 1VQ41 3CME1 4E32A 3H3VJ 3OW2Y 2NVQI 1DL6A 1TWHI 2DE6A 4BY1I 3J7A4 1M1K2 2R7ZI 3J81b 3RZDI 3J80b 1VQ9Z 3MONA 2GU2A 1QVGZ 1ZH1A 4A3CI 2HU9A 3IX0A 3CCJ1 3CC4Z 1Z02A 2W04A 1KC81 4A3FI 1K9M2 2JR6A 1Z01A 5C44I 3CC21 2VUGA 3HKZA 1TWCI 3VTNA 3RZOI 3HOYI 1Z03A 1YUAA 4AYBA 1VQLZ 4A3LI 3U50C 3S17I 1W2BY 1YJ91 1K732 3M3YI 2R92I 1YJWZ 2RIQA 2DE5A 4RS4A 2E2JI 2V8KA 1I6HI 1K8A2 3BG0B 1YJN1 3CCSZ 4E2WA 2YADA 4QTUA 3CC71 2OTLZ 3NDIA 3GTKI 1VQP1 4E33A 3I55Z 2R6MA 1USPB 3G6E1 1YI21 3GTQI 3Q87A 2W03A 3S15I 2P3YA 1Q811 3HOVI 4NOZA 1M1K1 3CMAZ 1ML8A 5C4JI 3CCMZ 3CCU1 4NBAA 4NBBA 4RV9A 3F3PC 3TE5B 2LIYA 3CXCY 2E2II 4E2XA 4XX2A 2JMOA 5FLXb 4NFRA 5D1OB 3F3FC 1LQLA 1TWAI 1N2FA 4RVDA 2R93I 3S1RI 2PM9A 2E2HI 3M4OI 3D6WA 1K83I 3CMEZ 1VQ4Z 3GCFA 2DE7A 1QVGY 1Q7Y2 5LL6f 2F4MA 3S1QI 4NBCA 3GTMS 5C3EI 5T67A 3NDJA 2G2KA 5A2Qb 3VMIA 1VQ51 3KIFA 2JNYA 2KI7B 2O53A 1RO2A 1VLAA 3G71Z 3IF8A 3I56Z 3EEDA 3GTPI 3I4NI 1K731 3IFUA 2B63I 2JA8I 2QRCB 1Y1WI 4MRIA 2RT9A 3FQMA 1Q861 4MD9A 2AKLA 1M902 3CQZI 3J81f 2VF1A 4E30A 1ZB9A 3CCE1 4A3MI 3HOWI 4DGLA 3PO3I 1USPA 1RLYA 1YITZ 3S1NI 1S72Z 3NH5A 3CCR1 1WIIA 2NVTI 4BBRI 1JWHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y I;  2R92 I;  2K5R A;  1WW9 A;  2DE5 A;  4NBD A;  2E2J I;  1TWF I;  1I6H I;  1ZB8 A;  1R9T I;  3GTL I;  3FKI I;  5CM2 M;  1Y1V S;  4NBE A;  3LUS A;  4QTU A;  3GTK I;  5IP7 I;  3S17 I;  1Y1V I;  3GKQ A;  3S1M I;  4A93 I;  4BY7 I;  3S14 I;  1USP B;  2NVX I;  1I50 I;  1RO4 A;  1WCM I;  3GTQ I;  3Q87 A;  3PO2 I;  3HOZ I;  2YU9 I;  2JA7 I;  3S15 I;  4A3D I;  2P3Y A;  4A3I I;  3I07 A;  3K7A I;  4NB9 A;  3HOV I;  4NOZ A;  3VMG A;  1TFI A;  1I3Q I;  1ML8 A;  1TWG I;  2JA6 I;  5C4J I;  4MH4 A;  4Y7N I;  1NUI A;  3GTM I;  2JS4 A;  4NBA A;  4NBB A;  4QTT A;  2E2I I;  4BBS I;  4BXX I;  3GTJ I;  4XX2 A;  3S2H I;  3ESW A;  2KPI A;  3S16 I;  4A3K I;  1LQL A;  1L1O C;  1N2F A;  1TWA I;  3GTG I;  3S1R I;  2R93 I;  5C4X I;  2E2H I;  3HOU I;  3HOX I;  3M4O I;  3D6W A;  4A3J I;  3GTO I;  4NBH A;  1K83 I;  4X6A I;  3GCF A;  2DE7 A;  3H3V J;  2NVQ I;  2VUM I;  2F4M A;  2HF1 A;  1DL6 A;  3EER A;  3S1Q I;  4NBC A;  1TWH I;  2DE6 A;  4BY1 I;  3GTM S;  1SFO I;  5C3E I;  3VMI A;  3I4M I;  2R7Z I;  2JNY A;  3RZD I;  1VLA A;  4NBF A;  3GTP I;  3I4N I;  4A3C I;  4NB8 A;  2B63 I;  3S2D I;  2JA8 I;  1Y1W I;  4A3E I;  4A3F I;  2AKL A;  2PK7 A;  3H0G I;  5FLM I;  2JA5 I;  3CQZ I;  2JR6 A;  1ZB9 A;  3PO3 S;  4A3M I;  5C44 I;  3HOW I;  2F4O A;  1TWC I;  3PO3 I;  2BJO A;  1USP A;  3RZO I;  3HOY I;  1RLY A;  4NBG A;  1PFT A;  1YUA A;  4A3L I;  3S1N I;  1QYP A;  4A3B I;  2J6A A;  2RBL A;  3U50 C;  1X3Z A;  2NVY I;  2NVT I;  1X3W A;  4A3G I;  4Y52 I;  4BBR I;  3VMH A;  5IP9 I;  3VB9 A; 
#chains in the Genus database with same CATH topology
 1Q16 A;  2E7Z A;  1N8R 1;  1WW9 A;  4NBD A;  2ZAE B;  2M6N A;  1YJN Z;  2QA4 1;  1ZB8 A;  3GTL I;  3CCL Z;  1VQP Z;  3IR7 A;  5D1O A;  3NH8 A;  1Y1V I;  3G6E Z;  1VQN 1;  2QRE B;  1YI2 Z;  1VQ6 1;  1YHQ 1;  1RO4 A;  3PO2 I;  4EWC A;  1KQS Y;  2JA7 I;  1VQ7 Z;  2JUB A;  4NB9 A;  2RHB A;  1NJI 1;  2NAP A;  3VMG A;  1I3Q I;  1TWG I;  3CD6 Z;  2IV2 X;  4Y7N I;  1JJ2 Z;  3GTM I;  3NFZ A;  1YIJ Z;  4BBS I;  4BXX I;  2QEX Z;  3GTJ I;  4NH1 C;  2KPI A;  3KIH A;  1VQ9 1;  2H85 A;  2JIP A;  3HOU I;  4CL1 A;  4E2Y A;  4A3J I;  3GTO I;  4NBH A;  4X6A I;  2QKD A;  5D1P A;  5FLX f;  2VUM I;  2HF1 A;  2GTI A;  5IT9 f;  1KD1 2;  1SFO I;  3JAM f;  3D9X A;  1KQS Z;  4NBF A;  5IT9 b;  3S2D I;  3JAM b;  1K9M 1;  1VQO Z;  1VQK Z;  1P9N A;  4MD8 A;  4RVH A;  5A2Q f;  2JA5 I;  4RVG A;  1VQ8 1;  1KC8 2;  2F4O A;  3CPW Z;  2QRD B;  3MZL B;  3CCS 1;  4TNU A;  3CCR Z;  3MZK B;  2GTH A;  2E9H A;  2OTL 1;  4A3B I;  3I55 1;  3CCQ 1;  1RNI A;  2RBL A;  4HGZ A;  2VPZ A;  2NVY I;  3CCJ Z;  1X3W A;  4Y52 I;  2RPR A;  3VMH A;  2IZ4 A;  1K8A 1;  2K5R A;  2Y0S A;  2QA4 Z;  3CC2 Z;  2OTJ 1;  1S7M A;  2VPW A;  3FKI I;  3CCM 1;  3LUS A;  1VQ6 Z;  3CCV 1;  5IP7 I;  3GKQ A;  2O4H A;  2V8I A;  1VQM 1;  1WZN A;  1JJ2 Y;  2K3R A;  1YJ9 Z;  3HOZ I;  2YU9 I;  4A3D I;  4RVF A;  3I07 A;  5T6B A;  3T4N B;  1Q81 2;  5AN9 F;  1TFI A;  2QR1 B;  3G4S 1;  2JA6 I;  4MH4 A;  1QF8 A;  2JIQ A;  2JS4 A;  2WAQ A;  4QTT A;  3CC7 Z;  3FQQ A;  3G71 1;  3I56 1;  2OOY B;  4A3K I;  2AYD A;  1X0T A;  1Q7Y 1;  2V3V A;  3D2L A;  1KRL A;  2LFU A;  1RO0 A;  2Q51 A;  3EER A;  3CCU Z;  2QLV B;  1YIT 1;  3I4M I;  1QXF A;  1YUK A;  3QWU A;  4HGY A;  1S72 1;  3CPW Y;  4NB8 A;  3OW2 Z;  1FDO A;  4A3E I;  1M90 1;  1VQ8 Z;  3CC4 1;  2PK7 A;  3H0G I;  5FLM I;  1QVF Y;  1Q86 2;  3PO3 S;  1Q82 2;  2EGT A;  1RQF A;  2P28 A;  4HH4 A;  2BJO A;  2OOX B;  1VQ5 Z;  3CCL 1;  4DQY B;  4NBG A;  1PFT A;  2VPX A;  3CCQ Z;  1QYP A;  3NH4 A;  2J6A A;  1VQL 1;  1X3Z A;  2I3C A;  4A3G I;  4DK1 A;  5IP9 I;  3VB9 A;  2IZ3 A;  1VQ7 1;  4MON A;  2OTJ Z;  1TWF I;  4MXU A;  4S1T A;  3CCE Z;  1YJW 1;  1N8R 2;  4E31 A;  1R9T I;  3CCV Z;  2OZK A;  5CM2 M;  1Y1V S;  3CD6 1;  1W2B Z;  4NBE A;  3P5J B;  4BY7 I;  1YIJ 1;  2M48 A;  3S1M I;  4A93 I;  3TDH B;  1SIW A;  2QEX 1;  3S14 I;  1VQM Z;  2NVX I;  1QVF Z;  1I50 I;  3BG1 B;  1WCM I;  2WB1 A;  5T64 A;  4A3I I;  2Q4Z A;  3K7A I;  2PMZ A;  3G4S Z;  4MD7 A;  1NJI 2;  3CMA 1;  1NUI A;  4E2Z A;  1AA6 A;  1NP6 A;  1VQN Z;  3S2H I;  3ESW A;  1YHQ Z;  3S16 I;  1L1O C;  3GTG I;  5C4X I;  1VQO 1;  1VQK 1;  3HOX I;  1Q82 1;  3CXC Z;  1KD1 1;  2V8J A;  3J80 f;  1VQ4 1;  3CME 1;  4E32 A;  3H3V J;  3OW2 Y;  2NVQ I;  1DL6 A;  1TWH I;  2DE6 A;  4BY1 I;  2V45 A;  3J7A 4;  1M1K 2;  1Y8C A;  2R7Z I;  3J81 b;  3RZD I;  3J80 b;  1VQ9 Z;  3MON A;  2GU2 A;  1QVG Z;  1ZH1 A;  4A3C I;  2HU9 A;  3IX0 A;  3CCJ 1;  3CC4 Z;  1Z02 A;  2W04 A;  1KC8 1;  4A3F I;  1K9M 2;  2JIR A;  2JR6 A;  1Z01 A;  5C44 I;  3CC2 1;  2VUG A;  3HKZ A;  1TWC I;  3VTN A;  3RZO I;  3HOY I;  1Z03 A;  1YUA A;  4AYB A;  1VQL Z;  4A3L I;  3U50 C;  3S17 I;  1W2B Y;  1YJ9 1;  1K73 2;  3M3Y I;  2R92 I;  1YJW Z;  2RIQ A;  2DE5 A;  4RS4 A;  2E2J I;  2V8K A;  1I6H I;  1K8A 2;  3BG0 B;  1YJN 1;  3CCS Z;  4E2W A;  2YAD A;  4QTU A;  3CC7 1;  2OTL Z;  3NDI A;  3GTK I;  1VQP 1;  4E33 A;  3I55 Z;  1WJ2 A;  2R6M A;  1USP B;  3G6E 1;  1YI2 1;  3GTQ I;  3Q87 A;  2W03 A;  3S15 I;  2P3Y A;  1Q81 1;  3HOV I;  4NOZ A;  1M1K 1;  3CMA Z;  1ML8 A;  2JIM A;  5C4J I;  3CCM Z;  3CCU 1;  4NBA A;  4NBB A;  4RV9 A;  3F3P C;  3TE5 B;  2LIY A;  3CXC Y;  2E2I I;  4E2X A;  4XX2 A;  2JMO A;  5FLX b;  4NFR A;  5D1O B;  3F3F C;  1LQL A;  1TWA I;  1N2F A;  4RVD A;  2R93 I;  3S1R I;  2PM9 A;  2E2H I;  3M4O I;  3D6W A;  1K83 I;  3CME Z;  1VQ4 Z;  3GCF A;  2DE7 A;  1QVG Y;  1Q7Y 2;  5LL6 f;  2F4M A;  3S1Q I;  4NBC A;  3GTM S;  5C3E I;  5T67 A;  3NDJ A;  2G2K A;  5A2Q b;  3VMI A;  1FDI A;  3KIF A;  1VQ5 1;  2JNY A;  2KI7 B;  2O53 A;  1RO2 A;  1VLA A;  3G71 Z;  3IF8 A;  3I56 Z;  3EED A;  3GTP I;  3I4N I;  1K73 1;  3IFU A;  2B63 I;  2JA8 I;  2QRC B;  1Y1W I;  4MRI A;  2RT9 A;  3FQM A;  1Q86 1;  4MD9 A;  2AKL A;  1M90 2;  3CQZ I;  3J81 f;  2VF1 A;  4E30 A;  1ZB9 A;  3CCE 1;  4A3M I;  3HOW I;  2JIO A;  4DGL A;  2VPY A;  3PO3 I;  1USP A;  1RLY A;  1YIT Z;  3S1N I;  1S72 Z;  2LEX A;  3NH5 A;  3CCR 1;  1WII A;  2NVT I;  4BBR I;  1JWH C; 
#chains in the Genus database with same CATH homology
 1N8R 1;  1WW9 A;  4NBD A;  2ZAE B;  2M6N A;  1YJN Z;  2QA4 1;  1ZB8 A;  3GTL I;  3CCL Z;  1VQP Z;  5D1O A;  3NH8 A;  1Y1V I;  3G6E Z;  1VQN 1;  2QRE B;  1YI2 Z;  1VQ6 1;  1YHQ 1;  1RO4 A;  3PO2 I;  4EWC A;  1KQS Y;  2JA7 I;  1VQ7 Z;  2JUB A;  4NB9 A;  2RHB A;  1NJI 1;  3VMG A;  1I3Q I;  1TWG I;  3CD6 Z;  4Y7N I;  1JJ2 Z;  3GTM I;  3NFZ A;  1YIJ Z;  4BBS I;  4BXX I;  2QEX Z;  3GTJ I;  4NH1 C;  2KPI A;  3KIH A;  1VQ9 1;  2H85 A;  3HOU I;  4CL1 A;  4E2Y A;  4A3J I;  3GTO I;  4NBH A;  4X6A I;  2QKD A;  5D1P A;  5FLX f;  2VUM I;  2HF1 A;  2GTI A;  5IT9 f;  1KD1 2;  1SFO I;  3JAM f;  3D9X A;  1KQS Z;  4NBF A;  5IT9 b;  3S2D I;  3JAM b;  1K9M 1;  1VQO Z;  1VQK Z;  1P9N A;  4MD8 A;  4RVH A;  5A2Q f;  2JA5 I;  4RVG A;  1VQ8 1;  1KC8 2;  2F4O A;  3CPW Z;  2QRD B;  3MZL B;  3CCS 1;  4TNU A;  3CCR Z;  3MZK B;  2GTH A;  2E9H A;  2OTL 1;  4A3B I;  3I55 1;  3CCQ 1;  1RNI A;  2RBL A;  4HGZ A;  2NVY I;  3CCJ Z;  1X3W A;  4Y52 I;  2RPR A;  3VMH A;  2IZ4 A;  1K8A 1;  2K5R A;  2Y0S A;  2QA4 Z;  3CC2 Z;  2OTJ 1;  1S7M A;  3FKI I;  3CCM 1;  3LUS A;  1VQ6 Z;  3CCV 1;  5IP7 I;  3GKQ A;  2O4H A;  2V8I A;  1VQM 1;  1JJ2 Y;  2K3R A;  1YJ9 Z;  3HOZ I;  2YU9 I;  4A3D I;  4RVF A;  3I07 A;  5T6B A;  3T4N B;  1Q81 2;  5AN9 F;  1TFI A;  2QR1 B;  3G4S 1;  2JA6 I;  4MH4 A;  1QF8 A;  2JS4 A;  2WAQ A;  4QTT A;  3CC7 Z;  3FQQ A;  3G71 1;  3I56 1;  2OOY B;  4A3K I;  1X0T A;  1Q7Y 1;  1KRL A;  2LFU A;  1RO0 A;  2Q51 A;  3EER A;  3CCU Z;  2QLV B;  1YIT 1;  3I4M I;  1YUK A;  3QWU A;  4HGY A;  1S72 1;  3CPW Y;  4NB8 A;  3OW2 Z;  4A3E I;  1M90 1;  1VQ8 Z;  3CC4 1;  2PK7 A;  3H0G I;  5FLM I;  1QVF Y;  1Q86 2;  3PO3 S;  1Q82 2;  2EGT A;  1RQF A;  2P28 A;  4HH4 A;  2BJO A;  2OOX B;  1VQ5 Z;  3CCL 1;  4DQY B;  4NBG A;  1PFT A;  3CCQ Z;  1QYP A;  3NH4 A;  2J6A A;  1VQL 1;  1X3Z A;  2I3C A;  4A3G I;  4DK1 A;  5IP9 I;  3VB9 A;  2IZ3 A;  1VQ7 1;  4MON A;  2OTJ Z;  1TWF I;  4MXU A;  4S1T A;  3CCE Z;  1YJW 1;  1N8R 2;  4E31 A;  1R9T I;  3CCV Z;  2OZK A;  5CM2 M;  1Y1V S;  3CD6 1;  1W2B Z;  4NBE A;  3P5J B;  4BY7 I;  1YIJ 1;  2M48 A;  3S1M I;  4A93 I;  3TDH B;  2QEX 1;  3S14 I;  1VQM Z;  2NVX I;  1QVF Z;  1I50 I;  3BG1 B;  1WCM I;  2WB1 A;  5T64 A;  4A3I I;  2Q4Z A;  3K7A I;  2PMZ A;  3G4S Z;  4MD7 A;  1NJI 2;  3CMA 1;  1NUI A;  4E2Z A;  1NP6 A;  1VQN Z;  3S2H I;  3ESW A;  1YHQ Z;  3S16 I;  1L1O C;  3GTG I;  5C4X I;  1VQO 1;  1VQK 1;  3HOX I;  1Q82 1;  3CXC Z;  1KD1 1;  2V8J A;  3J80 f;  1VQ4 1;  3CME 1;  4E32 A;  3H3V J;  3OW2 Y;  2NVQ I;  1DL6 A;  1TWH I;  2DE6 A;  4BY1 I;  3J7A 4;  1M1K 2;  2R7Z I;  3J81 b;  3RZD I;  3J80 b;  1VQ9 Z;  3MON A;  2GU2 A;  1QVG Z;  1ZH1 A;  4A3C I;  2HU9 A;  3IX0 A;  3CCJ 1;  3CC4 Z;  1Z02 A;  2W04 A;  1KC8 1;  4A3F I;  1K9M 2;  2JR6 A;  1Z01 A;  5C44 I;  3CC2 1;  2VUG A;  3HKZ A;  1TWC I;  3VTN A;  3RZO I;  3HOY I;  1Z03 A;  1YUA A;  4AYB A;  1VQL Z;  4A3L I;  3U50 C;  3S17 I;  1W2B Y;  1YJ9 1;  1K73 2;  3M3Y I;  2R92 I;  1YJW Z;  2RIQ A;  2DE5 A;  4RS4 A;  2E2J I;  2V8K A;  1I6H I;  1K8A 2;  3BG0 B;  1YJN 1;  3CCS Z;  4E2W A;  2YAD A;  4QTU A;  3CC7 1;  2OTL Z;  3NDI A;  3GTK I;  1VQP 1;  4E33 A;  3I55 Z;  2R6M A;  1USP B;  3G6E 1;  1YI2 1;  3GTQ I;  3Q87 A;  2W03 A;  3S15 I;  2P3Y A;  1Q81 1;  3HOV I;  4NOZ A;  1M1K 1;  3CMA Z;  1ML8 A;  5C4J I;  3CCM Z;  3CCU 1;  4NBA A;  4NBB A;  4RV9 A;  3F3P C;  3TE5 B;  2LIY A;  3CXC Y;  2E2I I;  4E2X A;  4XX2 A;  2JMO A;  5FLX b;  4NFR A;  5D1O B;  3F3F C;  1LQL A;  1TWA I;  1N2F A;  4RVD A;  2R93 I;  3S1R I;  2PM9 A;  2E2H I;  3M4O I;  3D6W A;  1K83 I;  3CME Z;  1VQ4 Z;  3GCF A;  2DE7 A;  1QVG Y;  1Q7Y 2;  5LL6 f;  2F4M A;  3S1Q I;  4NBC A;  3GTM S;  5C3E I;  5T67 A;  3NDJ A;  2G2K A;  5A2Q b;  3VMI A;  1VQ5 1;  3KIF A;  2JNY A;  2KI7 B;  2O53 A;  1RO2 A;  1VLA A;  3G71 Z;  3IF8 A;  3I56 Z;  3EED A;  3GTP I;  3I4N I;  1K73 1;  3IFU A;  2B63 I;  2JA8 I;  2QRC B;  1Y1W I;  4MRI A;  2RT9 A;  3FQM A;  1Q86 1;  4MD9 A;  2AKL A;  1M90 2;  3CQZ I;  3J81 f;  2VF1 A;  4E30 A;  1ZB9 A;  3CCE 1;  4A3M I;  3HOW I;  4DGL A;  3PO3 I;  1USP A;  1RLY A;  1YIT Z;  3S1N I;  1S72 Z;  3NH5 A;  3CCR 1;  1WII A;  2NVT I;  4BBR I;  1JWH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...