2JR6A

Solution structure of upf0434 protein nma0874. northeast structural genomics target mr32
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEEELKALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0434 protein NMA0874
publication title Solution structure of UPF0434 protein NMA0874.
rcsb
source organism Neisseria meningitidis
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jr6A01
3VMGA 1ZB9A 3H3VJ 4BY7I 4BBRI 3FKII 3VMHA 1QYPA 5C4JI 2K5RA 1Y1VI 3GTPI 3U50C 4A93I 4A3LI 4A3EI 4A3FI 1TWGI 3HOZI 4A3CI 2R93I 3S14I 3HOVI 4BBSI 5FLMI 4A3II 2VUMI 5C3EI 3ESWA 1I3QI 2KPIA 3LUSA 3GTMS 2JA6I 3HOXI 3M3YI 1NUIA 3GTLI 1WW9A 2RBLA 1RLYA 4Y7NI 3S2DI 2NVXI 2F4OA 2P3YA 3S2HI 3I4NI 3I07A 5C4XI 2B63I 4A3DI 2NVYI 2PK7A 1SFOI 4NBFA 1R9TI 2HF1A 3RZDI 2NVQI 3PO3S 1PFTA 5IP9I 2NVTI 1LQLA 2YU9I 1TWAI 1TFIA 5IP7I 3HOWI 4QTTA 1YUAA 2JA7I 3RZOI 3S1RI 2AKLA 1TWFI 1USPA 2F4MA 4NOZA 4A3JI 3HOUI 4NBGA 1TWHI 3GTGI 3S1NI 1X3ZA 2JR6A 3GTKI 1L1OC 3I4MI 4A3GI 1VLAA 4XX2A 4Y52I 1ZB8A 2JNYA 2E2HI 4NBDA 3GTOI 4BY1I 3VB9A 3CQZI 5CM2M 4X6AI 4NBEA 4NBAA 3GKQA 1K83I 2R92I 3GTMI 1WCMI 1USPB 1ML8A 2J6AA 3S16I 2DE6A 3HOYI 1TWCI 1I6HI 3S15I 3D6WA 3PO2I 3GTQI 3PO3I 1DL6A 1X3WA 4BXXI 4MH4A 2JA8I 3K7AI 2JA5I 4NBHA 3M4OI 2DE5A 2DE7A 4NB8A 3EERA 3GTJI 4QTUA 2E2JI 1Y1VS 3Q87A 1N2FA 4NBCA 4NBBA 1Y1WI 3GCFA 3H0GI 4A3KI 3S17I 1I50I 3VMIA 2R7ZI 4A3MI 4A3BI 1RO4A 2BJOA 3S1MI 4NB9A 3S1QI 2JS4A 2E2II 5C44I
chains in the Genus database with same CATH superfamily
3VMGA 1YI2Z 2QA4Z 3H3VJ 4BBRI 3VMHA 3JAMf 3CC21 3MZLB 4RS4A 3CMAZ 1Q16A 3NH5A 4A3EI 4A3FI 1TWGI 4A3CI 3S14I 3CC4Z 3HOVI 4A3II 1QF8A 1YUKA 1I3QI 3LUSA 3GTMS 2RT9A 3TDHB 2JA6I 4NH1C 4MXUA 3HOXI 3CCV1 3M3YI 1NUIA 1VQ9Z 1WW9A 2F4OA 3I07A 2P28A 1M901 2V8IA 4NBFA 3CMA1 2VPZA 2YADA 1PFTA 1ZH1A 1TWAI 1TFIA 4AYBA 3CC41 3CPWZ 1VQ5Z 3D2LA 3IR7A 2JA7I 2RIQA 2JIRA 2M48A 4NBGA 1W2BZ 1VQ7Z 1TWHI 2IZ4A 2GU2A 3IX0A 3S1NI 1X3ZA 4MD9A 1RO2A 3NDJA 3QWUA 5IT9f 4Y52I 3G6EZ 1NJI1 3CCJ1 4DQYB 1S72Z 3CMEZ 1RQFA 2VF1A 3VB9A 1K8A2 3J81f 2E9HA 4MRIA 2GTIA 2OTL1 1VQN1 3CCSZ 1VQ51 3CC71 3NH4A 2JUBA 2IZ3A 3S15I 4RVFA 2RPRA 4RVGA 4BXXI 3G6E1 3K7AI 1X0TA 3M4OI 4RVDA 2DE5A 4NB8A 3GTJI 3T4NB 4A3KI 3I551 5T67A 1I50I 1WIIA 2R7ZI 2M6NA 5T6BA 3VTNA 2QRCB 1Z02A 2JS4A 3KIFA 3G711 1AA6A 3F3PC 5C4JI 1Y1VI 1YJ9Z 5IT9b 2V8KA 2V8JA 1KD12 1YITZ 3MONA 2R93I 2LFUA 2Y0SA 1SIWA 4BBSI 5FLMI 3J81b 1YJW1 2QR1B 2V3VA 3I561 1K8A1 3CD61 1NJI2 3NFZA 3GTLI 2NVXI 2P3YA 1Q821 4E30A 2IV2X 2OTJZ 1Q812 3G4S1 1VQK1 2OOXB 1R9TI 3RZDI 1N8R2 1YIT1 2NVTI 2Q51A 2YU9I 3CCE1 5IP7I 3OW2Y 3BG1B 1USPA 3HOUI 2R6MA 2QEX1 2WAQA 2JR6A 1L1OC 1YI21 2QA41 2OTJ1 1RNIA 2JNYA 2E2HI 3CQZI 4NBEA 4NBAA 3GKQA 5A2Qf 2R92I 1M1K2 1S7MA 3KIHA 2QKDA 1USPB 1KC82 2J6AA 4E2XA 1VQLZ 3CCRZ 1K9M1 1KD11 1TWCI 2WB1A 4EWCA 2G2KA 2PM9A 1VQ91 3PO2I 3PO3I 4CL1A 1VQPZ 2W04A 3CXCY 2JA8I 4MONA 1QVFY 2QRDB 1VQ6Z 3EERA 4HGYA 2V45A 2NAPA 4QTUA 2E2JI 1FDOA 4NBCA 1Q811 3GCFA 3S17I 3CCR1 3VMIA 2RHBA 1Q822 1N8R1 3J7A4 4A3BI 4E33A 3S1MI 1VQ8Z 3S1QI 3CCUZ 1VQ71 1QYPA 1VQOZ 3GTPI 1S721 3U50C 3CME1 4A3LI 3FQMA 1YHQZ 2JIMA 3OW2Z 2OZKA 2ZAEB 5A2Qb 4MD7A 3CCS1 1Q7Y1 5C3EI 3ESWA 2JMOA 1VQMZ 2VPXA 2QLVB 3IF8A 3D9XA 1M1K1 3J80f 4Y7NI 2RBLA 3HKZA 1KC81 5C4XI 4A3DI 2KI7B 2JIQA 4E32A 2PK7A 1QVGY 3BG0B 1SFOI 2JIPA 1P9NA 2HF1A 3PO3S 3TE5B 1K9M2 5IP9I 2JIOA 4DK1A 1LQLA 1FDIA 1Z01A 3HOWI 1WJ2A 1KQSY 1Q862 3S1RI 2AKLA 1YJNZ 4E2WA 2LIYA 4NOZA 3CXCZ 3GTGI 3GTKI 1JJ2Y 3I4MI 4A3GI 4MD8A 1QVFZ 4XX2A 4S1TA 3CC2Z 2H85A 1YJ91 5LL6f 4NBDA 4X6AI 2Q4ZA 1K83I 2I3CA 3IFUA 1WCMI 4DGLA 3MZKB 1KRLA 1QXFA 3CCMZ 2DE6A 3CCVZ 2OOYB 1WZNA 1I6HI 1JWHC 3D6WA 1X3WA 3J80b 5FLXb 4NBHA 4TNUA 1Q7Y2 2DE7A 1K732 1Y8CA 1Y1VS 4NBBA 1Y1WI 4E31A 3H0GI 2EGTA 3CCM1 5T64A 1QVGZ 2E2II 3CCQZ 1ZB9A 4RVHA 4BY7I 1YIJZ 3FKII 1Q861 3NH8A 3CCJZ 2K5RA 4A93I 1KQSZ 3HOZI 2OTLZ 1VQNZ 1VQ4Z 2VUMI 3CC7Z 2QREB 3CCLZ 1VQL1 2KPIA 2VPYA 1JJ2Z 4E2YA 2VPWA 2PMZA 1RLYA 3CCQ1 3S2DI 3S2HI 3I4NI 1YIJ1 2B63I 2NVYI 4HGZA 2GTHA 1VQP1 2VUGA 3FQQA 2HU9A 3JAMb 2NVQI 5D1OA 3P5JB 1VQ61 1VQ41 3I55Z 2W03A 4QTTA 4RV9A 1YUAA 2E7ZA 3CCL1 3RZOI 1TWFI 2F4MA 4A3JI 1K731 1VQ81 3CCU1 3EEDA 3NDIA 3G71Z 2K3RA 1RO0A 1VLAA 5FLXf 5D1OB 1ZB8A 1VQO1 3GTOI 4BY1I 5CM2M 4HH4A 1YHQ1 1NP6A 3F3FC 3GTMI 1YJWZ 5D1PA 2O53A 2O4HA 1ML8A 3I56Z 3CD6Z 1M902 3S16I 4NFRA 3HOYI 1VQM1 3CPWY 3GTQI 2AYDA 1DL6A 1W2BY 5AN9F 4MH4A 3G4SZ 1VQKZ 4E2ZA 2LEXA 2JA5I 3CCEZ 3Q87A 1N2FA 4A3MI 1RO4A 2BJOA 1YJN1 4NB9A 2QEXZ 1Z03A 5C44I
chains in the Genus database with same CATH topology
3VMGA 1YI2Z 2QA4Z 3H3VJ 4BBRI 3VMHA 3JAMf 3CC21 3MZLB 4RS4A 3CMAZ 3NH5A 4A3EI 4A3FI 1TWGI 4A3CI 3S14I 3CC4Z 3HOVI 4A3II 1QF8A 1YUKA 1I3QI 3LUSA 3GTMS 2RT9A 3TDHB 2JA6I 4NH1C 4MXUA 3HOXI 3CCV1 3M3YI 1NUIA 1VQ9Z 1WW9A 2F4OA 3I07A 2P28A 1M901 2V8IA 4NBFA 3CMA1 2YADA 1PFTA 1ZH1A 1TWAI 1TFIA 4AYBA 3CC41 3CPWZ 1VQ5Z 2JA7I 2RIQA 2M48A 4NBGA 1W2BZ 1VQ7Z 1TWHI 2IZ4A 2GU2A 3IX0A 3S1NI 1X3ZA 4MD9A 1RO2A 3NDJA 3QWUA 5IT9f 4Y52I 3G6EZ 1NJI1 3CCJ1 4DQYB 1S72Z 3CMEZ 1RQFA 2VF1A 3VB9A 1K8A2 3J81f 2E9HA 4MRIA 2GTIA 2OTL1 1VQN1 3CCSZ 1VQ51 3CC71 3NH4A 2JUBA 2IZ3A 3S15I 4RVFA 2RPRA 4RVGA 4BXXI 3G6E1 3K7AI 1X0TA 3M4OI 4RVDA 2DE5A 4NB8A 3GTJI 3T4NB 4A3KI 3I551 5T67A 1I50I 1WIIA 2R7ZI 2M6NA 5T6BA 3VTNA 2QRCB 1Z02A 2JS4A 3KIFA 3G711 3F3PC 5C4JI 1Y1VI 1YJ9Z 5IT9b 2V8KA 2V8JA 1KD12 1YITZ 3MONA 2R93I 2LFUA 2Y0SA 4BBSI 5FLMI 3J81b 1YJW1 2QR1B 3I561 1K8A1 3CD61 1NJI2 3NFZA 3GTLI 2NVXI 2P3YA 1Q821 4E30A 2OTJZ 1Q812 3G4S1 1VQK1 2OOXB 1R9TI 3RZDI 1N8R2 1YIT1 2NVTI 2Q51A 2YU9I 3CCE1 5IP7I 3OW2Y 3BG1B 1USPA 3HOUI 2R6MA 2QEX1 2WAQA 2JR6A 1L1OC 1YI21 2QA41 2OTJ1 1RNIA 2JNYA 2E2HI 3CQZI 4NBEA 4NBAA 3GKQA 5A2Qf 2R92I 1M1K2 1S7MA 3KIHA 2QKDA 1USPB 1KC82 2J6AA 4E2XA 1VQLZ 3CCRZ 1K9M1 1KD11 1TWCI 2WB1A 4EWCA 2G2KA 2PM9A 1VQ91 3PO2I 3PO3I 4CL1A 1VQPZ 2W04A 3CXCY 2JA8I 4MONA 1QVFY 2QRDB 1VQ6Z 3EERA 4HGYA 4QTUA 2E2JI 4NBCA 1Q811 3GCFA 3S17I 3CCR1 3VMIA 2RHBA 1Q822 1N8R1 3J7A4 4A3BI 4E33A 3S1MI 1VQ8Z 3S1QI 3CCUZ 1VQ71 1QYPA 1VQOZ 3GTPI 1S721 3U50C 3CME1 4A3LI 3FQMA 1YHQZ 3OW2Z 2OZKA 2ZAEB 5A2Qb 4MD7A 3CCS1 1Q7Y1 5C3EI 3ESWA 2JMOA 1VQMZ 2QLVB 3IF8A 3D9XA 1M1K1 3J80f 4Y7NI 2RBLA 3HKZA 1KC81 5C4XI 4A3DI 2KI7B 4E32A 2PK7A 1QVGY 3BG0B 1SFOI 1P9NA 2HF1A 3PO3S 3TE5B 1K9M2 5IP9I 4DK1A 1LQLA 1Z01A 3HOWI 1KQSY 1Q862 3S1RI 2AKLA 1YJNZ 4E2WA 2LIYA 4NOZA 3CXCZ 3GTGI 3GTKI 1JJ2Y 3I4MI 4A3GI 4MD8A 1QVFZ 4XX2A 4S1TA 3CC2Z 2H85A 1YJ91 5LL6f 4NBDA 4X6AI 2Q4ZA 1K83I 2I3CA 3IFUA 1WCMI 4DGLA 3MZKB 1KRLA 3CCMZ 2DE6A 3CCVZ 2OOYB 1I6HI 1JWHC 3D6WA 1X3WA 3J80b 5FLXb 4NBHA 4TNUA 1Q7Y2 2DE7A 1K732 1Y1VS 4NBBA 1Y1WI 4E31A 3H0GI 2EGTA 3CCM1 5T64A 1QVGZ 2E2II 3CCQZ 1ZB9A 4RVHA 4BY7I 1YIJZ 3FKII 1Q861 3NH8A 3CCJZ 2K5RA 4A93I 1KQSZ 3HOZI 2OTLZ 1VQNZ 1VQ4Z 2VUMI 3CC7Z 2QREB 3CCLZ 1VQL1 2KPIA 1JJ2Z 4E2YA 2PMZA 1RLYA 3CCQ1 3S2DI 3S2HI 3I4NI 1YIJ1 2B63I 2NVYI 4HGZA 2GTHA 1VQP1 2VUGA 3FQQA 2HU9A 3JAMb 2NVQI 5D1OA 3P5JB 1VQ61 1VQ41 3I55Z 2W03A 4QTTA 4RV9A 1YUAA 3RZOI 3CCL1 1TWFI 2F4MA 4A3JI 1K731 1VQ81 3CCU1 3EEDA 3NDIA 3G71Z 2K3RA 1RO0A 1VLAA 5FLXf 5D1OB 1ZB8A 1VQO1 3GTOI 4BY1I 5CM2M 4HH4A 1YHQ1 1NP6A 3F3FC 3GTMI 1YJWZ 5D1PA 2O53A 2O4HA 1ML8A 3I56Z 3CD6Z 1M902 3S16I 4NFRA 3HOYI 1VQM1 3CPWY 3GTQI 1DL6A 1W2BY 5AN9F 4MH4A 3G4SZ 1VQKZ 4E2ZA 2JA5I 3CCEZ 3Q87A 1N2FA 4A3MI 1RO4A 2BJOA 1YJN1 4NB9A 2QEXZ 1Z03A 5C44I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMG A;  1ZB9 A;  3H3V J;  4BY7 I;  4BBR I;  3FKI I;  3VMH A;  1QYP A;  5C4J I;  2K5R A;  1Y1V I;  3GTP I;  3U50 C;  4A93 I;  4A3L I;  4A3E I;  4A3F I;  1TWG I;  3HOZ I;  4A3C I;  2R93 I;  3S14 I;  3HOV I;  4BBS I;  5FLM I;  4A3I I;  2VUM I;  5C3E I;  3ESW A;  1I3Q I;  2KPI A;  3LUS A;  3GTM S;  2JA6 I;  3HOX I;  3M3Y I;  1NUI A;  3GTL I;  1WW9 A;  2RBL A;  1RLY A;  4Y7N I;  3S2D I;  2NVX I;  2F4O A;  2P3Y A;  3S2H I;  3I4N I;  3I07 A;  5C4X I;  2B63 I;  4A3D I;  2NVY I;  2PK7 A;  1SFO I;  4NBF A;  1R9T I;  2HF1 A;  3RZD I;  2NVQ I;  3PO3 S;  1PFT A;  5IP9 I;  2NVT I;  1LQL A;  2YU9 I;  1TWA I;  1TFI A;  5IP7 I;  3HOW I;  4QTT A;  1YUA A;  2JA7 I;  3RZO I;  3S1R I;  2AKL A;  1TWF I;  1USP A;  2F4M A;  4NOZ A;  4A3J I;  3HOU I;  4NBG A;  1TWH I;  3GTG I;  3S1N I;  1X3Z A;  2JR6 A;  3GTK I;  1L1O C;  3I4M I;  4A3G I;  1VLA A;  4XX2 A;  4Y52 I;  1ZB8 A;  2JNY A;  2E2H I;  4NBD A;  3GTO I;  4BY1 I;  3VB9 A;  3CQZ I;  5CM2 M;  4X6A I;  4NBE A;  4NBA A;  3GKQ A;  1K83 I;  2R92 I;  3GTM I;  1WCM I;  1USP B;  1ML8 A;  2J6A A;  3S16 I;  2DE6 A;  3HOY I;  1TWC I;  1I6H I;  3S15 I;  3D6W A;  3PO2 I;  3GTQ I;  3PO3 I;  1DL6 A;  1X3W A;  4BXX I;  4MH4 A;  2JA8 I;  3K7A I;  2JA5 I;  4NBH A;  3M4O I;  2DE5 A;  2DE7 A;  4NB8 A;  3EER A;  3GTJ I;  4QTU A;  2E2J I;  1Y1V S;  3Q87 A;  1N2F A;  4NBC A;  4NBB A;  1Y1W I;  3GCF A;  3H0G I;  4A3K I;  3S17 I;  1I50 I;  3VMI A;  2R7Z I;  4A3M I;  4A3B I;  1RO4 A;  2BJO A;  3S1M I;  4NB9 A;  3S1Q I;  2JS4 A;  2E2I I;  5C44 I; 
#chains in the Genus database with same CATH topology
 3VMG A;  1YI2 Z;  2QA4 Z;  3H3V J;  4BBR I;  3VMH A;  3JAM f;  3CC2 1;  3MZL B;  4RS4 A;  3CMA Z;  1Q16 A;  3NH5 A;  4A3E I;  4A3F I;  1TWG I;  4A3C I;  3S14 I;  3CC4 Z;  3HOV I;  4A3I I;  1QF8 A;  1YUK A;  1I3Q I;  3LUS A;  3GTM S;  2RT9 A;  3TDH B;  2JA6 I;  4NH1 C;  4MXU A;  3HOX I;  3CCV 1;  3M3Y I;  1NUI A;  1VQ9 Z;  1WW9 A;  2F4O A;  3I07 A;  2P28 A;  1M90 1;  2V8I A;  4NBF A;  3CMA 1;  2VPZ A;  2YAD A;  1PFT A;  1ZH1 A;  1TWA I;  1TFI A;  4AYB A;  3CC4 1;  3CPW Z;  1VQ5 Z;  3D2L A;  3IR7 A;  2JA7 I;  2RIQ A;  2JIR A;  2M48 A;  4NBG A;  1W2B Z;  1VQ7 Z;  1TWH I;  2IZ4 A;  2GU2 A;  3IX0 A;  3S1N I;  1X3Z A;  4MD9 A;  1RO2 A;  3NDJ A;  3QWU A;  5IT9 f;  4Y52 I;  3G6E Z;  1NJI 1;  3CCJ 1;  4DQY B;  1S72 Z;  3CME Z;  1RQF A;  2VF1 A;  3VB9 A;  1K8A 2;  3J81 f;  2E9H A;  4MRI A;  2GTI A;  2OTL 1;  1VQN 1;  3CCS Z;  1VQ5 1;  3CC7 1;  3NH4 A;  2JUB A;  2IZ3 A;  3S15 I;  4RVF A;  2RPR A;  4RVG A;  4BXX I;  3G6E 1;  3K7A I;  1X0T A;  3M4O I;  4RVD A;  2DE5 A;  4NB8 A;  3GTJ I;  3T4N B;  4A3K I;  3I55 1;  5T67 A;  1I50 I;  1WII A;  2R7Z I;  2M6N A;  5T6B A;  3VTN A;  2QRC B;  1Z02 A;  2JS4 A;  3KIF A;  3G71 1;  1AA6 A;  3F3P C;  5C4J I;  1Y1V I;  1YJ9 Z;  5IT9 b;  2V8K A;  2V8J A;  1KD1 2;  1YIT Z;  3MON A;  2R93 I;  2LFU A;  2Y0S A;  1SIW A;  4BBS I;  5FLM I;  3J81 b;  1YJW 1;  2QR1 B;  2V3V A;  3I56 1;  1K8A 1;  3CD6 1;  1NJI 2;  3NFZ A;  3GTL I;  2NVX I;  2P3Y A;  1Q82 1;  4E30 A;  2IV2 X;  2OTJ Z;  1Q81 2;  3G4S 1;  1VQK 1;  2OOX B;  1R9T I;  3RZD I;  1N8R 2;  1YIT 1;  2NVT I;  2Q51 A;  2YU9 I;  3CCE 1;  5IP7 I;  3OW2 Y;  3BG1 B;  1USP A;  3HOU I;  2R6M A;  2QEX 1;  2WAQ A;  2JR6 A;  1L1O C;  1YI2 1;  2QA4 1;  2OTJ 1;  1RNI A;  2JNY A;  2E2H I;  3CQZ I;  4NBE A;  4NBA A;  3GKQ A;  5A2Q f;  2R92 I;  1M1K 2;  1S7M A;  3KIH A;  2QKD A;  1USP B;  1KC8 2;  2J6A A;  4E2X A;  1VQL Z;  3CCR Z;  1K9M 1;  1KD1 1;  1TWC I;  2WB1 A;  4EWC A;  2G2K A;  2PM9 A;  1VQ9 1;  3PO2 I;  3PO3 I;  4CL1 A;  1VQP Z;  2W04 A;  3CXC Y;  2JA8 I;  4MON A;  1QVF Y;  2QRD B;  1VQ6 Z;  3EER A;  4HGY A;  2V45 A;  2NAP A;  4QTU A;  2E2J I;  1FDO A;  4NBC A;  1Q81 1;  3GCF A;  3S17 I;  3CCR 1;  3VMI A;  2RHB A;  1Q82 2;  1N8R 1;  3J7A 4;  4A3B I;  4E33 A;  3S1M I;  1VQ8 Z;  3S1Q I;  3CCU Z;  1VQ7 1;  1QYP A;  1VQO Z;  3GTP I;  1S72 1;  3U50 C;  3CME 1;  4A3L I;  3FQM A;  1YHQ Z;  2JIM A;  3OW2 Z;  2OZK A;  2ZAE B;  5A2Q b;  4MD7 A;  3CCS 1;  1Q7Y 1;  5C3E I;  3ESW A;  2JMO A;  1VQM Z;  2VPX A;  2QLV B;  3IF8 A;  3D9X A;  1M1K 1;  3J80 f;  4Y7N I;  2RBL A;  3HKZ A;  1KC8 1;  5C4X I;  4A3D I;  2KI7 B;  2JIQ A;  4E32 A;  2PK7 A;  1QVG Y;  3BG0 B;  1SFO I;  2JIP A;  1P9N A;  2HF1 A;  3PO3 S;  3TE5 B;  1K9M 2;  5IP9 I;  2JIO A;  4DK1 A;  1LQL A;  1FDI A;  1Z01 A;  3HOW I;  1WJ2 A;  1KQS Y;  1Q86 2;  3S1R I;  2AKL A;  1YJN Z;  4E2W A;  2LIY A;  4NOZ A;  3CXC Z;  3GTG I;  3GTK I;  1JJ2 Y;  3I4M I;  4A3G I;  4MD8 A;  1QVF Z;  4XX2 A;  4S1T A;  3CC2 Z;  2H85 A;  1YJ9 1;  5LL6 f;  4NBD A;  4X6A I;  2Q4Z A;  1K83 I;  2I3C A;  3IFU A;  1WCM I;  4DGL A;  3MZK B;  1KRL A;  1QXF A;  3CCM Z;  2DE6 A;  3CCV Z;  2OOY B;  1WZN A;  1I6H I;  1JWH C;  3D6W A;  1X3W A;  3J80 b;  5FLX b;  4NBH A;  4TNU A;  1Q7Y 2;  2DE7 A;  1K73 2;  1Y8C A;  1Y1V S;  4NBB A;  1Y1W I;  4E31 A;  3H0G I;  2EGT A;  3CCM 1;  5T64 A;  1QVG Z;  2E2I I;  3CCQ Z;  1ZB9 A;  4RVH A;  4BY7 I;  1YIJ Z;  3FKI I;  1Q86 1;  3NH8 A;  3CCJ Z;  2K5R A;  4A93 I;  1KQS Z;  3HOZ I;  2OTL Z;  1VQN Z;  1VQ4 Z;  2VUM I;  3CC7 Z;  2QRE B;  3CCL Z;  1VQL 1;  2KPI A;  2VPY A;  1JJ2 Z;  4E2Y A;  2VPW A;  2PMZ A;  1RLY A;  3CCQ 1;  3S2D I;  3S2H I;  3I4N I;  1YIJ 1;  2B63 I;  2NVY I;  4HGZ A;  2GTH A;  1VQP 1;  2VUG A;  3FQQ A;  2HU9 A;  3JAM b;  2NVQ I;  5D1O A;  3P5J B;  1VQ6 1;  1VQ4 1;  3I55 Z;  2W03 A;  4QTT A;  4RV9 A;  1YUA A;  2E7Z A;  3CCL 1;  3RZO I;  1TWF I;  2F4M A;  4A3J I;  1K73 1;  1VQ8 1;  3CCU 1;  3EED A;  3NDI A;  3G71 Z;  2K3R A;  1RO0 A;  1VLA A;  5FLX f;  5D1O B;  1ZB8 A;  1VQO 1;  3GTO I;  4BY1 I;  5CM2 M;  4HH4 A;  1YHQ 1;  1NP6 A;  3F3F C;  3GTM I;  1YJW Z;  5D1P A;  2O53 A;  2O4H A;  1ML8 A;  3I56 Z;  3CD6 Z;  1M90 2;  3S16 I;  4NFR A;  3HOY I;  1VQM 1;  3CPW Y;  3GTQ I;  2AYD A;  1DL6 A;  1W2B Y;  5AN9 F;  4MH4 A;  3G4S Z;  1VQK Z;  4E2Z A;  2LEX A;  2JA5 I;  3CCE Z;  3Q87 A;  1N2F A;  4A3M I;  1RO4 A;  2BJO A;  1YJN 1;  4NB9 A;  2QEX Z;  1Z03 A;  5C44 I; 
#chains in the Genus database with same CATH homology
 3VMG A;  1YI2 Z;  2QA4 Z;  3H3V J;  4BBR I;  3VMH A;  3JAM f;  3CC2 1;  3MZL B;  4RS4 A;  3CMA Z;  3NH5 A;  4A3E I;  4A3F I;  1TWG I;  4A3C I;  3S14 I;  3CC4 Z;  3HOV I;  4A3I I;  1QF8 A;  1YUK A;  1I3Q I;  3LUS A;  3GTM S;  2RT9 A;  3TDH B;  2JA6 I;  4NH1 C;  4MXU A;  3HOX I;  3CCV 1;  3M3Y I;  1NUI A;  1VQ9 Z;  1WW9 A;  2F4O A;  3I07 A;  2P28 A;  1M90 1;  2V8I A;  4NBF A;  3CMA 1;  2YAD A;  1PFT A;  1ZH1 A;  1TWA I;  1TFI A;  4AYB A;  3CC4 1;  3CPW Z;  1VQ5 Z;  2JA7 I;  2RIQ A;  2M48 A;  4NBG A;  1W2B Z;  1VQ7 Z;  1TWH I;  2IZ4 A;  2GU2 A;  3IX0 A;  3S1N I;  1X3Z A;  4MD9 A;  1RO2 A;  3NDJ A;  3QWU A;  5IT9 f;  4Y52 I;  3G6E Z;  1NJI 1;  3CCJ 1;  4DQY B;  1S72 Z;  3CME Z;  1RQF A;  2VF1 A;  3VB9 A;  1K8A 2;  3J81 f;  2E9H A;  4MRI A;  2GTI A;  2OTL 1;  1VQN 1;  3CCS Z;  1VQ5 1;  3CC7 1;  3NH4 A;  2JUB A;  2IZ3 A;  3S15 I;  4RVF A;  2RPR A;  4RVG A;  4BXX I;  3G6E 1;  3K7A I;  1X0T A;  3M4O I;  4RVD A;  2DE5 A;  4NB8 A;  3GTJ I;  3T4N B;  4A3K I;  3I55 1;  5T67 A;  1I50 I;  1WII A;  2R7Z I;  2M6N A;  5T6B A;  3VTN A;  2QRC B;  1Z02 A;  2JS4 A;  3KIF A;  3G71 1;  3F3P C;  5C4J I;  1Y1V I;  1YJ9 Z;  5IT9 b;  2V8K A;  2V8J A;  1KD1 2;  1YIT Z;  3MON A;  2R93 I;  2LFU A;  2Y0S A;  4BBS I;  5FLM I;  3J81 b;  1YJW 1;  2QR1 B;  3I56 1;  1K8A 1;  3CD6 1;  1NJI 2;  3NFZ A;  3GTL I;  2NVX I;  2P3Y A;  1Q82 1;  4E30 A;  2OTJ Z;  1Q81 2;  3G4S 1;  1VQK 1;  2OOX B;  1R9T I;  3RZD I;  1N8R 2;  1YIT 1;  2NVT I;  2Q51 A;  2YU9 I;  3CCE 1;  5IP7 I;  3OW2 Y;  3BG1 B;  1USP A;  3HOU I;  2R6M A;  2QEX 1;  2WAQ A;  2JR6 A;  1L1O C;  1YI2 1;  2QA4 1;  2OTJ 1;  1RNI A;  2JNY A;  2E2H I;  3CQZ I;  4NBE A;  4NBA A;  3GKQ A;  5A2Q f;  2R92 I;  1M1K 2;  1S7M A;  3KIH A;  2QKD A;  1USP B;  1KC8 2;  2J6A A;  4E2X A;  1VQL Z;  3CCR Z;  1K9M 1;  1KD1 1;  1TWC I;  2WB1 A;  4EWC A;  2G2K A;  2PM9 A;  1VQ9 1;  3PO2 I;  3PO3 I;  4CL1 A;  1VQP Z;  2W04 A;  3CXC Y;  2JA8 I;  4MON A;  1QVF Y;  2QRD B;  1VQ6 Z;  3EER A;  4HGY A;  4QTU A;  2E2J I;  4NBC A;  1Q81 1;  3GCF A;  3S17 I;  3CCR 1;  3VMI A;  2RHB A;  1Q82 2;  1N8R 1;  3J7A 4;  4A3B I;  4E33 A;  3S1M I;  1VQ8 Z;  3S1Q I;  3CCU Z;  1VQ7 1;  1QYP A;  1VQO Z;  3GTP I;  1S72 1;  3U50 C;  3CME 1;  4A3L I;  3FQM A;  1YHQ Z;  3OW2 Z;  2OZK A;  2ZAE B;  5A2Q b;  4MD7 A;  3CCS 1;  1Q7Y 1;  5C3E I;  3ESW A;  2JMO A;  1VQM Z;  2QLV B;  3IF8 A;  3D9X A;  1M1K 1;  3J80 f;  4Y7N I;  2RBL A;  3HKZ A;  1KC8 1;  5C4X I;  4A3D I;  2KI7 B;  4E32 A;  2PK7 A;  1QVG Y;  3BG0 B;  1SFO I;  1P9N A;  2HF1 A;  3PO3 S;  3TE5 B;  1K9M 2;  5IP9 I;  4DK1 A;  1LQL A;  1Z01 A;  3HOW I;  1KQS Y;  1Q86 2;  3S1R I;  2AKL A;  1YJN Z;  4E2W A;  2LIY A;  4NOZ A;  3CXC Z;  3GTG I;  3GTK I;  1JJ2 Y;  3I4M I;  4A3G I;  4MD8 A;  1QVF Z;  4XX2 A;  4S1T A;  3CC2 Z;  2H85 A;  1YJ9 1;  5LL6 f;  4NBD A;  4X6A I;  2Q4Z A;  1K83 I;  2I3C A;  3IFU A;  1WCM I;  4DGL A;  3MZK B;  1KRL A;  3CCM Z;  2DE6 A;  3CCV Z;  2OOY B;  1I6H I;  1JWH C;  3D6W A;  1X3W A;  3J80 b;  5FLX b;  4NBH A;  4TNU A;  1Q7Y 2;  2DE7 A;  1K73 2;  1Y1V S;  4NBB A;  1Y1W I;  4E31 A;  3H0G I;  2EGT A;  3CCM 1;  5T64 A;  1QVG Z;  2E2I I;  3CCQ Z;  1ZB9 A;  4RVH A;  4BY7 I;  1YIJ Z;  3FKI I;  1Q86 1;  3NH8 A;  3CCJ Z;  2K5R A;  4A93 I;  1KQS Z;  3HOZ I;  2OTL Z;  1VQN Z;  1VQ4 Z;  2VUM I;  3CC7 Z;  2QRE B;  3CCL Z;  1VQL 1;  2KPI A;  1JJ2 Z;  4E2Y A;  2PMZ A;  1RLY A;  3CCQ 1;  3S2D I;  3S2H I;  3I4N I;  1YIJ 1;  2B63 I;  2NVY I;  4HGZ A;  2GTH A;  1VQP 1;  2VUG A;  3FQQ A;  2HU9 A;  3JAM b;  2NVQ I;  5D1O A;  3P5J B;  1VQ6 1;  1VQ4 1;  3I55 Z;  2W03 A;  4QTT A;  4RV9 A;  1YUA A;  3RZO I;  3CCL 1;  1TWF I;  2F4M A;  4A3J I;  1K73 1;  1VQ8 1;  3CCU 1;  3EED A;  3NDI A;  3G71 Z;  2K3R A;  1RO0 A;  1VLA A;  5FLX f;  5D1O B;  1ZB8 A;  1VQO 1;  3GTO I;  4BY1 I;  5CM2 M;  4HH4 A;  1YHQ 1;  1NP6 A;  3F3F C;  3GTM I;  1YJW Z;  5D1P A;  2O53 A;  2O4H A;  1ML8 A;  3I56 Z;  3CD6 Z;  1M90 2;  3S16 I;  4NFR A;  3HOY I;  1VQM 1;  3CPW Y;  3GTQ I;  1DL6 A;  1W2B Y;  5AN9 F;  4MH4 A;  3G4S Z;  1VQK Z;  4E2Z A;  2JA5 I;  3CCE Z;  3Q87 A;  1N2F A;  4A3M I;  1RO4 A;  2BJO A;  1YJN 1;  4NB9 A;  2QEX Z;  1Z03 A;  5C44 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...