3HOVI

Complete rna polymerase ii elongation complex ii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hovI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hovI02
1X3ZA 1YUAA 3GTOI 3CQZI 3S1RI 3GTPI 3S2DI 2DE5A 4BY1I 1R9TI 1I6HI 4A3FI 3S2HI 4NBCA 4NBGA 2YU9I 3S14I 1USPA 1ZB9A 3S15I 2E2HI 1QYPA 2R7ZI 4A3DI 2R93I 4BY7I 1WCMI 3HOVI 1WW9A 4A3BI 3PO3S 1N2FA 4MH4A 3RZDI 2B63I 1TWCI 2JA7I 4A3KI 2DE6A 3GTMS 3I4NI 2JA5I 3S1MI 3VMGA 2BJOA 1ZB8A 3K7AI 3I4MI 2HF1A 1USPB 2J6AA 3RZOI 2NVXI 4Y52I 4NOZA 2E2II 4NBBA 1TFIA 3ESWA 4A3MI 3LUSA 3FKII 3I07A 3PO2I 3Q87A 3VMIA 2E2JI 3H0GI 3U50C 1TWHI 3HOUI 4Y7NI 3D6WA 1TWGI 4BBSI 4NBHA 3H3VJ 2F4OA 2JA6I 3GTLI 5CM2M 4X6AI 1Y1WI 3PO3I 1Y1VS 3M4OI 5C44I 3GTMI 3VB9A 1I3QI 1PFTA 4QTUA 1NUIA 4NB8A 3GTGI 2DE7A 3S17I 4A3GI 3EERA 1SFOI 3S1NI 4A3JI 2VUMI 4NB9A 4XX2A 4A93I 1LQLA 1K83I 1RLYA 2JR6A 2PK7A 1X3WA 2KPIA 3GTQI 2R92I 3HOZI 5C4JI 1TWFI 3S16I 4NBDA 5IP7I 2K5RA 2JS4A 1L1OC 3GTJI 5C3EI 2NVYI 2RBLA 3S1QI 4NBEA 1I50I 3HOXI 1VLAA 4BXXI 2NVTI 5C4XI 1RO4A 3GCFA 4A3II 2AKLA 4A3CI 4QTTA 1Y1VI 3M3YI 4NBFA 2JNYA 3GKQA 5IP9I 2JA8I 2NVQI 3VMHA 3HOWI 4A3EI 2F4MA 1ML8A 4A3LI 4BBRI 3GTKI 1DL6A 1TWAI 2P3YA 3HOYI 4NBAA 5FLMI
chains in the Genus database with same CATH superfamily
3GTOI 1W2BY 3T4NB 2JIMA 3NFZA 1Q861 4BY1I 1I6HI 2QEXZ 4EWCA 4A3FI 1YJ9Z 1VQ6Z 3S14I 1USPA 2GTIA 1NJI1 3EEDA 1Q822 2OTLZ 1WJ2A 3G4S1 2R93I 2V3VA 3P5JB 2EGTA 5D1PA 1S7MA 1VQ51 1VQ71 3CCE1 2B63I 1YJN1 1KRLA 3VMGA 3CC2Z 3CC41 2W03A 3I4MI 1USPB 1VQ81 3IFUA 4NBBA 2RIQA 1VQN1 3JAMb 5IT9b 2OZKA 3PO2I 1YI2Z 1Q862 2Y0SA 3D9XA 5AN9F 3G6E1 3D6WA 2QRDB 4BBSI 3OW2Z 1NJI2 2YADA 5CM2M 4X6AI 3PO3I 1Y1VS 3CMAZ 1KQSZ 1VQPZ 5C44I 3GTMI 1I3QI 2WB1A 3CCJ1 1P9NA 1NUIA 2IZ4A 3CCVZ 4A3GI 4E31A 5T67A 1M901 1Z01A 2RPRA 1FDOA 2E7ZA 3CD61 1RLYA 2JR6A 2O4HA 3CME1 3GTQI 3F3FC 1TWFI 1WZNA 3S16I 4NBDA 2K5RA 2Q4ZA 1L1OC 1Z02A 1RNIA 1VLAA 3CCL1 1X0TA 2AKLA 3CC71 2VPYA 4DK1A 3MZLB 2KI7B 2W04A 2QA4Z 2IV2X 4BBRI 3CPWZ 1TWAI 2P3YA 1YIT1 3HOYI 4NBAA 1YIJ1 3S1RI 2DE5A 1M902 2RT9A 1KD11 2OTJZ 1QYPA 2JIPA 4A3DI 4E2WA 3J81b 2V8KA 2QEX1 2JMOA 2JIRA 3HOVI 1WW9A 1VQ61 3PO3S 2JUBA 1N2FA 3RZDI 4MD9A 2VUGA 1TWCI 3I56Z 1N8R1 2JA7I 4A3KI 2DE6A 3GTMS 3I4NI 3G71Z 4E2XA 2JA5I 3FQQA 3OW2Y 3CXCZ 3I55Z 2LIYA 1ZB8A 2HF1A 2J6AA 5A2Qf 1NP6A 1TFIA 1KQSY 3ESWA 3KIHA 4RVDA 1VQLZ 3CCQ1 1K731 3FKII 5FLXb 1VQKZ 2E2JI 3H0GI 3CC21 3IF8A 4TNUA 1KD12 3J80f 4NFRA 1YJWZ 4MD8A 1FDIA 4RV9A 2JA6I 3GTLI 1YI21 1VQ9Z 2QR1B 3D2LA 4E33A 4DGLA 1N8R2 4E2YA 1KC81 3S1NI 3CCU1 2VUMI 4XX2A 3CMA1 1M1K1 5LL6f 2KPIA 1K732 2JS4A 3GTJI 3CPWY 1Q16A 5C3EI 3S1QI 4NBEA 1I50I 2G2KA 1RO4A 2PMZA 1QVFZ 2JNYA 3GKQA 2JA8I 3VMHA 3HOWI 4A3EI 4A3LI 3GTKI 1VQ8Z 3NH5A 2VF1A 2M48A 2O53A 1AA6A 5FLMI 1YUAA 1KC82 3GTPI 1M1K2 2Q51A 1R9TI 3CXCY 4NBCA 2YU9I 2V8JA 1ZB9A 3S15I 3NDIA 3NDJA 2LEXA 2IZ3A 4BY7I 2QRCB 3NH4A 4MD7A 4A3BI 4MH4A 3CCJZ 4AYBA 1VQ41 1YUKA 1QXFA 2OTJ1 3CCMZ 1YHQ1 3S1MI 2BJOA 2V8IA 3CD6Z 3CMEZ 4CL1A 2NVXI 2JIQA 4Y52I 2E2II 4A3MI 2VPZA 3I561 2QLVB 1VQMZ 2LFUA 4HGYA 3G711 2OOYB 3CCSZ 3CCR1 3I551 1YJ91 3HOUI 4Y7NI 1VQOZ 1RO0A 3CC7Z 1TWGI 1VQL1 3H3VJ 5T6BA 2OTL1 1Y1WI 2VPWA 3M4OI 1RQFA 1QVGZ 1PFTA 1QVFY 3KIFA 4RVFA 2DE7A 2I3CA 3S17I 1S72Z 1SFOI 4A3JI 4A93I 4MXUA 1K83I 1VQ91 3HKZA 2PK7A 3HOZI 2AYDA 4HH4A 5C4JI 2VPXA 4MONA 1WIIA 1K8A1 2NAPA 3MONA 2NVTI 5C4XI 5A2Qb 3GCFA 1ZH1A 4RVHA 3TDHB 3M3YI 2K3RA 5T64A 3JAMf 5IT9f 5IP9I 2F4MA 1ML8A 2OOXB 2E9HA 3J80b 2QKDA 1QF8A 1SIWA 1K9M1 1VQP1 2WAQA 1DL6A 3CCQZ 2P28A 2V45A 1X3ZA 2HU9A 3CQZI 3G4SZ 3CCV1 3S2DI 3BG0B 2R6MA 3S2HI 2JIOA 1VQ5Z 3J7A4 4NBGA 1VQ7Z 3CCEZ 2E2HI 1JJ2Y 2ZAEB 1YJNZ 2RHBA 2R7ZI 1K8A2 3VTNA 3CC4Z 1WCMI 4NH1C 1W2BZ 1VQNZ 1Q811 3CCUZ 2QREB 2QA41 1K9M2 3K7AI 3RZOI 3G6EZ 4NOZA 3IR7A 1QVGY 3LUSA 3I07A 5D1OA 3IX0A 3CCM1 3Q87A 3VMIA 1JWHC 2H85A 3U50C 1TWHI 4E30A 4NBHA 1VQM1 2F4OA 3CCS1 4E2ZA 1Q7Y1 1VQO1 3VB9A 3F3PC 1JJ2Z 4QTUA 5D1OB 4NB8A 4E32A 3GTGI 1Q812 1Y8CA 1RO2A 3EERA 3QWUA 3J81f 3NH8A 2GU2A 3FQMA 4NB9A 3CCLZ 1LQLA 1X3WA 2R92I 4HGZA 5IP7I 2PM9A 1Q821 2NVYI 2RBLA 4DQYB 1S721 1VQK1 3HOXI 4BXXI 2M6NA 3MZKB 4A3II 3BG1B 1YJW1 3TE5B 4RS4A 1VQ4Z 1Z03A 4RVGA 1YITZ 4QTTA 1Y1VI 4A3CI 4NBFA 4S1TA 1YHQZ 2NVQI 5FLXf 1YIJZ 2GTHA 1Q7Y2 4MRIA 3CCRZ
chains in the Genus database with same CATH topology
3GTOI 1W2BY 3T4NB 3NFZA 1Q861 4BY1I 1I6HI 2QEXZ 4EWCA 4A3FI 1YJ9Z 1VQ6Z 3S14I 1USPA 2GTIA 1NJI1 3EEDA 1Q822 2OTLZ 3G4S1 2R93I 3P5JB 2EGTA 5D1PA 1S7MA 1VQ51 1VQ71 3CCE1 2B63I 1YJN1 1KRLA 3VMGA 3CC2Z 3CC41 2W03A 3I4MI 1USPB 1VQ81 3IFUA 4NBBA 2RIQA 1VQN1 3JAMb 5IT9b 2OZKA 3PO2I 1YI2Z 1Q862 2Y0SA 3D9XA 5AN9F 3G6E1 3D6WA 2QRDB 4BBSI 3OW2Z 1NJI2 2YADA 5CM2M 4X6AI 3PO3I 1Y1VS 3CMAZ 1KQSZ 1VQPZ 5C44I 3GTMI 1I3QI 2WB1A 3CCJ1 1P9NA 1NUIA 2IZ4A 3CCVZ 4A3GI 4E31A 5T67A 1M901 1Z01A 2RPRA 3CD61 1RLYA 2JR6A 2O4HA 3CME1 3GTQI 3F3FC 1TWFI 3S16I 4NBDA 2K5RA 2Q4ZA 1L1OC 1Z02A 1RNIA 1VLAA 3CCL1 1X0TA 2AKLA 3CC71 4DK1A 3MZLB 2KI7B 2W04A 2QA4Z 4BBRI 3CPWZ 1TWAI 2P3YA 1YIT1 3HOYI 4NBAA 1YIJ1 3S1RI 2DE5A 1M902 2RT9A 1KD11 2OTJZ 1QYPA 4A3DI 4E2WA 3J81b 2V8KA 2QEX1 2JMOA 3HOVI 1WW9A 1VQ61 3PO3S 2JUBA 1N2FA 3RZDI 4MD9A 2VUGA 1TWCI 3I56Z 1N8R1 2JA7I 4A3KI 2DE6A 3GTMS 3I4NI 3G71Z 4E2XA 2JA5I 3FQQA 3OW2Y 3CXCZ 3I55Z 2LIYA 1ZB8A 2HF1A 2J6AA 5A2Qf 1NP6A 1TFIA 1KQSY 3ESWA 3KIHA 4RVDA 1VQLZ 3CCQ1 1K731 3FKII 5FLXb 1VQKZ 2E2JI 3H0GI 3CC21 3IF8A 4TNUA 1KD12 3J80f 4NFRA 1YJWZ 4MD8A 4RV9A 2JA6I 3GTLI 1YI21 1VQ9Z 2QR1B 4E33A 4DGLA 1N8R2 4E2YA 1KC81 3S1NI 3CCU1 2VUMI 4XX2A 3CMA1 1M1K1 5LL6f 2KPIA 1K732 2JS4A 3GTJI 3CPWY 5C3EI 3S1QI 4NBEA 1I50I 2G2KA 1RO4A 2PMZA 1QVFZ 2JNYA 3GKQA 2JA8I 3VMHA 3HOWI 4A3EI 4A3LI 3GTKI 1VQ8Z 3NH5A 2VF1A 2M48A 2O53A 5FLMI 1YUAA 1KC82 3GTPI 1M1K2 2Q51A 1R9TI 3CXCY 4NBCA 2YU9I 2V8JA 1ZB9A 3S15I 3NDIA 3NDJA 2IZ3A 4BY7I 2QRCB 3NH4A 4MD7A 4A3BI 4MH4A 3CCJZ 4AYBA 1VQ41 1YUKA 2OTJ1 3CCMZ 1YHQ1 3S1MI 2BJOA 2V8IA 3CD6Z 3CMEZ 4CL1A 2NVXI 4Y52I 2E2II 4A3MI 3I561 2QLVB 1VQMZ 2LFUA 4HGYA 3G711 2OOYB 3CCSZ 3CCR1 3I551 1YJ91 3HOUI 4Y7NI 1VQOZ 1RO0A 3CC7Z 1TWGI 1VQL1 3H3VJ 5T6BA 2OTL1 1Y1WI 3M4OI 1RQFA 1QVGZ 1PFTA 1QVFY 3KIFA 4RVFA 2DE7A 2I3CA 3S17I 1S72Z 1SFOI 4A3JI 4A93I 4MXUA 1K83I 1VQ91 3HKZA 2PK7A 3HOZI 4HH4A 5C4JI 4MONA 1WIIA 1K8A1 3MONA 2NVTI 5C4XI 5A2Qb 3GCFA 1ZH1A 4RVHA 3TDHB 3M3YI 2K3RA 5T64A 3JAMf 5IT9f 5IP9I 2F4MA 1ML8A 2OOXB 2E9HA 3J80b 2QKDA 1QF8A 1K9M1 1VQP1 2WAQA 1DL6A 3CCQZ 2P28A 1X3ZA 2HU9A 3CQZI 3G4SZ 3CCV1 3S2DI 3BG0B 2R6MA 3S2HI 1VQ5Z 3J7A4 4NBGA 1VQ7Z 3CCEZ 2E2HI 1JJ2Y 2ZAEB 1YJNZ 2RHBA 2R7ZI 1K8A2 3VTNA 3CC4Z 1WCMI 4NH1C 1W2BZ 1VQNZ 1Q811 3CCUZ 2QREB 2QA41 1K9M2 3K7AI 3RZOI 3G6EZ 4NOZA 1QVGY 3LUSA 3I07A 5D1OA 3IX0A 3CCM1 3Q87A 3VMIA 1JWHC 2H85A 3U50C 1TWHI 4E30A 4NBHA 1VQM1 2F4OA 3CCS1 4E2ZA 1Q7Y1 1VQO1 3VB9A 3F3PC 1JJ2Z 4QTUA 5D1OB 4NB8A 4E32A 3GTGI 1Q812 1RO2A 3EERA 3QWUA 3J81f 3NH8A 2GU2A 3FQMA 4NB9A 3CCLZ 1LQLA 1X3WA 2R92I 4HGZA 5IP7I 2PM9A 1Q821 2NVYI 2RBLA 4DQYB 1S721 1VQK1 3HOXI 4BXXI 2M6NA 3MZKB 4A3II 3BG1B 1YJW1 3TE5B 4RS4A 1VQ4Z 1Z03A 4RVGA 1YITZ 4QTTA 1Y1VI 4A3CI 4NBFA 4S1TA 1YHQZ 2NVQI 5FLXf 1YIJZ 2GTHA 1Q7Y2 4MRIA 3CCRZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Z A;  1YUA A;  3GTO I;  3CQZ I;  3S1R I;  3GTP I;  3S2D I;  2DE5 A;  4BY1 I;  1R9T I;  1I6H I;  4A3F I;  3S2H I;  4NBC A;  4NBG A;  2YU9 I;  3S14 I;  1USP A;  1ZB9 A;  3S15 I;  2E2H I;  1QYP A;  2R7Z I;  4A3D I;  2R93 I;  4BY7 I;  1WCM I;  3HOV I;  1WW9 A;  4A3B I;  3PO3 S;  1N2F A;  4MH4 A;  3RZD I;  2B63 I;  1TWC I;  2JA7 I;  4A3K I;  2DE6 A;  3GTM S;  3I4N I;  2JA5 I;  3S1M I;  3VMG A;  2BJO A;  1ZB8 A;  3K7A I;  3I4M I;  2HF1 A;  1USP B;  2J6A A;  3RZO I;  2NVX I;  4Y52 I;  4NOZ A;  2E2I I;  4NBB A;  1TFI A;  3ESW A;  4A3M I;  3LUS A;  3FKI I;  3I07 A;  3PO2 I;  3Q87 A;  3VMI A;  2E2J I;  3H0G I;  3U50 C;  1TWH I;  3HOU I;  4Y7N I;  3D6W A;  1TWG I;  4BBS I;  4NBH A;  3H3V J;  2F4O A;  2JA6 I;  3GTL I;  5CM2 M;  4X6A I;  1Y1W I;  3PO3 I;  1Y1V S;  3M4O I;  5C44 I;  3GTM I;  3VB9 A;  1I3Q I;  1PFT A;  4QTU A;  1NUI A;  4NB8 A;  3GTG I;  2DE7 A;  3S17 I;  4A3G I;  3EER A;  1SFO I;  3S1N I;  4A3J I;  2VUM I;  4NB9 A;  4XX2 A;  4A93 I;  1LQL A;  1K83 I;  1RLY A;  2JR6 A;  2PK7 A;  1X3W A;  2KPI A;  3GTQ I;  2R92 I;  3HOZ I;  5C4J I;  1TWF I;  3S16 I;  4NBD A;  5IP7 I;  2K5R A;  2JS4 A;  1L1O C;  3GTJ I;  5C3E I;  2NVY I;  2RBL A;  3S1Q I;  4NBE A;  1I50 I;  3HOX I;  1VLA A;  4BXX I;  2NVT I;  5C4X I;  1RO4 A;  3GCF A;  4A3I I;  2AKL A;  4A3C I;  4QTT A;  1Y1V I;  3M3Y I;  4NBF A;  2JNY A;  3GKQ A;  5IP9 I;  2JA8 I;  2NVQ I;  3VMH A;  3HOW I;  4A3E I;  2F4M A;  1ML8 A;  4A3L I;  4BBR I;  3GTK I;  1DL6 A;  1TWA I;  2P3Y A;  3HOY I;  4NBA A;  5FLM I; 
#chains in the Genus database with same CATH topology
 3GTO I;  1W2B Y;  3T4N B;  2JIM A;  3NFZ A;  1Q86 1;  4BY1 I;  1I6H I;  2QEX Z;  4EWC A;  4A3F I;  1YJ9 Z;  1VQ6 Z;  3S14 I;  1USP A;  2GTI A;  1NJI 1;  3EED A;  1Q82 2;  2OTL Z;  1WJ2 A;  3G4S 1;  2R93 I;  2V3V A;  3P5J B;  2EGT A;  5D1P A;  1S7M A;  1VQ5 1;  1VQ7 1;  3CCE 1;  2B63 I;  1YJN 1;  1KRL A;  3VMG A;  3CC2 Z;  3CC4 1;  2W03 A;  3I4M I;  1USP B;  1VQ8 1;  3IFU A;  4NBB A;  2RIQ A;  1VQN 1;  3JAM b;  5IT9 b;  2OZK A;  3PO2 I;  1YI2 Z;  1Q86 2;  2Y0S A;  3D9X A;  5AN9 F;  3G6E 1;  3D6W A;  2QRD B;  4BBS I;  3OW2 Z;  1NJI 2;  2YAD A;  5CM2 M;  4X6A I;  3PO3 I;  1Y1V S;  3CMA Z;  1KQS Z;  1VQP Z;  5C44 I;  3GTM I;  1I3Q I;  2WB1 A;  3CCJ 1;  1P9N A;  1NUI A;  2IZ4 A;  3CCV Z;  4A3G I;  4E31 A;  5T67 A;  1M90 1;  1Z01 A;  2RPR A;  1FDO A;  2E7Z A;  3CD6 1;  1RLY A;  2JR6 A;  2O4H A;  3CME 1;  3GTQ I;  3F3F C;  1TWF I;  1WZN A;  3S16 I;  4NBD A;  2K5R A;  2Q4Z A;  1L1O C;  1Z02 A;  1RNI A;  1VLA A;  3CCL 1;  1X0T A;  2AKL A;  3CC7 1;  2VPY A;  4DK1 A;  3MZL B;  2KI7 B;  2W04 A;  2QA4 Z;  2IV2 X;  4BBR I;  3CPW Z;  1TWA I;  2P3Y A;  1YIT 1;  3HOY I;  4NBA A;  1YIJ 1;  3S1R I;  2DE5 A;  1M90 2;  2RT9 A;  1KD1 1;  2OTJ Z;  1QYP A;  2JIP A;  4A3D I;  4E2W A;  3J81 b;  2V8K A;  2QEX 1;  2JMO A;  2JIR A;  3HOV I;  1WW9 A;  1VQ6 1;  3PO3 S;  2JUB A;  1N2F A;  3RZD I;  4MD9 A;  2VUG A;  1TWC I;  3I56 Z;  1N8R 1;  2JA7 I;  4A3K I;  2DE6 A;  3GTM S;  3I4N I;  3G71 Z;  4E2X A;  2JA5 I;  3FQQ A;  3OW2 Y;  3CXC Z;  3I55 Z;  2LIY A;  1ZB8 A;  2HF1 A;  2J6A A;  5A2Q f;  1NP6 A;  1TFI A;  1KQS Y;  3ESW A;  3KIH A;  4RVD A;  1VQL Z;  3CCQ 1;  1K73 1;  3FKI I;  5FLX b;  1VQK Z;  2E2J I;  3H0G I;  3CC2 1;  3IF8 A;  4TNU A;  1KD1 2;  3J80 f;  4NFR A;  1YJW Z;  4MD8 A;  1FDI A;  4RV9 A;  2JA6 I;  3GTL I;  1YI2 1;  1VQ9 Z;  2QR1 B;  3D2L A;  4E33 A;  4DGL A;  1N8R 2;  4E2Y A;  1KC8 1;  3S1N I;  3CCU 1;  2VUM I;  4XX2 A;  3CMA 1;  1M1K 1;  5LL6 f;  2KPI A;  1K73 2;  2JS4 A;  3GTJ I;  3CPW Y;  1Q16 A;  5C3E I;  3S1Q I;  4NBE A;  1I50 I;  2G2K A;  1RO4 A;  2PMZ A;  1QVF Z;  2JNY A;  3GKQ A;  2JA8 I;  3VMH A;  3HOW I;  4A3E I;  4A3L I;  3GTK I;  1VQ8 Z;  3NH5 A;  2VF1 A;  2M48 A;  2O53 A;  1AA6 A;  5FLM I;  1YUA A;  1KC8 2;  3GTP I;  1M1K 2;  2Q51 A;  1R9T I;  3CXC Y;  4NBC A;  2YU9 I;  2V8J A;  1ZB9 A;  3S15 I;  3NDI A;  3NDJ A;  2LEX A;  2IZ3 A;  4BY7 I;  2QRC B;  3NH4 A;  4MD7 A;  4A3B I;  4MH4 A;  3CCJ Z;  4AYB A;  1VQ4 1;  1YUK A;  1QXF A;  2OTJ 1;  3CCM Z;  1YHQ 1;  3S1M I;  2BJO A;  2V8I A;  3CD6 Z;  3CME Z;  4CL1 A;  2NVX I;  2JIQ A;  4Y52 I;  2E2I I;  4A3M I;  2VPZ A;  3I56 1;  2QLV B;  1VQM Z;  2LFU A;  4HGY A;  3G71 1;  2OOY B;  3CCS Z;  3CCR 1;  3I55 1;  1YJ9 1;  3HOU I;  4Y7N I;  1VQO Z;  1RO0 A;  3CC7 Z;  1TWG I;  1VQL 1;  3H3V J;  5T6B A;  2OTL 1;  1Y1W I;  2VPW A;  3M4O I;  1RQF A;  1QVG Z;  1PFT A;  1QVF Y;  3KIF A;  4RVF A;  2DE7 A;  2I3C A;  3S17 I;  1S72 Z;  1SFO I;  4A3J I;  4A93 I;  4MXU A;  1K83 I;  1VQ9 1;  3HKZ A;  2PK7 A;  3HOZ I;  2AYD A;  4HH4 A;  5C4J I;  2VPX A;  4MON A;  1WII A;  1K8A 1;  2NAP A;  3MON A;  2NVT I;  5C4X I;  5A2Q b;  3GCF A;  1ZH1 A;  4RVH A;  3TDH B;  3M3Y I;  2K3R A;  5T64 A;  3JAM f;  5IT9 f;  5IP9 I;  2F4M A;  1ML8 A;  2OOX B;  2E9H A;  3J80 b;  2QKD A;  1QF8 A;  1SIW A;  1K9M 1;  1VQP 1;  2WAQ A;  1DL6 A;  3CCQ Z;  2P28 A;  2V45 A;  1X3Z A;  2HU9 A;  3CQZ I;  3G4S Z;  3CCV 1;  3S2D I;  3BG0 B;  2R6M A;  3S2H I;  2JIO A;  1VQ5 Z;  3J7A 4;  4NBG A;  1VQ7 Z;  3CCE Z;  2E2H I;  1JJ2 Y;  2ZAE B;  1YJN Z;  2RHB A;  2R7Z I;  1K8A 2;  3VTN A;  3CC4 Z;  1WCM I;  4NH1 C;  1W2B Z;  1VQN Z;  1Q81 1;  3CCU Z;  2QRE B;  2QA4 1;  1K9M 2;  3K7A I;  3RZO I;  3G6E Z;  4NOZ A;  3IR7 A;  1QVG Y;  3LUS A;  3I07 A;  5D1O A;  3IX0 A;  3CCM 1;  3Q87 A;  3VMI A;  1JWH C;  2H85 A;  3U50 C;  1TWH I;  4E30 A;  4NBH A;  1VQM 1;  2F4O A;  3CCS 1;  4E2Z A;  1Q7Y 1;  1VQO 1;  3VB9 A;  3F3P C;  1JJ2 Z;  4QTU A;  5D1O B;  4NB8 A;  4E32 A;  3GTG I;  1Q81 2;  1Y8C A;  1RO2 A;  3EER A;  3QWU A;  3J81 f;  3NH8 A;  2GU2 A;  3FQM A;  4NB9 A;  3CCL Z;  1LQL A;  1X3W A;  2R92 I;  4HGZ A;  5IP7 I;  2PM9 A;  1Q82 1;  2NVY I;  2RBL A;  4DQY B;  1S72 1;  1VQK 1;  3HOX I;  4BXX I;  2M6N A;  3MZK B;  4A3I I;  3BG1 B;  1YJW 1;  3TE5 B;  4RS4 A;  1VQ4 Z;  1Z03 A;  4RVG A;  1YIT Z;  4QTT A;  1Y1V I;  4A3C I;  4NBF A;  4S1T A;  1YHQ Z;  2NVQ I;  5FLX f;  1YIJ Z;  2GTH A;  1Q7Y 2;  4MRI A;  3CCR Z; 
#chains in the Genus database with same CATH homology
 3GTO I;  1W2B Y;  3T4N B;  3NFZ A;  1Q86 1;  4BY1 I;  1I6H I;  2QEX Z;  4EWC A;  4A3F I;  1YJ9 Z;  1VQ6 Z;  3S14 I;  1USP A;  2GTI A;  1NJI 1;  3EED A;  1Q82 2;  2OTL Z;  3G4S 1;  2R93 I;  3P5J B;  2EGT A;  5D1P A;  1S7M A;  1VQ5 1;  1VQ7 1;  3CCE 1;  2B63 I;  1YJN 1;  1KRL A;  3VMG A;  3CC2 Z;  3CC4 1;  2W03 A;  3I4M I;  1USP B;  1VQ8 1;  3IFU A;  4NBB A;  2RIQ A;  1VQN 1;  3JAM b;  5IT9 b;  2OZK A;  3PO2 I;  1YI2 Z;  1Q86 2;  2Y0S A;  3D9X A;  5AN9 F;  3G6E 1;  3D6W A;  2QRD B;  4BBS I;  3OW2 Z;  1NJI 2;  2YAD A;  5CM2 M;  4X6A I;  3PO3 I;  1Y1V S;  3CMA Z;  1KQS Z;  1VQP Z;  5C44 I;  3GTM I;  1I3Q I;  2WB1 A;  3CCJ 1;  1P9N A;  1NUI A;  2IZ4 A;  3CCV Z;  4A3G I;  4E31 A;  5T67 A;  1M90 1;  1Z01 A;  2RPR A;  3CD6 1;  1RLY A;  2JR6 A;  2O4H A;  3CME 1;  3GTQ I;  3F3F C;  1TWF I;  3S16 I;  4NBD A;  2K5R A;  2Q4Z A;  1L1O C;  1Z02 A;  1RNI A;  1VLA A;  3CCL 1;  1X0T A;  2AKL A;  3CC7 1;  4DK1 A;  3MZL B;  2KI7 B;  2W04 A;  2QA4 Z;  4BBR I;  3CPW Z;  1TWA I;  2P3Y A;  1YIT 1;  3HOY I;  4NBA A;  1YIJ 1;  3S1R I;  2DE5 A;  1M90 2;  2RT9 A;  1KD1 1;  2OTJ Z;  1QYP A;  4A3D I;  4E2W A;  3J81 b;  2V8K A;  2QEX 1;  2JMO A;  3HOV I;  1WW9 A;  1VQ6 1;  3PO3 S;  2JUB A;  1N2F A;  3RZD I;  4MD9 A;  2VUG A;  1TWC I;  3I56 Z;  1N8R 1;  2JA7 I;  4A3K I;  2DE6 A;  3GTM S;  3I4N I;  3G71 Z;  4E2X A;  2JA5 I;  3FQQ A;  3OW2 Y;  3CXC Z;  3I55 Z;  2LIY A;  1ZB8 A;  2HF1 A;  2J6A A;  5A2Q f;  1NP6 A;  1TFI A;  1KQS Y;  3ESW A;  3KIH A;  4RVD A;  1VQL Z;  3CCQ 1;  1K73 1;  3FKI I;  5FLX b;  1VQK Z;  2E2J I;  3H0G I;  3CC2 1;  3IF8 A;  4TNU A;  1KD1 2;  3J80 f;  4NFR A;  1YJW Z;  4MD8 A;  4RV9 A;  2JA6 I;  3GTL I;  1YI2 1;  1VQ9 Z;  2QR1 B;  4E33 A;  4DGL A;  1N8R 2;  4E2Y A;  1KC8 1;  3S1N I;  3CCU 1;  2VUM I;  4XX2 A;  3CMA 1;  1M1K 1;  5LL6 f;  2KPI A;  1K73 2;  2JS4 A;  3GTJ I;  3CPW Y;  5C3E I;  3S1Q I;  4NBE A;  1I50 I;  2G2K A;  1RO4 A;  2PMZ A;  1QVF Z;  2JNY A;  3GKQ A;  2JA8 I;  3VMH A;  3HOW I;  4A3E I;  4A3L I;  3GTK I;  1VQ8 Z;  3NH5 A;  2VF1 A;  2M48 A;  2O53 A;  5FLM I;  1YUA A;  1KC8 2;  3GTP I;  1M1K 2;  2Q51 A;  1R9T I;  3CXC Y;  4NBC A;  2YU9 I;  2V8J A;  1ZB9 A;  3S15 I;  3NDI A;  3NDJ A;  2IZ3 A;  4BY7 I;  2QRC B;  3NH4 A;  4MD7 A;  4A3B I;  4MH4 A;  3CCJ Z;  4AYB A;  1VQ4 1;  1YUK A;  2OTJ 1;  3CCM Z;  1YHQ 1;  3S1M I;  2BJO A;  2V8I A;  3CD6 Z;  3CME Z;  4CL1 A;  2NVX I;  4Y52 I;  2E2I I;  4A3M I;  3I56 1;  2QLV B;  1VQM Z;  2LFU A;  4HGY A;  3G71 1;  2OOY B;  3CCS Z;  3CCR 1;  3I55 1;  1YJ9 1;  3HOU I;  4Y7N I;  1VQO Z;  1RO0 A;  3CC7 Z;  1TWG I;  1VQL 1;  3H3V J;  5T6B A;  2OTL 1;  1Y1W I;  3M4O I;  1RQF A;  1QVG Z;  1PFT A;  1QVF Y;  3KIF A;  4RVF A;  2DE7 A;  2I3C A;  3S17 I;  1S72 Z;  1SFO I;  4A3J I;  4A93 I;  4MXU A;  1K83 I;  1VQ9 1;  3HKZ A;  2PK7 A;  3HOZ I;  4HH4 A;  5C4J I;  4MON A;  1WII A;  1K8A 1;  3MON A;  2NVT I;  5C4X I;  5A2Q b;  3GCF A;  1ZH1 A;  4RVH A;  3TDH B;  3M3Y I;  2K3R A;  5T64 A;  3JAM f;  5IT9 f;  5IP9 I;  2F4M A;  1ML8 A;  2OOX B;  2E9H A;  3J80 b;  2QKD A;  1QF8 A;  1K9M 1;  1VQP 1;  2WAQ A;  1DL6 A;  3CCQ Z;  2P28 A;  1X3Z A;  2HU9 A;  3CQZ I;  3G4S Z;  3CCV 1;  3S2D I;  3BG0 B;  2R6M A;  3S2H I;  1VQ5 Z;  3J7A 4;  4NBG A;  1VQ7 Z;  3CCE Z;  2E2H I;  1JJ2 Y;  2ZAE B;  1YJN Z;  2RHB A;  2R7Z I;  1K8A 2;  3VTN A;  3CC4 Z;  1WCM I;  4NH1 C;  1W2B Z;  1VQN Z;  1Q81 1;  3CCU Z;  2QRE B;  2QA4 1;  1K9M 2;  3K7A I;  3RZO I;  3G6E Z;  4NOZ A;  1QVG Y;  3LUS A;  3I07 A;  5D1O A;  3IX0 A;  3CCM 1;  3Q87 A;  3VMI A;  1JWH C;  2H85 A;  3U50 C;  1TWH I;  4E30 A;  4NBH A;  1VQM 1;  2F4O A;  3CCS 1;  4E2Z A;  1Q7Y 1;  1VQO 1;  3VB9 A;  3F3P C;  1JJ2 Z;  4QTU A;  5D1O B;  4NB8 A;  4E32 A;  3GTG I;  1Q81 2;  1RO2 A;  3EER A;  3QWU A;  3J81 f;  3NH8 A;  2GU2 A;  3FQM A;  4NB9 A;  3CCL Z;  1LQL A;  1X3W A;  2R92 I;  4HGZ A;  5IP7 I;  2PM9 A;  1Q82 1;  2NVY I;  2RBL A;  4DQY B;  1S72 1;  1VQK 1;  3HOX I;  4BXX I;  2M6N A;  3MZK B;  4A3I I;  3BG1 B;  1YJW 1;  3TE5 B;  4RS4 A;  1VQ4 Z;  1Z03 A;  4RVG A;  1YIT Z;  4QTT A;  1Y1V I;  4A3C I;  4NBF A;  4S1T A;  1YHQ Z;  2NVQ I;  5FLX f;  1YIJ Z;  2GTH A;  1Q7Y 2;  4MRI A;  3CCR Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...