3HOVI

Complete rna polymerase ii elongation complex ii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hovI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hovI02
2DE6A 3CQZI 3HOUI 5C3EI 1I6HI 3HOXI 1DL6A 1X3ZA 4NB9A 2E2II 4A3FI 4NBHA 4A93I 2K5RA 3S1QI 1QYPA 3M3YI 4A3BI 2NVXI 4A3KI 4BBSI 3S1RI 2R92I 2F4OA 1YUAA 4NBAA 3FKII 4BBRI 5CM2M 3K7AI 3M4OI 5C4XI 3D6WA 1Y1VS 1TWHI 2KPIA 2RBLA 3GTGI 3S1MI 1USPB 2NVYI 2PK7A 2HF1A 4A3CI 1Y1WI 2R7ZI 1ML8A 1RO4A 1LQLA 2YU9I 2JR6A 1WCMI 3PO3S 3Q87A 4Y7NI 2B63I 1TFIA 1SFOI 4NBGA 2F4MA 2AKLA 3H0GI 3S15I 3H3VJ 1I3QI 3S16I 1WW9A 1USPA 3EERA 1Y1VI 3GTMI 5IP7I 3RZOI 2DE5A 3U50C 3GKQA 3S14I 3GTQI 3HOYI 1PFTA 3HOZI 2J6AA 4A3LI 3PO3I 4NBBA 4NOZA 5IP9I 3I07A 4BY7I 4XX2A 2JA6I 2P3YA 5C44I 2E2HI 3GTLI 2BJOA 3S17I 3LUSA 1X3WA 4NBCA 2R93I 1N2FA 1ZB8A 1L1OC 4A3DI 3GTPI 3VMIA 3HOWI 1TWFI 4QTUA 3S1NI 3VB9A 1RLYA 4Y52I 3GCFA 4BY1I 4A3JI 1VLAA 4A3GI 2JA7I 2NVQI 4NBDA 4A3II 3ESWA 5FLMI 1K83I 2E2JI 3I4NI 1TWCI 3GTJI 2JNYA 2NVTI 2VUMI 1I50I 3HOVI 3GTKI 3I4MI 2DE7A 2JA5I 3GTOI 4A3EI 3VMGA 3S2HI 3VMHA 1R9TI 3S2DI 3PO2I 4A3MI 2JS4A 4QTTA 1NUIA 4NBFA 4NBEA 5C4JI 2JA8I 3GTMS 4X6AI 1ZB9A 4MH4A 1TWAI 4NB8A 3RZDI 4BXXI 1TWGI
chains in the Genus database with same CATH superfamily
1RO2A 5C3EI 5T67A 2PM9A 1KC81 1X3ZA 4A3FI 2K5RA 3P5JB 1S721 4A3BI 1AA6A 5FLXf 2JIPA 4BBSI 2R92I 1VQK1 3CC2Z 2GTHA 1VQNZ 2AYDA 3CMEZ 1YJ91 5CM2M 3J7A4 1VQMZ 1S7MA 2OTLZ 2PK7A 2HF1A 3CXCY 1Y8CA 2Q4ZA 2R7ZI 3CCLZ 3CD61 3T4NB 3G4S1 1VQLZ 1SFOI 2F4MA 2PMZA 3QWUA 3CCE1 3G71Z 2QREB 1USPA 3EERA 3RZOI 2DE5A 3VTNA 1Q16A 3NDJA 5IT9f 4E2YA 2GU2A 3BG1B 2QRCB 3BG0B 4XX2A 2JMOA 2E2HI 5C44I 1VQN1 3S17I 3CME1 3TE5B 1Q812 1VQM1 1N8R2 3GTPI 3CC7Z 2OTL1 1TWFI 1VQ6Z 1K732 3S1NI 1RLYA 1M901 4E31A 3CCL1 2K3RA 2W03A 1VQL1 4NBDA 5LL6f 4A3II 2E2JI 1TWCI 4E33A 3G711 3GTKI 2V45A 2M6NA 3S2HI 3EEDA 4QTTA 2QKDA 1ZH1A 3KIHA 4MH4A 4CL1A 2YADA 1KD11 2DE6A 1YJNZ 1YHQZ 2KI7B 3J80f 3J81b 3HOXI 3NFZA 1K9M1 4A93I 3F3FC 2QRDB 3CPWY 2NVXI 1Q821 3CC71 5T64A 1YUAA 1VQ61 1RQFA 2JIOA 2LEXA 2ZAEB 4E30A 3K7AI 3M4OI 5C4XI 1Y1VS 1TWHI 3GTGI 2NVYI 3OW2Y 1Y1WI 2VF1A 2H85A 1QVFZ 4RV9A 1NJI2 2YU9I 1WCMI 3FQMA 2B63I 1TFIA 3CCSZ 1RNIA 2V8KA 2AKLA 2RPRA 5FLXb 1VQ5Z 3H3VJ 3CMAZ 4TNUA 3CCVZ 3S16I 1WW9A 1KQSZ 1YJN1 1Q7Y1 2OTJZ 1Y1VI 1Z03A 2JUBA 3GTMI 3U50C 3GKQA 1WZNA 1JWHC 1W2BZ 3HOYI 4A3LI 1K8A1 4NBBA 1KC82 1YUKA 4BY7I 2P3YA 1N2FA 2VPXA 4S1TA 4E2WA 5T6BA 2QR1B 3VB9A 3GCFA 4E2ZA 4A3JI 1VLAA 2VPYA 2JA7I 2R6MA 4MXUA 3CCS1 1RO0A 3CCJZ 3ESWA 3MZKB 5A2Qf 3CC21 4HGYA 2I3CA 2JIQA 1VQ51 5IT9b 3CMA1 2O53A 3CCV1 3FQQA 2OTJ1 3VMGA 5D1OB 3S2DI 3PO2I 1Q861 2QA4Z 1NUIA 4NBFA 4X6AI 1VQ7Z 1FDOA 1TWAI 4BXXI 3G6EZ 3D2LA 1I6HI 4NB9A 4MONA 3CCQZ 4NBHA 3S1QI 1QYPA 3I56Z 4AYBA 1VQ9Z 1YI2Z 2V8IA 2GTIA 1QVGZ 3FKII 1JJ2Y 3NDIA 3D6WA 4MD9A 2KPIA 1NP6A 2RBLA 1M902 3JAMf 1M1K2 5AN9F 2QLVB 1YJWZ 3F3PC 1ML8A 1RO4A 1LQLA 2JR6A 3IF8A 3CC4Z 3Q87A 3J80b 2LIYA 4NFRA 1FDIA 1P9NA 2QEXZ 2HU9A 1VQ71 3S15I 2V3VA 1I3QI 3CCRZ 2RIQA 2Q51A 2P28A 5IP7I 4RVHA 3CCQ1 3S14I 3IX0A 1KD12 2RHBA 3I561 1NJI1 1PFTA 2J6AA 1VQ91 1YI21 4DGLA 2IZ4A 4E2XA 4NOZA 1K9M2 1QF8A 1KQSY 3GTLI 1KRLA 2BJOA 4HH4A 1YIJZ 2R93I 1Q822 1ZB8A 1L1OC 1W2BY 2OZKA 3CCMZ 1VQOZ 1YITZ 3VMIA 3HOWI 2IV2X 2VPZA 3CCEZ 1SIWA 1YJW1 1YHQ1 4RVGA 3CC41 5D1PA 4HGZA 4A3GI 2M48A 3KIFA 2NVQI 1QXFA 2RT9A 2QEX1 1K83I 3I4NI 2JNYA 2VUMI 1I50I 2OOYB 3OW2Z 4DQYB 3HOVI 3CCR1 3I4MI 2O4HA 3NH8A 4A3MI 1VQPZ 2W04A 4NBEA 5C4JI 2IZ3A 1Q7Y2 1ZB9A 3HOUI 2V8JA 4NB8A 3I55Z 1WJ2A 3CQZI 1DL6A 3CCUZ 2E2II 4RVDA 1YIJ1 1K8A2 2E7ZA 3M3YI 5D1OA 3CCM1 4A3KI 1VQO1 3S1RI 3CXCZ 1YIT1 1WIIA 2F4OA 3MONA 5A2Qb 1Q811 1N8R1 1VQ8Z 4NBAA 1K731 4BBRI 4MD8A 3IR7A 1USPB 1VQ4Z 3S1MI 4RS4A 4A3CI 4EWCA 2OOXB 3PO3S 1QVGY 2JIMA 4Y7NI 4NBGA 1VQP1 2NAPA 2Y0SA 3H0GI 3I551 2LFUA 4DK1A 1Q862 2VPWA 3D9XA 3MZLB 3CCU1 3IFUA 1M1K1 3GTQI 3CCJ1 2WB1A 3HOZI 2G2KA 3PO3I 2VUGA 3JAMb 2WAQA 5IP9I 3I07A 1VQ81 2JA6I 3LUSA 1X3WA 3NH4A 4NBCA 1S72Z 2QA41 3NH5A 4A3DI 3HKZA 1VQ41 1VQKZ 2E9HA 4QTUA 3G6E1 1QVFY 4Y52I 3J81f 4BY1I 2JIRA 1YJ9Z 4MRIA 1JJ2Z 4RVFA 5FLMI 3GTJI 2NVTI 3TDHB 1Z02A 3CD6Z 4E32A 2DE7A 2EGTA 1Z01A 2JA5I 3GTOI 3G4SZ 4A3EI 3VMHA 4MD7A 1R9TI 2JS4A 1X0TA 3CPWZ 2JA8I 3GTMS 3RZDI 4NH1C 1TWGI
chains in the Genus database with same CATH topology
1RO2A 5C3EI 5T67A 2PM9A 1KC81 1X3ZA 4A3FI 2K5RA 3P5JB 1S721 4A3BI 5FLXf 4BBSI 2R92I 1VQK1 3CC2Z 2GTHA 1VQNZ 3CMEZ 1YJ91 5CM2M 3J7A4 1VQMZ 1S7MA 2OTLZ 2PK7A 2HF1A 3CXCY 2Q4ZA 2R7ZI 3CCLZ 3CD61 3T4NB 3G4S1 1VQLZ 1SFOI 2F4MA 2PMZA 3QWUA 3CCE1 3G71Z 2QREB 1USPA 3EERA 3RZOI 2DE5A 3VTNA 3NDJA 5IT9f 4E2YA 2GU2A 3BG1B 2QRCB 3BG0B 4XX2A 2JMOA 2E2HI 5C44I 1VQN1 3S17I 3CME1 3TE5B 1Q812 1VQM1 1N8R2 3GTPI 3CC7Z 2OTL1 1TWFI 1VQ6Z 1K732 3S1NI 1RLYA 1M901 4E31A 3CCL1 2K3RA 2W03A 1VQL1 4NBDA 5LL6f 4A3II 2E2JI 1TWCI 4E33A 3G711 3GTKI 2M6NA 3S2HI 3EEDA 4QTTA 2QKDA 1ZH1A 3KIHA 4MH4A 4CL1A 2YADA 1KD11 2DE6A 1YJNZ 1YHQZ 2KI7B 3J80f 3J81b 3HOXI 3NFZA 1K9M1 4A93I 3F3FC 2QRDB 3CPWY 2NVXI 1Q821 3CC71 5T64A 1YUAA 1VQ61 1RQFA 2ZAEB 4E30A 3K7AI 3M4OI 5C4XI 1Y1VS 1TWHI 3GTGI 2NVYI 3OW2Y 1Y1WI 2VF1A 2H85A 1QVFZ 4RV9A 1NJI2 2YU9I 1WCMI 3FQMA 2B63I 1TFIA 3CCSZ 1RNIA 2V8KA 2AKLA 2RPRA 5FLXb 1VQ5Z 3H3VJ 3CMAZ 4TNUA 3CCVZ 3S16I 1WW9A 1KQSZ 1YJN1 1Q7Y1 2OTJZ 1Y1VI 1Z03A 2JUBA 3GTMI 3U50C 3GKQA 1JWHC 1W2BZ 3HOYI 4A3LI 1K8A1 4NBBA 1KC82 1YUKA 4BY7I 2P3YA 1N2FA 4S1TA 4E2WA 5T6BA 2QR1B 3VB9A 3GCFA 4E2ZA 4A3JI 1VLAA 2JA7I 2R6MA 4MXUA 3CCS1 1RO0A 3CCJZ 3ESWA 3MZKB 5A2Qf 3CC21 4HGYA 2I3CA 1VQ51 5IT9b 3CMA1 2O53A 3CCV1 3FQQA 2OTJ1 3VMGA 5D1OB 3S2DI 3PO2I 1Q861 2QA4Z 1NUIA 4NBFA 4X6AI 1VQ7Z 1TWAI 4BXXI 3G6EZ 1I6HI 4NB9A 4MONA 3CCQZ 4NBHA 3S1QI 1QYPA 3I56Z 4AYBA 1VQ9Z 1YI2Z 2V8IA 2GTIA 1QVGZ 3FKII 1JJ2Y 3NDIA 3D6WA 4MD9A 2KPIA 1NP6A 2RBLA 1M902 3JAMf 1M1K2 5AN9F 2QLVB 1YJWZ 3F3PC 1ML8A 1RO4A 1LQLA 2JR6A 3IF8A 3CC4Z 3Q87A 3J80b 2LIYA 4NFRA 1P9NA 2QEXZ 2HU9A 1VQ71 3S15I 1I3QI 3CCRZ 2RIQA 2Q51A 2P28A 5IP7I 4RVHA 3CCQ1 3S14I 3IX0A 1KD12 2RHBA 3I561 1NJI1 1PFTA 2J6AA 1VQ91 1YI21 4DGLA 2IZ4A 4E2XA 4NOZA 1K9M2 1QF8A 1KQSY 3GTLI 1KRLA 2BJOA 4HH4A 1YIJZ 2R93I 1Q822 1ZB8A 1L1OC 1W2BY 2OZKA 3CCMZ 1VQOZ 1YITZ 3VMIA 3HOWI 3CCEZ 1YJW1 1YHQ1 4RVGA 3CC41 5D1PA 4HGZA 4A3GI 2M48A 3KIFA 2NVQI 2RT9A 2QEX1 1K83I 3I4NI 2JNYA 2VUMI 1I50I 2OOYB 3OW2Z 4DQYB 3HOVI 3CCR1 3I4MI 2O4HA 3NH8A 4A3MI 1VQPZ 2W04A 4NBEA 5C4JI 2IZ3A 1Q7Y2 1ZB9A 3HOUI 2V8JA 4NB8A 3I55Z 3CQZI 1DL6A 3CCUZ 2E2II 4RVDA 1YIJ1 1K8A2 3M3YI 5D1OA 3CCM1 4A3KI 1VQO1 3S1RI 3CXCZ 1YIT1 1WIIA 2F4OA 3MONA 5A2Qb 1Q811 1N8R1 1VQ8Z 4NBAA 1K731 4BBRI 4MD8A 3S1MI 1USPB 1VQ4Z 4RS4A 4A3CI 4EWCA 2OOXB 3PO3S 1QVGY 4Y7NI 4NBGA 1VQP1 2Y0SA 3H0GI 3I551 2LFUA 4DK1A 1Q862 3D9XA 3MZLB 3CCU1 3IFUA 1M1K1 3GTQI 3CCJ1 2WB1A 3HOZI 2G2KA 3PO3I 2VUGA 3JAMb 2WAQA 5IP9I 3I07A 1VQ81 2JA6I 3LUSA 1X3WA 3NH4A 4NBCA 1S72Z 2QA41 3NH5A 4A3DI 3HKZA 1VQ41 1VQKZ 2E9HA 4QTUA 3G6E1 1QVFY 4Y52I 3J81f 4BY1I 1YJ9Z 4MRIA 1JJ2Z 4RVFA 5FLMI 3GTJI 2NVTI 3TDHB 1Z02A 3CD6Z 4E32A 2DE7A 2EGTA 1Z01A 2JA5I 3GTOI 3G4SZ 4A3EI 3VMHA 4MD7A 1R9TI 2JS4A 1X0TA 3CPWZ 2JA8I 3GTMS 3RZDI 4NH1C 1TWGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE6 A;  3CQZ I;  3HOU I;  5C3E I;  1I6H I;  3HOX I;  1DL6 A;  1X3Z A;  4NB9 A;  2E2I I;  4A3F I;  4NBH A;  4A93 I;  2K5R A;  3S1Q I;  1QYP A;  3M3Y I;  4A3B I;  2NVX I;  4A3K I;  4BBS I;  3S1R I;  2R92 I;  2F4O A;  1YUA A;  4NBA A;  3FKI I;  4BBR I;  5CM2 M;  3K7A I;  3M4O I;  5C4X I;  3D6W A;  1Y1V S;  1TWH I;  2KPI A;  2RBL A;  3GTG I;  3S1M I;  1USP B;  2NVY I;  2PK7 A;  2HF1 A;  4A3C I;  1Y1W I;  2R7Z I;  1ML8 A;  1RO4 A;  1LQL A;  2YU9 I;  2JR6 A;  1WCM I;  3PO3 S;  3Q87 A;  4Y7N I;  2B63 I;  1TFI A;  1SFO I;  4NBG A;  2F4M A;  2AKL A;  3H0G I;  3S15 I;  3H3V J;  1I3Q I;  3S16 I;  1WW9 A;  1USP A;  3EER A;  1Y1V I;  3GTM I;  5IP7 I;  3RZO I;  2DE5 A;  3U50 C;  3GKQ A;  3S14 I;  3GTQ I;  3HOY I;  1PFT A;  3HOZ I;  2J6A A;  4A3L I;  3PO3 I;  4NBB A;  4NOZ A;  5IP9 I;  3I07 A;  4BY7 I;  4XX2 A;  2JA6 I;  2P3Y A;  5C44 I;  2E2H I;  3GTL I;  2BJO A;  3S17 I;  3LUS A;  1X3W A;  4NBC A;  2R93 I;  1N2F A;  1ZB8 A;  1L1O C;  4A3D I;  3GTP I;  3VMI A;  3HOW I;  1TWF I;  4QTU A;  3S1N I;  3VB9 A;  1RLY A;  4Y52 I;  3GCF A;  4BY1 I;  4A3J I;  1VLA A;  4A3G I;  2JA7 I;  2NVQ I;  4NBD A;  4A3I I;  3ESW A;  5FLM I;  1K83 I;  2E2J I;  3I4N I;  1TWC I;  3GTJ I;  2JNY A;  2NVT I;  2VUM I;  1I50 I;  3HOV I;  3GTK I;  3I4M I;  2DE7 A;  2JA5 I;  3GTO I;  4A3E I;  3VMG A;  3S2H I;  3VMH A;  1R9T I;  3S2D I;  3PO2 I;  4A3M I;  2JS4 A;  4QTT A;  1NUI A;  4NBF A;  4NBE A;  5C4J I;  2JA8 I;  3GTM S;  4X6A I;  1ZB9 A;  4MH4 A;  1TWA I;  4NB8 A;  3RZD I;  4BXX I;  1TWG I; 
#chains in the Genus database with same CATH topology
 1RO2 A;  5C3E I;  5T67 A;  2PM9 A;  1KC8 1;  1X3Z A;  4A3F I;  2K5R A;  3P5J B;  1S72 1;  4A3B I;  1AA6 A;  5FLX f;  2JIP A;  4BBS I;  2R92 I;  1VQK 1;  3CC2 Z;  2GTH A;  1VQN Z;  2AYD A;  3CME Z;  1YJ9 1;  5CM2 M;  3J7A 4;  1VQM Z;  1S7M A;  2OTL Z;  2PK7 A;  2HF1 A;  3CXC Y;  1Y8C A;  2Q4Z A;  2R7Z I;  3CCL Z;  3CD6 1;  3T4N B;  3G4S 1;  1VQL Z;  1SFO I;  2F4M A;  2PMZ A;  3QWU A;  3CCE 1;  3G71 Z;  2QRE B;  1USP A;  3EER A;  3RZO I;  2DE5 A;  3VTN A;  1Q16 A;  3NDJ A;  5IT9 f;  4E2Y A;  2GU2 A;  3BG1 B;  2QRC B;  3BG0 B;  4XX2 A;  2JMO A;  2E2H I;  5C44 I;  1VQN 1;  3S17 I;  3CME 1;  3TE5 B;  1Q81 2;  1VQM 1;  1N8R 2;  3GTP I;  3CC7 Z;  2OTL 1;  1TWF I;  1VQ6 Z;  1K73 2;  3S1N I;  1RLY A;  1M90 1;  4E31 A;  3CCL 1;  2K3R A;  2W03 A;  1VQL 1;  4NBD A;  5LL6 f;  4A3I I;  2E2J I;  1TWC I;  4E33 A;  3G71 1;  3GTK I;  2V45 A;  2M6N A;  3S2H I;  3EED A;  4QTT A;  2QKD A;  1ZH1 A;  3KIH A;  4MH4 A;  4CL1 A;  2YAD A;  1KD1 1;  2DE6 A;  1YJN Z;  1YHQ Z;  2KI7 B;  3J80 f;  3J81 b;  3HOX I;  3NFZ A;  1K9M 1;  4A93 I;  3F3F C;  2QRD B;  3CPW Y;  2NVX I;  1Q82 1;  3CC7 1;  5T64 A;  1YUA A;  1VQ6 1;  1RQF A;  2JIO A;  2LEX A;  2ZAE B;  4E30 A;  3K7A I;  3M4O I;  5C4X I;  1Y1V S;  1TWH I;  3GTG I;  2NVY I;  3OW2 Y;  1Y1W I;  2VF1 A;  2H85 A;  1QVF Z;  4RV9 A;  1NJI 2;  2YU9 I;  1WCM I;  3FQM A;  2B63 I;  1TFI A;  3CCS Z;  1RNI A;  2V8K A;  2AKL A;  2RPR A;  5FLX b;  1VQ5 Z;  3H3V J;  3CMA Z;  4TNU A;  3CCV Z;  3S16 I;  1WW9 A;  1KQS Z;  1YJN 1;  1Q7Y 1;  2OTJ Z;  1Y1V I;  1Z03 A;  2JUB A;  3GTM I;  3U50 C;  3GKQ A;  1WZN A;  1JWH C;  1W2B Z;  3HOY I;  4A3L I;  1K8A 1;  4NBB A;  1KC8 2;  1YUK A;  4BY7 I;  2P3Y A;  1N2F A;  2VPX A;  4S1T A;  4E2W A;  5T6B A;  2QR1 B;  3VB9 A;  3GCF A;  4E2Z A;  4A3J I;  1VLA A;  2VPY A;  2JA7 I;  2R6M A;  4MXU A;  3CCS 1;  1RO0 A;  3CCJ Z;  3ESW A;  3MZK B;  5A2Q f;  3CC2 1;  4HGY A;  2I3C A;  2JIQ A;  1VQ5 1;  5IT9 b;  3CMA 1;  2O53 A;  3CCV 1;  3FQQ A;  2OTJ 1;  3VMG A;  5D1O B;  3S2D I;  3PO2 I;  1Q86 1;  2QA4 Z;  1NUI A;  4NBF A;  4X6A I;  1VQ7 Z;  1FDO A;  1TWA I;  4BXX I;  3G6E Z;  3D2L A;  1I6H I;  4NB9 A;  4MON A;  3CCQ Z;  4NBH A;  3S1Q I;  1QYP A;  3I56 Z;  4AYB A;  1VQ9 Z;  1YI2 Z;  2V8I A;  2GTI A;  1QVG Z;  3FKI I;  1JJ2 Y;  3NDI A;  3D6W A;  4MD9 A;  2KPI A;  1NP6 A;  2RBL A;  1M90 2;  3JAM f;  1M1K 2;  5AN9 F;  2QLV B;  1YJW Z;  3F3P C;  1ML8 A;  1RO4 A;  1LQL A;  2JR6 A;  3IF8 A;  3CC4 Z;  3Q87 A;  3J80 b;  2LIY A;  4NFR A;  1FDI A;  1P9N A;  2QEX Z;  2HU9 A;  1VQ7 1;  3S15 I;  2V3V A;  1I3Q I;  3CCR Z;  2RIQ A;  2Q51 A;  2P28 A;  5IP7 I;  4RVH A;  3CCQ 1;  3S14 I;  3IX0 A;  1KD1 2;  2RHB A;  3I56 1;  1NJI 1;  1PFT A;  2J6A A;  1VQ9 1;  1YI2 1;  4DGL A;  2IZ4 A;  4E2X A;  4NOZ A;  1K9M 2;  1QF8 A;  1KQS Y;  3GTL I;  1KRL A;  2BJO A;  4HH4 A;  1YIJ Z;  2R93 I;  1Q82 2;  1ZB8 A;  1L1O C;  1W2B Y;  2OZK A;  3CCM Z;  1VQO Z;  1YIT Z;  3VMI A;  3HOW I;  2IV2 X;  2VPZ A;  3CCE Z;  1SIW A;  1YJW 1;  1YHQ 1;  4RVG A;  3CC4 1;  5D1P A;  4HGZ A;  4A3G I;  2M48 A;  3KIF A;  2NVQ I;  1QXF A;  2RT9 A;  2QEX 1;  1K83 I;  3I4N I;  2JNY A;  2VUM I;  1I50 I;  2OOY B;  3OW2 Z;  4DQY B;  3HOV I;  3CCR 1;  3I4M I;  2O4H A;  3NH8 A;  4A3M I;  1VQP Z;  2W04 A;  4NBE A;  5C4J I;  2IZ3 A;  1Q7Y 2;  1ZB9 A;  3HOU I;  2V8J A;  4NB8 A;  3I55 Z;  1WJ2 A;  3CQZ I;  1DL6 A;  3CCU Z;  2E2I I;  4RVD A;  1YIJ 1;  1K8A 2;  2E7Z A;  3M3Y I;  5D1O A;  3CCM 1;  4A3K I;  1VQO 1;  3S1R I;  3CXC Z;  1YIT 1;  1WII A;  2F4O A;  3MON A;  5A2Q b;  1Q81 1;  1N8R 1;  1VQ8 Z;  4NBA A;  1K73 1;  4BBR I;  4MD8 A;  3IR7 A;  1USP B;  1VQ4 Z;  3S1M I;  4RS4 A;  4A3C I;  4EWC A;  2OOX B;  3PO3 S;  1QVG Y;  2JIM A;  4Y7N I;  4NBG A;  1VQP 1;  2NAP A;  2Y0S A;  3H0G I;  3I55 1;  2LFU A;  4DK1 A;  1Q86 2;  2VPW A;  3D9X A;  3MZL B;  3CCU 1;  3IFU A;  1M1K 1;  3GTQ I;  3CCJ 1;  2WB1 A;  3HOZ I;  2G2K A;  3PO3 I;  2VUG A;  3JAM b;  2WAQ A;  5IP9 I;  3I07 A;  1VQ8 1;  2JA6 I;  3LUS A;  1X3W A;  3NH4 A;  4NBC A;  1S72 Z;  2QA4 1;  3NH5 A;  4A3D I;  3HKZ A;  1VQ4 1;  1VQK Z;  2E9H A;  4QTU A;  3G6E 1;  1QVF Y;  4Y52 I;  3J81 f;  4BY1 I;  2JIR A;  1YJ9 Z;  4MRI A;  1JJ2 Z;  4RVF A;  5FLM I;  3GTJ I;  2NVT I;  3TDH B;  1Z02 A;  3CD6 Z;  4E32 A;  2DE7 A;  2EGT A;  1Z01 A;  2JA5 I;  3GTO I;  3G4S Z;  4A3E I;  3VMH A;  4MD7 A;  1R9T I;  2JS4 A;  1X0T A;  3CPW Z;  2JA8 I;  3GTM S;  3RZD I;  4NH1 C;  1TWG I; 
#chains in the Genus database with same CATH homology
 1RO2 A;  5C3E I;  5T67 A;  2PM9 A;  1KC8 1;  1X3Z A;  4A3F I;  2K5R A;  3P5J B;  1S72 1;  4A3B I;  5FLX f;  4BBS I;  2R92 I;  1VQK 1;  3CC2 Z;  2GTH A;  1VQN Z;  3CME Z;  1YJ9 1;  5CM2 M;  3J7A 4;  1VQM Z;  1S7M A;  2OTL Z;  2PK7 A;  2HF1 A;  3CXC Y;  2Q4Z A;  2R7Z I;  3CCL Z;  3CD6 1;  3T4N B;  3G4S 1;  1VQL Z;  1SFO I;  2F4M A;  2PMZ A;  3QWU A;  3CCE 1;  3G71 Z;  2QRE B;  1USP A;  3EER A;  3RZO I;  2DE5 A;  3VTN A;  3NDJ A;  5IT9 f;  4E2Y A;  2GU2 A;  3BG1 B;  2QRC B;  3BG0 B;  4XX2 A;  2JMO A;  2E2H I;  5C44 I;  1VQN 1;  3S17 I;  3CME 1;  3TE5 B;  1Q81 2;  1VQM 1;  1N8R 2;  3GTP I;  3CC7 Z;  2OTL 1;  1TWF I;  1VQ6 Z;  1K73 2;  3S1N I;  1RLY A;  1M90 1;  4E31 A;  3CCL 1;  2K3R A;  2W03 A;  1VQL 1;  4NBD A;  5LL6 f;  4A3I I;  2E2J I;  1TWC I;  4E33 A;  3G71 1;  3GTK I;  2M6N A;  3S2H I;  3EED A;  4QTT A;  2QKD A;  1ZH1 A;  3KIH A;  4MH4 A;  4CL1 A;  2YAD A;  1KD1 1;  2DE6 A;  1YJN Z;  1YHQ Z;  2KI7 B;  3J80 f;  3J81 b;  3HOX I;  3NFZ A;  1K9M 1;  4A93 I;  3F3F C;  2QRD B;  3CPW Y;  2NVX I;  1Q82 1;  3CC7 1;  5T64 A;  1YUA A;  1VQ6 1;  1RQF A;  2ZAE B;  4E30 A;  3K7A I;  3M4O I;  5C4X I;  1Y1V S;  1TWH I;  3GTG I;  2NVY I;  3OW2 Y;  1Y1W I;  2VF1 A;  2H85 A;  1QVF Z;  4RV9 A;  1NJI 2;  2YU9 I;  1WCM I;  3FQM A;  2B63 I;  1TFI A;  3CCS Z;  1RNI A;  2V8K A;  2AKL A;  2RPR A;  5FLX b;  1VQ5 Z;  3H3V J;  3CMA Z;  4TNU A;  3CCV Z;  3S16 I;  1WW9 A;  1KQS Z;  1YJN 1;  1Q7Y 1;  2OTJ Z;  1Y1V I;  1Z03 A;  2JUB A;  3GTM I;  3U50 C;  3GKQ A;  1JWH C;  1W2B Z;  3HOY I;  4A3L I;  1K8A 1;  4NBB A;  1KC8 2;  1YUK A;  4BY7 I;  2P3Y A;  1N2F A;  4S1T A;  4E2W A;  5T6B A;  2QR1 B;  3VB9 A;  3GCF A;  4E2Z A;  4A3J I;  1VLA A;  2JA7 I;  2R6M A;  4MXU A;  3CCS 1;  1RO0 A;  3CCJ Z;  3ESW A;  3MZK B;  5A2Q f;  3CC2 1;  4HGY A;  2I3C A;  1VQ5 1;  5IT9 b;  3CMA 1;  2O53 A;  3CCV 1;  3FQQ A;  2OTJ 1;  3VMG A;  5D1O B;  3S2D I;  3PO2 I;  1Q86 1;  2QA4 Z;  1NUI A;  4NBF A;  4X6A I;  1VQ7 Z;  1TWA I;  4BXX I;  3G6E Z;  1I6H I;  4NB9 A;  4MON A;  3CCQ Z;  4NBH A;  3S1Q I;  1QYP A;  3I56 Z;  4AYB A;  1VQ9 Z;  1YI2 Z;  2V8I A;  2GTI A;  1QVG Z;  3FKI I;  1JJ2 Y;  3NDI A;  3D6W A;  4MD9 A;  2KPI A;  1NP6 A;  2RBL A;  1M90 2;  3JAM f;  1M1K 2;  5AN9 F;  2QLV B;  1YJW Z;  3F3P C;  1ML8 A;  1RO4 A;  1LQL A;  2JR6 A;  3IF8 A;  3CC4 Z;  3Q87 A;  3J80 b;  2LIY A;  4NFR A;  1P9N A;  2QEX Z;  2HU9 A;  1VQ7 1;  3S15 I;  1I3Q I;  3CCR Z;  2RIQ A;  2Q51 A;  2P28 A;  5IP7 I;  4RVH A;  3CCQ 1;  3S14 I;  3IX0 A;  1KD1 2;  2RHB A;  3I56 1;  1NJI 1;  1PFT A;  2J6A A;  1VQ9 1;  1YI2 1;  4DGL A;  2IZ4 A;  4E2X A;  4NOZ A;  1K9M 2;  1QF8 A;  1KQS Y;  3GTL I;  1KRL A;  2BJO A;  4HH4 A;  1YIJ Z;  2R93 I;  1Q82 2;  1ZB8 A;  1L1O C;  1W2B Y;  2OZK A;  3CCM Z;  1VQO Z;  1YIT Z;  3VMI A;  3HOW I;  3CCE Z;  1YJW 1;  1YHQ 1;  4RVG A;  3CC4 1;  5D1P A;  4HGZ A;  4A3G I;  2M48 A;  3KIF A;  2NVQ I;  2RT9 A;  2QEX 1;  1K83 I;  3I4N I;  2JNY A;  2VUM I;  1I50 I;  2OOY B;  3OW2 Z;  4DQY B;  3HOV I;  3CCR 1;  3I4M I;  2O4H A;  3NH8 A;  4A3M I;  1VQP Z;  2W04 A;  4NBE A;  5C4J I;  2IZ3 A;  1Q7Y 2;  1ZB9 A;  3HOU I;  2V8J A;  4NB8 A;  3I55 Z;  3CQZ I;  1DL6 A;  3CCU Z;  2E2I I;  4RVD A;  1YIJ 1;  1K8A 2;  3M3Y I;  5D1O A;  3CCM 1;  4A3K I;  1VQO 1;  3S1R I;  3CXC Z;  1YIT 1;  1WII A;  2F4O A;  3MON A;  5A2Q b;  1Q81 1;  1N8R 1;  1VQ8 Z;  4NBA A;  1K73 1;  4BBR I;  4MD8 A;  3S1M I;  1USP B;  1VQ4 Z;  4RS4 A;  4A3C I;  4EWC A;  2OOX B;  3PO3 S;  1QVG Y;  4Y7N I;  4NBG A;  1VQP 1;  2Y0S A;  3H0G I;  3I55 1;  2LFU A;  4DK1 A;  1Q86 2;  3D9X A;  3MZL B;  3CCU 1;  3IFU A;  1M1K 1;  3GTQ I;  3CCJ 1;  2WB1 A;  3HOZ I;  2G2K A;  3PO3 I;  2VUG A;  3JAM b;  2WAQ A;  5IP9 I;  3I07 A;  1VQ8 1;  2JA6 I;  3LUS A;  1X3W A;  3NH4 A;  4NBC A;  1S72 Z;  2QA4 1;  3NH5 A;  4A3D I;  3HKZ A;  1VQ4 1;  1VQK Z;  2E9H A;  4QTU A;  3G6E 1;  1QVF Y;  4Y52 I;  3J81 f;  4BY1 I;  1YJ9 Z;  4MRI A;  1JJ2 Z;  4RVF A;  5FLM I;  3GTJ I;  2NVT I;  3TDH B;  1Z02 A;  3CD6 Z;  4E32 A;  2DE7 A;  2EGT A;  1Z01 A;  2JA5 I;  3GTO I;  3G4S Z;  4A3E I;  3VMH A;  4MD7 A;  1R9T I;  2JS4 A;  1X0T A;  3CPW Z;  2JA8 I;  3GTM S;  3RZD I;  4NH1 C;  1TWG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...