3HOVI

Complete rna polymerase ii elongation complex ii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hovI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hovI02
1L1OC 2NVXI 3HOUI 3HOWI 2E2II 1NUIA 1RLYA 3GTOI 3D6WA 3GKQA 1DL6A 1YUAA 4X6AI 2F4OA 2NVYI 3I4MI 5FLMI 2K5RA 4A3MI 3I07A 3RZOI 3CQZI 3K7AI 1X3WA 5CM2M 2JR6A 1TWGI 2AKLA 4BY7I 3GTMI 3H0GI 4NBBA 1USPB 3HOXI 3I4NI 3VMHA 3LUSA 1I3QI 4NBCA 1I6HI 1ZB9A 2R92I 3S16I 3FKII 1N2FA 1ZB8A 2P3YA 2JA7I 1ML8A 2NVQI 3HOYI 3PO3I 3GTMS 1PFTA 5IP9I 4A93I 3VB9A 3S1QI 2JS4A 4A3CI 2KPIA 2DE7A 4A3KI 3GCFA 4BXXI 4A3GI 1RO4A 3S15I 5C4XI 5C3EI 2JA8I 3RZDI 4NBDA 4A3EI 2HF1A 1WW9A 1TWAI 4BBRI 2DE6A 4A3FI 5IP7I 2DE5A 4A3DI 4MH4A 1TWFI 1Y1WI 2F4MA 2VUMI 4XX2A 4QTTA 5C4JI 3PO2I 2B63I 3ESWA 3S2DI 3GTPI 2E2HI 2RBLA 2YU9I 1TWCI 1X3ZA 4Y7NI 3S14I 3PO3S 1VLAA 3S1MI 1I50I 2BJOA 4A3II 1SFOI 3M3YI 4QTUA 4NBHA 1TFIA 4A3LI 1QYPA 3S1NI 4NBEA 1WCMI 4A3JI 3M4OI 5C44I 2R7ZI 1Y1VI 3GTJI 3EERA 3S2HI 4BBSI 3GTKI 4NB9A 2E2JI 1USPA 2JA5I 2NVTI 4NOZA 4NBGA 3S17I 3H3VJ 2J6AA 1R9TI 3Q87A 1TWHI 4A3BI 4NBAA 3VMIA 3S1RI 2JA6I 1LQLA 3GTLI 1Y1VS 1K83I 3U50C 4NB8A 3VMGA 3GTQI 4Y52I 3GTGI 4BY1I 2R93I 3HOZI 3HOVI 4NBFA 2PK7A 2JNYA
chains in the Genus database with same CATH superfamily
1L1OC 3HOUI 3IF8A 1DL6A 1N8R2 1YUAA 3D2LA 3I4MI 2K5RA 2AYDA 3K7AI 1X3WA 5CM2M 2YADA 4BY7I 3H0GI 4MD7A 1Y8CA 1VQP1 2LEXA 3S16I 3FKII 1N2FA 1ZB8A 2JA7I 3CC71 2NVQI 1WIIA 3I561 1PFTA 1WJ2A 4A93I 2RIQA 2E7ZA 3CC7Z 5D1PA 3MZLB 2VPXA 2JA8I 3RZDI 3CCL1 2HF1A 1NP6A 1WW9A 4A3FI 3OW2Z 4A3DI 1TWFI 1Y1WI 2QKDA 3IR7A 5C4JI 2M6NA 3JAMb 2VPZA 3G6E1 4E31A 2E2HI 1YIJZ 1Q861 2RBLA 2VPWA 1X3ZA 2VUGA 4E2XA 3G6EZ 2W03A 1JWHC 3S1MI 4A3II 1RNIA 1KQSZ 1VQMZ 1TFIA 2E9HA 2V3VA 1S7MA 5A2Qf 4AYBA 1K8A1 2R7ZI 3CCM1 2W04A 2E2JI 2JA5I 3H3VJ 2J6AA 3MONA 3CD61 4A3BI 3NH5A 3S1RI 3GTLI 3U50C 3T4NB 4BY1I 3HOZI 1Q16A 5T6BA 2NVXI 1RLYA 3CCRZ 3D6WA 2QRDB 2F4OA 2NVYI 2G2KA 2V45A 4A3MI 3NDJA 2Q4ZA 1VQ9Z 1TWGI 3BG1B 2GTHA 1VQOZ 4NBBA 1USPB 2QA41 1Z03A 1NJI1 3F3FC 1KC81 2GU2A 4MRIA 2LFUA 2IZ3A 1QVFY 2P3YA 3GTMS 2LIYA 2RT9A 3J81b 4RV9A 4CL1A 1KQSY 2OOYB 1M901 4HH4A 3S1QI 4A3CI 5T67A 2DE7A 1VQKZ 4A3GI 3J7A4 5C4XI 5C3EI 3J80b 3KIHA 2PM9A 4DGLA 1VQ4Z 3BG0B 2F4MA 2VUMI 3NDIA 5IT9b 4QTTA 4E30A 3CXCY 1Z02A 3PO2I 3CMEZ 3CC2Z 1YITZ 3S2DI 1Q812 1RQFA 3GTPI 3NFZA 1VQ71 4HGYA 4RVGA 1Z01A 4RVHA 5FLXb 1TWCI 3S14I 1KRLA 1VLAA 1I50I 1VQ7Z 3M3YI 4DQYB 2HU9A 1Q821 1YIJ1 1WZNA 1VQN1 2JIRA 2JIMA 1W2BZ 3J80f 1QYPA 1WCMI 5AN9F 4A3JI 5C44I 2VPYA 1YUKA 4NB9A 2JMOA 1VQNZ 3QWUA 2NVTI 2K3RA 1VQM1 1VQ81 1TWHI 1YHQ1 1QVFZ 1S721 1Y1VS 4NB8A 3IFUA 2RHBA 1Q7Y1 3FQQA 3GTGI 1SIWA 2IV2X 5FLXf 1VQ6Z 2M48A 1VQ8Z 3TE5B 5IP9I 2JNYA 1YHQZ 1P9NA 1S72Z 3CCS1 3GTOI 3CCJZ 5FLMI 1M1K1 3I07A 2Q51A 3RZOI 4MONA 1KD11 3I55Z 1YI21 2RPRA 3CCSZ 1JJ2Y 3GTMI 3HOXI 3P5JB 3VMHA 3JAMf 2V8IA 3CXCZ 3NH4A 3LUSA 1I3QI 4NBCA 3CCR1 2JIQA 1ZB9A 5D1OA 2R92I 1YI2Z 1Q862 3PO3I 2O53A 1VQ91 3CMAZ 3VTNA 4E2WA 2R6MA 1VQO1 2EGTA 3VB9A 1YJW1 2QLVB 1W2BY 3GCFA 4BXXI 3S15I 4A3EI 4NH1C 1N8R1 2JIOA 2DE6A 1VQ51 1YJWZ 1K8A2 2DE5A 1M1K2 1VQLZ 1QF8A 1VQK1 3ESWA 4E2ZA 1VQ5Z 2WAQA 4HGZA 1VQ41 2OTJZ 4Y7NI 2OZKA 3CCQ1 1RO0A 3CCEZ 3PO3S 3CME1 3CC21 1YIT1 1SFOI 4EWCA 4MD9A 2V8JA 3CCV1 3IX0A 1YJNZ 3CCQZ 1K731 4E2YA 4RVFA 3G71Z 4A3LI 3S1NI 4NBEA 3M4OI 1YJ9Z 1Y1VI 3GTJI 4BBSI 2QR1B 1NJI2 3MZKB 1KC82 3CCVZ 2QRCB 2QEXZ 1JJ2Z 1QXFA 3TDHB 1USPA 1R9TI 4NBAA 1ZH1A 2JA6I 1LQLA 1RO2A 3J81f 1M902 2R93I 2P28A 2PK7A 1VQPZ 3HOWI 2E2II 1NUIA 4MXUA 2I3CA 3GKQA 4X6AI 3D9XA 1QVGZ 1AA6A 5A2Qb 3CQZI 1K732 2NAPA 2JR6A 4S1TA 2AKLA 3FQMA 4NFRA 3I56Z 2IZ4A 5IT9f 1VQ61 3I4NI 2O4HA 1I6HI 4RS4A 3CCJ1 3CCLZ 1ML8A 2JIPA 2OOXB 3HKZA 3HOYI 5D1OB 4E32A 3NH8A 3I551 1FDOA 3CPWY 2WB1A 2JS4A 2KPIA 4A3KI 3CCU1 1Q822 1RO4A 3EEDA 4NBDA 2GTIA 1TWAI 4BBRI 5IP7I 3CMA1 1K9M1 4MH4A 3CCUZ 4XX2A 4RVDA 2B63I 3F3PC 4TNUA 4DK1A 1Q7Y2 2Y0SA 2YU9I 2VF1A 1VQL1 2ZAEB 1QVGY 2OTL1 3CCMZ 2BJOA 2QREB 3G4S1 4QTUA 4NBHA 3CC41 3OW2Y 4MD8A 4E33A 1KD12 3CD6Z 2OTJ1 2OTLZ 2KI7B 2V8KA 5LL6f 3CCE1 3EERA 3G4SZ 3S2HI 1K9M2 3GTKI 3CC4Z 1X0TA 4NOZA 3KIFA 1Q811 4NBGA 1YJN1 3S17I 3Q87A 2H85A 3G711 2PMZA 3VMIA 1K83I 3VMGA 1YJ91 3GTQI 5T64A 4Y52I 2JUBA 3CPWZ 3HOVI 2QEX1 1FDIA 2QA4Z 4NBFA
chains in the Genus database with same CATH topology
1L1OC 3HOUI 3IF8A 1DL6A 1N8R2 1YUAA 3I4MI 2K5RA 3K7AI 1X3WA 5CM2M 2YADA 4BY7I 3H0GI 4MD7A 1VQP1 3S16I 3FKII 1N2FA 1ZB8A 2JA7I 3CC71 2NVQI 1WIIA 3I561 1PFTA 4A93I 2RIQA 3CC7Z 5D1PA 3MZLB 2JA8I 3RZDI 3CCL1 2HF1A 1NP6A 1WW9A 4A3FI 3OW2Z 4A3DI 1TWFI 1Y1WI 2QKDA 5C4JI 2M6NA 3JAMb 3G6E1 4E31A 2E2HI 1YIJZ 1Q861 2RBLA 1X3ZA 2VUGA 4E2XA 3G6EZ 2W03A 1JWHC 3S1MI 4A3II 1RNIA 1KQSZ 1VQMZ 1TFIA 2E9HA 1S7MA 5A2Qf 4AYBA 1K8A1 2R7ZI 3CCM1 2W04A 2E2JI 2JA5I 3H3VJ 2J6AA 3MONA 3CD61 4A3BI 3NH5A 3S1RI 3GTLI 3U50C 3T4NB 4BY1I 3HOZI 5T6BA 2NVXI 1RLYA 3CCRZ 3D6WA 2QRDB 2F4OA 2NVYI 2G2KA 4A3MI 3NDJA 2Q4ZA 1VQ9Z 1TWGI 3BG1B 2GTHA 1VQOZ 4NBBA 1USPB 2QA41 1Z03A 1NJI1 3F3FC 1KC81 2GU2A 4MRIA 2LFUA 2IZ3A 1QVFY 2P3YA 3GTMS 2LIYA 2RT9A 3J81b 4RV9A 4CL1A 1KQSY 2OOYB 1M901 4HH4A 3S1QI 4A3CI 5T67A 2DE7A 1VQKZ 4A3GI 3J7A4 5C4XI 5C3EI 3J80b 3KIHA 2PM9A 4DGLA 1VQ4Z 3BG0B 2F4MA 2VUMI 3NDIA 5IT9b 4QTTA 4E30A 3CXCY 1Z02A 3PO2I 3CMEZ 3CC2Z 1YITZ 3S2DI 1Q812 1RQFA 3GTPI 3NFZA 1VQ71 4HGYA 4RVGA 1Z01A 4RVHA 5FLXb 1TWCI 3S14I 1KRLA 1VLAA 1I50I 1VQ7Z 3M3YI 4DQYB 2HU9A 1Q821 1YIJ1 1VQN1 1W2BZ 3J80f 1QYPA 1WCMI 5AN9F 4A3JI 5C44I 1YUKA 4NB9A 2JMOA 1VQNZ 3QWUA 2NVTI 2K3RA 1VQM1 1VQ81 1TWHI 1YHQ1 1QVFZ 1S721 1Y1VS 4NB8A 3IFUA 2RHBA 1Q7Y1 3FQQA 3GTGI 5FLXf 1VQ6Z 2M48A 1VQ8Z 3TE5B 5IP9I 1YHQZ 2JNYA 1P9NA 1S72Z 3CCS1 3GTOI 3CCJZ 5FLMI 1M1K1 3I07A 2Q51A 3RZOI 4MONA 1KD11 3I55Z 1YI21 2RPRA 3CCSZ 1JJ2Y 3GTMI 3HOXI 3P5JB 3VMHA 3JAMf 2V8IA 3CXCZ 3NH4A 3LUSA 1I3QI 4NBCA 3CCR1 1ZB9A 5D1OA 2R92I 1YI2Z 1Q862 3PO3I 2O53A 1VQ91 3CMAZ 3VTNA 4E2WA 2R6MA 1VQO1 2EGTA 3VB9A 1YJW1 2QLVB 1W2BY 3GCFA 4BXXI 3S15I 4A3EI 4NH1C 1N8R1 2DE6A 1VQ51 1YJWZ 1K8A2 2DE5A 1M1K2 1VQLZ 1QF8A 1VQK1 3ESWA 4E2ZA 1VQ5Z 2WAQA 4HGZA 1VQ41 2OTJZ 4Y7NI 2OZKA 3CCQ1 1RO0A 3CCEZ 3PO3S 3CME1 3CC21 1YIT1 1SFOI 4EWCA 4MD9A 2V8JA 3CCV1 3IX0A 1YJNZ 3CCQZ 1K731 4E2YA 4RVFA 3G71Z 4A3LI 3S1NI 4NBEA 3M4OI 1YJ9Z 1Y1VI 3GTJI 4BBSI 2QR1B 1NJI2 3MZKB 1KC82 3CCVZ 2QRCB 2QEXZ 1JJ2Z 3TDHB 1USPA 1R9TI 4NBAA 1ZH1A 2JA6I 1LQLA 1RO2A 3J81f 1M902 2R93I 2P28A 2PK7A 1VQPZ 3HOWI 2E2II 1NUIA 4MXUA 2I3CA 3GKQA 4X6AI 3D9XA 1QVGZ 5A2Qb 3CQZI 1K732 2JR6A 4S1TA 2AKLA 3FQMA 4NFRA 3I56Z 2IZ4A 5IT9f 1VQ61 3I4NI 2O4HA 1I6HI 4RS4A 3CCJ1 3CCLZ 1ML8A 2OOXB 3HKZA 3HOYI 5D1OB 4E32A 3NH8A 3I551 3CPWY 2WB1A 2JS4A 2KPIA 4A3KI 3CCU1 1Q822 1RO4A 3EEDA 4NBDA 2GTIA 1TWAI 4BBRI 5IP7I 3CMA1 1K9M1 4MH4A 3CCUZ 4XX2A 4RVDA 2B63I 3F3PC 4TNUA 4DK1A 1Q7Y2 2Y0SA 2YU9I 2VF1A 1VQL1 2ZAEB 1QVGY 2OTL1 3CCMZ 2BJOA 2QREB 3G4S1 4QTUA 4NBHA 3CC41 3OW2Y 4MD8A 4E33A 1KD12 3CD6Z 2OTJ1 2OTLZ 2KI7B 2V8KA 5LL6f 3CCE1 3EERA 3G4SZ 3S2HI 1K9M2 3GTKI 3CC4Z 1X0TA 4NOZA 3KIFA 1Q811 4NBGA 1YJN1 3S17I 3Q87A 2H85A 3G711 2PMZA 3VMIA 1K83I 3VMGA 1YJ91 3GTQI 5T64A 4Y52I 2JUBA 3CPWZ 3HOVI 2QEX1 2QA4Z 4NBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O C;  2NVX I;  3HOU I;  3HOW I;  2E2I I;  1NUI A;  1RLY A;  3GTO I;  3D6W A;  3GKQ A;  1DL6 A;  1YUA A;  4X6A I;  2F4O A;  2NVY I;  3I4M I;  5FLM I;  2K5R A;  4A3M I;  3I07 A;  3RZO I;  3CQZ I;  3K7A I;  1X3W A;  5CM2 M;  2JR6 A;  1TWG I;  2AKL A;  4BY7 I;  3GTM I;  3H0G I;  4NBB A;  1USP B;  3HOX I;  3I4N I;  3VMH A;  3LUS A;  1I3Q I;  4NBC A;  1I6H I;  1ZB9 A;  2R92 I;  3S16 I;  3FKI I;  1N2F A;  1ZB8 A;  2P3Y A;  2JA7 I;  1ML8 A;  2NVQ I;  3HOY I;  3PO3 I;  3GTM S;  1PFT A;  5IP9 I;  4A93 I;  3VB9 A;  3S1Q I;  2JS4 A;  4A3C I;  2KPI A;  2DE7 A;  4A3K I;  3GCF A;  4BXX I;  4A3G I;  1RO4 A;  3S15 I;  5C4X I;  5C3E I;  2JA8 I;  3RZD I;  4NBD A;  4A3E I;  2HF1 A;  1WW9 A;  1TWA I;  4BBR I;  2DE6 A;  4A3F I;  5IP7 I;  2DE5 A;  4A3D I;  4MH4 A;  1TWF I;  1Y1W I;  2F4M A;  2VUM I;  4XX2 A;  4QTT A;  5C4J I;  3PO2 I;  2B63 I;  3ESW A;  3S2D I;  3GTP I;  2E2H I;  2RBL A;  2YU9 I;  1TWC I;  1X3Z A;  4Y7N I;  3S14 I;  3PO3 S;  1VLA A;  3S1M I;  1I50 I;  2BJO A;  4A3I I;  1SFO I;  3M3Y I;  4QTU A;  4NBH A;  1TFI A;  4A3L I;  1QYP A;  3S1N I;  4NBE A;  1WCM I;  4A3J I;  3M4O I;  5C44 I;  2R7Z I;  1Y1V I;  3GTJ I;  3EER A;  3S2H I;  4BBS I;  3GTK I;  4NB9 A;  2E2J I;  1USP A;  2JA5 I;  2NVT I;  4NOZ A;  4NBG A;  3S17 I;  3H3V J;  2J6A A;  1R9T I;  3Q87 A;  1TWH I;  4A3B I;  4NBA A;  3VMI A;  3S1R I;  2JA6 I;  1LQL A;  3GTL I;  1Y1V S;  1K83 I;  3U50 C;  4NB8 A;  3VMG A;  3GTQ I;  4Y52 I;  3GTG I;  4BY1 I;  2R93 I;  3HOZ I;  3HOV I;  4NBF A;  2PK7 A;  2JNY A; 
#chains in the Genus database with same CATH topology
 1L1O C;  3HOU I;  3IF8 A;  1DL6 A;  1N8R 2;  1YUA A;  3D2L A;  3I4M I;  2K5R A;  2AYD A;  3K7A I;  1X3W A;  5CM2 M;  2YAD A;  4BY7 I;  3H0G I;  4MD7 A;  1Y8C A;  1VQP 1;  2LEX A;  3S16 I;  3FKI I;  1N2F A;  1ZB8 A;  2JA7 I;  3CC7 1;  2NVQ I;  1WII A;  3I56 1;  1PFT A;  1WJ2 A;  4A93 I;  2RIQ A;  2E7Z A;  3CC7 Z;  5D1P A;  3MZL B;  2VPX A;  2JA8 I;  3RZD I;  3CCL 1;  2HF1 A;  1NP6 A;  1WW9 A;  4A3F I;  3OW2 Z;  4A3D I;  1TWF I;  1Y1W I;  2QKD A;  3IR7 A;  5C4J I;  2M6N A;  3JAM b;  2VPZ A;  3G6E 1;  4E31 A;  2E2H I;  1YIJ Z;  1Q86 1;  2RBL A;  2VPW A;  1X3Z A;  2VUG A;  4E2X A;  3G6E Z;  2W03 A;  1JWH C;  3S1M I;  4A3I I;  1RNI A;  1KQS Z;  1VQM Z;  1TFI A;  2E9H A;  2V3V A;  1S7M A;  5A2Q f;  4AYB A;  1K8A 1;  2R7Z I;  3CCM 1;  2W04 A;  2E2J I;  2JA5 I;  3H3V J;  2J6A A;  3MON A;  3CD6 1;  4A3B I;  3NH5 A;  3S1R I;  3GTL I;  3U50 C;  3T4N B;  4BY1 I;  3HOZ I;  1Q16 A;  5T6B A;  2NVX I;  1RLY A;  3CCR Z;  3D6W A;  2QRD B;  2F4O A;  2NVY I;  2G2K A;  2V45 A;  4A3M I;  3NDJ A;  2Q4Z A;  1VQ9 Z;  1TWG I;  3BG1 B;  2GTH A;  1VQO Z;  4NBB A;  1USP B;  2QA4 1;  1Z03 A;  1NJI 1;  3F3F C;  1KC8 1;  2GU2 A;  4MRI A;  2LFU A;  2IZ3 A;  1QVF Y;  2P3Y A;  3GTM S;  2LIY A;  2RT9 A;  3J81 b;  4RV9 A;  4CL1 A;  1KQS Y;  2OOY B;  1M90 1;  4HH4 A;  3S1Q I;  4A3C I;  5T67 A;  2DE7 A;  1VQK Z;  4A3G I;  3J7A 4;  5C4X I;  5C3E I;  3J80 b;  3KIH A;  2PM9 A;  4DGL A;  1VQ4 Z;  3BG0 B;  2F4M A;  2VUM I;  3NDI A;  5IT9 b;  4QTT A;  4E30 A;  3CXC Y;  1Z02 A;  3PO2 I;  3CME Z;  3CC2 Z;  1YIT Z;  3S2D I;  1Q81 2;  1RQF A;  3GTP I;  3NFZ A;  1VQ7 1;  4HGY A;  4RVG A;  1Z01 A;  4RVH A;  5FLX b;  1TWC I;  3S14 I;  1KRL A;  1VLA A;  1I50 I;  1VQ7 Z;  3M3Y I;  4DQY B;  2HU9 A;  1Q82 1;  1YIJ 1;  1WZN A;  1VQN 1;  2JIR A;  2JIM A;  1W2B Z;  3J80 f;  1QYP A;  1WCM I;  5AN9 F;  4A3J I;  5C44 I;  2VPY A;  1YUK A;  4NB9 A;  2JMO A;  1VQN Z;  3QWU A;  2NVT I;  2K3R A;  1VQM 1;  1VQ8 1;  1TWH I;  1YHQ 1;  1QVF Z;  1S72 1;  1Y1V S;  4NB8 A;  3IFU A;  2RHB A;  1Q7Y 1;  3FQQ A;  3GTG I;  1SIW A;  2IV2 X;  5FLX f;  1VQ6 Z;  2M48 A;  1VQ8 Z;  3TE5 B;  5IP9 I;  2JNY A;  1YHQ Z;  1P9N A;  1S72 Z;  3CCS 1;  3GTO I;  3CCJ Z;  5FLM I;  1M1K 1;  3I07 A;  2Q51 A;  3RZO I;  4MON A;  1KD1 1;  3I55 Z;  1YI2 1;  2RPR A;  3CCS Z;  1JJ2 Y;  3GTM I;  3HOX I;  3P5J B;  3VMH A;  3JAM f;  2V8I A;  3CXC Z;  3NH4 A;  3LUS A;  1I3Q I;  4NBC A;  3CCR 1;  2JIQ A;  1ZB9 A;  5D1O A;  2R92 I;  1YI2 Z;  1Q86 2;  3PO3 I;  2O53 A;  1VQ9 1;  3CMA Z;  3VTN A;  4E2W A;  2R6M A;  1VQO 1;  2EGT A;  3VB9 A;  1YJW 1;  2QLV B;  1W2B Y;  3GCF A;  4BXX I;  3S15 I;  4A3E I;  4NH1 C;  1N8R 1;  2JIO A;  2DE6 A;  1VQ5 1;  1YJW Z;  1K8A 2;  2DE5 A;  1M1K 2;  1VQL Z;  1QF8 A;  1VQK 1;  3ESW A;  4E2Z A;  1VQ5 Z;  2WAQ A;  4HGZ A;  1VQ4 1;  2OTJ Z;  4Y7N I;  2OZK A;  3CCQ 1;  1RO0 A;  3CCE Z;  3PO3 S;  3CME 1;  3CC2 1;  1YIT 1;  1SFO I;  4EWC A;  4MD9 A;  2V8J A;  3CCV 1;  3IX0 A;  1YJN Z;  3CCQ Z;  1K73 1;  4E2Y A;  4RVF A;  3G71 Z;  4A3L I;  3S1N I;  4NBE A;  3M4O I;  1YJ9 Z;  1Y1V I;  3GTJ I;  4BBS I;  2QR1 B;  1NJI 2;  3MZK B;  1KC8 2;  3CCV Z;  2QRC B;  2QEX Z;  1JJ2 Z;  1QXF A;  3TDH B;  1USP A;  1R9T I;  4NBA A;  1ZH1 A;  2JA6 I;  1LQL A;  1RO2 A;  3J81 f;  1M90 2;  2R93 I;  2P28 A;  2PK7 A;  1VQP Z;  3HOW I;  2E2I I;  1NUI A;  4MXU A;  2I3C A;  3GKQ A;  4X6A I;  3D9X A;  1QVG Z;  1AA6 A;  5A2Q b;  3CQZ I;  1K73 2;  2NAP A;  2JR6 A;  4S1T A;  2AKL A;  3FQM A;  4NFR A;  3I56 Z;  2IZ4 A;  5IT9 f;  1VQ6 1;  3I4N I;  2O4H A;  1I6H I;  4RS4 A;  3CCJ 1;  3CCL Z;  1ML8 A;  2JIP A;  2OOX B;  3HKZ A;  3HOY I;  5D1O B;  4E32 A;  3NH8 A;  3I55 1;  1FDO A;  3CPW Y;  2WB1 A;  2JS4 A;  2KPI A;  4A3K I;  3CCU 1;  1Q82 2;  1RO4 A;  3EED A;  4NBD A;  2GTI A;  1TWA I;  4BBR I;  5IP7 I;  3CMA 1;  1K9M 1;  4MH4 A;  3CCU Z;  4XX2 A;  4RVD A;  2B63 I;  3F3P C;  4TNU A;  4DK1 A;  1Q7Y 2;  2Y0S A;  2YU9 I;  2VF1 A;  1VQL 1;  2ZAE B;  1QVG Y;  2OTL 1;  3CCM Z;  2BJO A;  2QRE B;  3G4S 1;  4QTU A;  4NBH A;  3CC4 1;  3OW2 Y;  4MD8 A;  4E33 A;  1KD1 2;  3CD6 Z;  2OTJ 1;  2OTL Z;  2KI7 B;  2V8K A;  5LL6 f;  3CCE 1;  3EER A;  3G4S Z;  3S2H I;  1K9M 2;  3GTK I;  3CC4 Z;  1X0T A;  4NOZ A;  3KIF A;  1Q81 1;  4NBG A;  1YJN 1;  3S17 I;  3Q87 A;  2H85 A;  3G71 1;  2PMZ A;  3VMI A;  1K83 I;  3VMG A;  1YJ9 1;  3GTQ I;  5T64 A;  4Y52 I;  2JUB A;  3CPW Z;  3HOV I;  2QEX 1;  1FDI A;  2QA4 Z;  4NBF A; 
#chains in the Genus database with same CATH homology
 1L1O C;  3HOU I;  3IF8 A;  1DL6 A;  1N8R 2;  1YUA A;  3I4M I;  2K5R A;  3K7A I;  1X3W A;  5CM2 M;  2YAD A;  4BY7 I;  3H0G I;  4MD7 A;  1VQP 1;  3S16 I;  3FKI I;  1N2F A;  1ZB8 A;  2JA7 I;  3CC7 1;  2NVQ I;  1WII A;  3I56 1;  1PFT A;  4A93 I;  2RIQ A;  3CC7 Z;  5D1P A;  3MZL B;  2JA8 I;  3RZD I;  3CCL 1;  2HF1 A;  1NP6 A;  1WW9 A;  4A3F I;  3OW2 Z;  4A3D I;  1TWF I;  1Y1W I;  2QKD A;  5C4J I;  2M6N A;  3JAM b;  3G6E 1;  4E31 A;  2E2H I;  1YIJ Z;  1Q86 1;  2RBL A;  1X3Z A;  2VUG A;  4E2X A;  3G6E Z;  2W03 A;  1JWH C;  3S1M I;  4A3I I;  1RNI A;  1KQS Z;  1VQM Z;  1TFI A;  2E9H A;  1S7M A;  5A2Q f;  4AYB A;  1K8A 1;  2R7Z I;  3CCM 1;  2W04 A;  2E2J I;  2JA5 I;  3H3V J;  2J6A A;  3MON A;  3CD6 1;  4A3B I;  3NH5 A;  3S1R I;  3GTL I;  3U50 C;  3T4N B;  4BY1 I;  3HOZ I;  5T6B A;  2NVX I;  1RLY A;  3CCR Z;  3D6W A;  2QRD B;  2F4O A;  2NVY I;  2G2K A;  4A3M I;  3NDJ A;  2Q4Z A;  1VQ9 Z;  1TWG I;  3BG1 B;  2GTH A;  1VQO Z;  4NBB A;  1USP B;  2QA4 1;  1Z03 A;  1NJI 1;  3F3F C;  1KC8 1;  2GU2 A;  4MRI A;  2LFU A;  2IZ3 A;  1QVF Y;  2P3Y A;  3GTM S;  2LIY A;  2RT9 A;  3J81 b;  4RV9 A;  4CL1 A;  1KQS Y;  2OOY B;  1M90 1;  4HH4 A;  3S1Q I;  4A3C I;  5T67 A;  2DE7 A;  1VQK Z;  4A3G I;  3J7A 4;  5C4X I;  5C3E I;  3J80 b;  3KIH A;  2PM9 A;  4DGL A;  1VQ4 Z;  3BG0 B;  2F4M A;  2VUM I;  3NDI A;  5IT9 b;  4QTT A;  4E30 A;  3CXC Y;  1Z02 A;  3PO2 I;  3CME Z;  3CC2 Z;  1YIT Z;  3S2D I;  1Q81 2;  1RQF A;  3GTP I;  3NFZ A;  1VQ7 1;  4HGY A;  4RVG A;  1Z01 A;  4RVH A;  5FLX b;  1TWC I;  3S14 I;  1KRL A;  1VLA A;  1I50 I;  1VQ7 Z;  3M3Y I;  4DQY B;  2HU9 A;  1Q82 1;  1YIJ 1;  1VQN 1;  1W2B Z;  3J80 f;  1QYP A;  1WCM I;  5AN9 F;  4A3J I;  5C44 I;  1YUK A;  4NB9 A;  2JMO A;  1VQN Z;  3QWU A;  2NVT I;  2K3R A;  1VQM 1;  1VQ8 1;  1TWH I;  1YHQ 1;  1QVF Z;  1S72 1;  1Y1V S;  4NB8 A;  3IFU A;  2RHB A;  1Q7Y 1;  3FQQ A;  3GTG I;  5FLX f;  1VQ6 Z;  2M48 A;  1VQ8 Z;  3TE5 B;  5IP9 I;  1YHQ Z;  2JNY A;  1P9N A;  1S72 Z;  3CCS 1;  3GTO I;  3CCJ Z;  5FLM I;  1M1K 1;  3I07 A;  2Q51 A;  3RZO I;  4MON A;  1KD1 1;  3I55 Z;  1YI2 1;  2RPR A;  3CCS Z;  1JJ2 Y;  3GTM I;  3HOX I;  3P5J B;  3VMH A;  3JAM f;  2V8I A;  3CXC Z;  3NH4 A;  3LUS A;  1I3Q I;  4NBC A;  3CCR 1;  1ZB9 A;  5D1O A;  2R92 I;  1YI2 Z;  1Q86 2;  3PO3 I;  2O53 A;  1VQ9 1;  3CMA Z;  3VTN A;  4E2W A;  2R6M A;  1VQO 1;  2EGT A;  3VB9 A;  1YJW 1;  2QLV B;  1W2B Y;  3GCF A;  4BXX I;  3S15 I;  4A3E I;  4NH1 C;  1N8R 1;  2DE6 A;  1VQ5 1;  1YJW Z;  1K8A 2;  2DE5 A;  1M1K 2;  1VQL Z;  1QF8 A;  1VQK 1;  3ESW A;  4E2Z A;  1VQ5 Z;  2WAQ A;  4HGZ A;  1VQ4 1;  2OTJ Z;  4Y7N I;  2OZK A;  3CCQ 1;  1RO0 A;  3CCE Z;  3PO3 S;  3CME 1;  3CC2 1;  1YIT 1;  1SFO I;  4EWC A;  4MD9 A;  2V8J A;  3CCV 1;  3IX0 A;  1YJN Z;  3CCQ Z;  1K73 1;  4E2Y A;  4RVF A;  3G71 Z;  4A3L I;  3S1N I;  4NBE A;  3M4O I;  1YJ9 Z;  1Y1V I;  3GTJ I;  4BBS I;  2QR1 B;  1NJI 2;  3MZK B;  1KC8 2;  3CCV Z;  2QRC B;  2QEX Z;  1JJ2 Z;  3TDH B;  1USP A;  1R9T I;  4NBA A;  1ZH1 A;  2JA6 I;  1LQL A;  1RO2 A;  3J81 f;  1M90 2;  2R93 I;  2P28 A;  2PK7 A;  1VQP Z;  3HOW I;  2E2I I;  1NUI A;  4MXU A;  2I3C A;  3GKQ A;  4X6A I;  3D9X A;  1QVG Z;  5A2Q b;  3CQZ I;  1K73 2;  2JR6 A;  4S1T A;  2AKL A;  3FQM A;  4NFR A;  3I56 Z;  2IZ4 A;  5IT9 f;  1VQ6 1;  3I4N I;  2O4H A;  1I6H I;  4RS4 A;  3CCJ 1;  3CCL Z;  1ML8 A;  2OOX B;  3HKZ A;  3HOY I;  5D1O B;  4E32 A;  3NH8 A;  3I55 1;  3CPW Y;  2WB1 A;  2JS4 A;  2KPI A;  4A3K I;  3CCU 1;  1Q82 2;  1RO4 A;  3EED A;  4NBD A;  2GTI A;  1TWA I;  4BBR I;  5IP7 I;  3CMA 1;  1K9M 1;  4MH4 A;  3CCU Z;  4XX2 A;  4RVD A;  2B63 I;  3F3P C;  4TNU A;  4DK1 A;  1Q7Y 2;  2Y0S A;  2YU9 I;  2VF1 A;  1VQL 1;  2ZAE B;  1QVG Y;  2OTL 1;  3CCM Z;  2BJO A;  2QRE B;  3G4S 1;  4QTU A;  4NBH A;  3CC4 1;  3OW2 Y;  4MD8 A;  4E33 A;  1KD1 2;  3CD6 Z;  2OTJ 1;  2OTL Z;  2KI7 B;  2V8K A;  5LL6 f;  3CCE 1;  3EER A;  3G4S Z;  3S2H I;  1K9M 2;  3GTK I;  3CC4 Z;  1X0T A;  4NOZ A;  3KIF A;  1Q81 1;  4NBG A;  1YJN 1;  3S17 I;  3Q87 A;  2H85 A;  3G71 1;  2PMZ A;  3VMI A;  1K83 I;  3VMG A;  1YJ9 1;  3GTQ I;  5T64 A;  4Y52 I;  2JUB A;  3CPW Z;  3HOV I;  2QEX 1;  2QA4 Z;  4NBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...