2JR6A

Solution structure of upf0434 protein nma0874. northeast structural genomics target mr32
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEEELKALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0434 protein NMA0874
publication title Solution structure of UPF0434 protein NMA0874.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jr6A01
1VLAA 4NBGA 5CM2M 5IP9I 1RO4A 4A3BI 3I4MI 2JA7I 3GTOI 5FLMI 2F4MA 3I07A 5IP7I 4A3DI 3GTLI 1K83I 1Y1VS 1LQLA 2DE6A 4A3JI 4BY1I 1I3QI 1WCMI 4XX2A 1ZB9A 4A3FI 1TFIA 4NOZA 2J6AA 3S1NI 1TWAI 1Y1WI 3GTMS 2E2HI 1TWCI 2NVQI 3PO3I 5C4XI 3D6WA 2DE5A 3H3VJ 2YU9I 2HF1A 4A3EI 3CQZI 5C4JI 4A3II 5C3EI 2R7ZI 1I6HI 3RZOI 3EERA 3HOXI 3HOUI 2F4OA 3GTQI 2RBLA 3S15I 4BY7I 1N2FA 3GTKI 3I4NI 3GCFA 3RZDI 1X3WA 2JA8I 2KPIA 1PFTA 2PK7A 4MH4A 4A3KI 3S1QI 1TWFI 2R93I 4X6AI 4A3LI 2NVYI 4A93I 1DL6A 3S1RI 3S14I 1RLYA 3S2HI 3VB9A 1X3ZA 2AKLA 4Y7NI 3GTPI 3HOYI 1SFOI 4NBHA 4NB8A 1ZB8A 3GKQA 1USPA 4BXXI 3HOWI 1TWGI 1WW9A 4QTTA 2BJOA 3VMIA 2JR6A 3K7AI 3S2DI 3S1MI 4A3GI 1USPB 1Y1VI 3FKII 2JA5I 2P3YA 1R9TI 3GTGI 3GTMI 3HOVI 2JNYA 4NBAA 2B63I 2NVXI 3S16I 3PO3S 3U50C 1QYPA 3GTJI 1L1OC 5C44I 1YUAA 3Q87A 3PO2I 4Y52I 3H0GI 2NVTI 4NB9A 2E2II 2E2JI 3ESWA 1ML8A 4NBFA 3VMGA 4BBRI 2VUMI 2K5RA 4NBDA 3M3YI 4A3MI 3HOZI 2JA6I 1I50I 4NBCA 2R92I 1NUIA 3LUSA 3VMHA 2JS4A 4QTUA 1TWHI 2DE7A 4BBSI 3M4OI 4NBEA 3S17I 4NBBA 4A3CI
chains in the Genus database with same CATH superfamily
5CM2M 3J81f 1Q822 2VPYA 5IP7I 3CME1 1K83I 1VQ7Z 2DE6A 4A3JI 2RPRA 1TWAI 4MD9A 2NVQI 5C4XI 1QXFA 1RNIA 2DE5A 3H3VJ 2OZKA 2RHBA 3FQQA 2OTJ1 4AYBA 1VQOZ 4E32A 3CCEZ 1K8A1 2RBLA 1VQL1 1S721 1N2FA 3GTKI 2VPWA 4RVGA 1X3WA 5FLXb 1PFTA 4MH4A 1NJI2 2R93I 1W2BZ 3KIFA 1Q861 4A93I 2KI7B 3S14I 3MZKB 1X3ZA 1ZH1A 1YJNZ 3NDJA 1VQNZ 1USPA 4BXXI 3CCL1 3S1MI 5D1OA 1USPB 1JWHC 5A2Qf 3I55Z 1K732 2QRDB 3NFZA 3CCMZ 1VQ9Z 1Z03A 3KIHA 1M1K1 3BG1B 3GTGI 2JUBA 3CC2Z 1VQ51 2Q4ZA 3PO3S 2LEXA 3U50C 4E33A 1L1OC 4RS4A 3Q87A 3PO2I 4Y52I 2E2JI 3CMA1 4NBFA 5D1PA 3TDHB 2K5RA 1FDIA 1S7MA 3I561 4MONA 4E31A 3VMHA 3G6EZ 3CCU1 3J80b 3CCQ1 1VQ8Z 4BBSI 3CCR1 1JJ2Y 2QLVB 3MONA 4DQYB 4NBBA 2EGTA 2IZ4A 2NAPA 4MRIA 3D9XA 5IP9I 3I4MI 1VQ71 3G4S1 4A3DI 5FLXf 1Y1VS 3CPWZ 4BY1I 4RVFA 4A3FI 2PMZA 1N8R1 3PO3I 2P28A 2E9HA 2YU9I 1VQO1 1YUKA 3CCE1 5C4JI 5C3EI 2R7ZI 1I6HI 3RZOI 3HOUI 1KD12 2RIQA 3G4SZ 1QVGZ 3MZLB 1KQSZ 1YIJZ 4TNUA 1DL6A 2QEXZ 1YJN1 1VQKZ 1YITZ 2AKLA 1VQN1 1SFOI 2JMOA 2GU2A 3TE5B 3HOWI 1TWGI 4QTTA 2JR6A 2AYDA 3K7AI 4A3GI 3I551 1Y1VI 3J80f 3CCM1 1Q821 3FKII 1VQ91 2JIQA 1WZNA 2GTHA 2H85A 3CC21 1R9TI 2V3VA 2JNYA 4NBAA 1KC82 1QYPA 2K3RA 1YUAA 2M6NA 4NB9A 2W04A 1X0TA 1QVFZ 1AA6A 1Q812 2VUMI 4A3CI 1WIIA 2JA6I 3G6E1 4HGYA 3IF8A 1VQ81 1TWHI 5IT9b 5D1OB 2W03A 3G71Z 3CC4Z 2LFUA 3D2LA 3CXCY 1K9M2 3S17I 1NJI1 1FDOA 1VLAA 4NBGA 2QA4Z 3OW2Y 2O4HA 3GTOI 5FLMI 3I07A 3IX0A 3GTLI 2OTLZ 5T64A 2VPXA 2ZAEB 1Q7Y2 1WCMI 4XX2A 1ZB9A 4RVDA 1VQMZ 4NOZA 3S1NI 3GTMS 1YHQZ 3NH8A 3CCVZ 1TWCI 1K731 3IFUA 1M902 2LIYA 3D6WA 3P5JB 2HF1A 1QF8A 3VTNA 3EERA 1K9M1 4MXUA 3S15I 1RO2A 5T6BA 3T4NB 3GCFA 2I3CA 1YIJ1 1VQ6Z 4A3KI 3S1QI 4X6AI 2QEX1 1VQK1 1YIT1 3S1RI 3HOYI 4Y7NI 5T67A 4NB8A 3GKQA 2IV2X 1YJWZ 1M901 2E7ZA 1SIWA 2BJOA 3VMIA 4NFRA 4DK1A 3BG0B 3HKZA 5IT9f 2OOYB 2P3YA 2V8JA 3GTMI 3CCJZ 3NH5A 1W2BY 3HOVI 1YJ9Z 2V8KA 3CD6Z 4MD7A 2NVXI 2B63I 2JIOA 3CCSZ 1VQPZ 1YI2Z 2G2KA 1JJ2Z 3GTJI 1Z01A 2V45A 4CL1A 3F3PC 3H0GI 2NVTI 3ESWA 3VMGA 4BBRI 1VQ4Z 3HOZI 4NH1C 1KRLA 4S1TA 4E2XA 1NUIA 3LUSA 1Q862 1KD11 3JAMb 5AN9F 1Z02A 3G711 2DE7A 4DGLA 3CC41 2QREB 1RO0A 5LL6f 4HGZA 3CC7Z 2WB1A 4NBEA 2QA41 2VPZA 1RO4A 4A3BI 2JA7I 2F4MA 2OTL1 1M1K2 2YADA 1RQFA 2GTIA 1WJ2A 1LQLA 3CMEZ 2Q51A 1VQM1 1I3QI 1YHQ1 1TFIA 3CCV1 2J6AA 2JIMA 1Y1WI 2R6MA 2E2HI 3FQMA 2M48A 1NP6A 4HH4A 1P9NA 4A3EI 3CQZI 4E2WA 4A3II 2OTJZ 3QWUA 3HOXI 1KC81 2QRCB 2F4OA 3CPWY 3GTQI 3J81b 4BY7I 1VQLZ 2IZ3A 2HU9A 1S72Z 3I4NI 3RZDI 1Q811 1VQ61 2JA8I 2KPIA 1Q16A 2PK7A 3J7A4 1TWFI 2RT9A 4A3LI 2NVYI 4EWCA 3NH4A 2JIPA 2Y0SA 1RLYA 3S2HI 3VB9A 3GTPI 1YJW1 2VF1A 4NBHA 1ZB8A 2O53A 1WW9A 3CCLZ 1QVGY 3S2DI 3JAMf 1N8R2 2JA5I 1KQSY 3CCJ1 1YJ91 3CD61 3CCS1 3F3FC 3NDIA 4RVHA 4E30A 1VQP1 1YI21 3S16I 1VQ5Z 1Q7Y1 4MD8A 5C44I 4E2YA 2PM9A 1Y8CA 2E2II 3CXCZ 2V8IA 1ML8A 1VQ41 3CMAZ 2JIRA 3OW2Z 4NBDA 2QKDA 3M3YI 2OOXB 4A3MI 2WAQA 2VUGA 1I50I 4NBCA 2R92I 3I56Z 2JS4A 3EEDA 4QTUA 4E2ZA 3CCUZ 5A2Qb 2QR1B 3CCQZ 3M4OI 3CC71 4RV9A 3CCRZ 1K8A2 3IR7A 1QVFY
chains in the Genus database with same CATH topology
5CM2M 3J81f 1Q822 5IP7I 3CME1 1K83I 1VQ7Z 2DE6A 4A3JI 2RPRA 1TWAI 4MD9A 2NVQI 5C4XI 1RNIA 2DE5A 3H3VJ 2OZKA 2RHBA 3FQQA 2OTJ1 4AYBA 1VQOZ 4E32A 3CCEZ 1K8A1 2RBLA 1VQL1 1S721 1N2FA 3GTKI 4RVGA 1X3WA 5FLXb 1PFTA 4MH4A 1NJI2 2R93I 1W2BZ 3KIFA 1Q861 4A93I 2KI7B 3S14I 3MZKB 1X3ZA 1ZH1A 1YJNZ 3NDJA 1VQNZ 1USPA 4BXXI 3CCL1 3S1MI 5D1OA 1USPB 1JWHC 5A2Qf 3I55Z 1K732 2QRDB 3NFZA 3CCMZ 1VQ9Z 1Z03A 3KIHA 1M1K1 3BG1B 3GTGI 2JUBA 3CC2Z 1VQ51 2Q4ZA 3PO3S 3U50C 4E33A 1L1OC 4RS4A 3Q87A 3PO2I 4Y52I 2E2JI 3CMA1 4NBFA 5D1PA 3TDHB 2K5RA 1S7MA 3I561 4MONA 4E31A 3VMHA 3G6EZ 3CCU1 3J80b 3CCQ1 1VQ8Z 4BBSI 3CCR1 1JJ2Y 2QLVB 3MONA 4DQYB 4NBBA 2EGTA 2IZ4A 4MRIA 3D9XA 5IP9I 3I4MI 1VQ71 3G4S1 4A3DI 5FLXf 1Y1VS 3CPWZ 4BY1I 4RVFA 4A3FI 2PMZA 1N8R1 3PO3I 2P28A 2E9HA 2YU9I 1VQO1 1YUKA 3CCE1 5C4JI 5C3EI 2R7ZI 1I6HI 3RZOI 3HOUI 1KD12 2RIQA 3G4SZ 1QVGZ 3MZLB 1KQSZ 1YIJZ 4TNUA 1DL6A 2QEXZ 1YJN1 1VQKZ 1YITZ 2AKLA 1VQN1 1SFOI 2JMOA 2GU2A 3TE5B 3HOWI 1TWGI 4QTTA 2JR6A 3K7AI 4A3GI 3I551 1Y1VI 3J80f 3CCM1 1Q821 3FKII 1VQ91 2GTHA 2H85A 3CC21 1R9TI 2JNYA 4NBAA 1KC82 1QYPA 2K3RA 1YUAA 2M6NA 4NB9A 2W04A 1X0TA 1QVFZ 1Q812 2VUMI 4A3CI 1WIIA 2JA6I 3G6E1 4HGYA 3IF8A 1VQ81 1TWHI 5IT9b 5D1OB 2W03A 3G71Z 3CC4Z 2LFUA 3CXCY 1K9M2 3S17I 1NJI1 1VLAA 4NBGA 2QA4Z 3OW2Y 2O4HA 3GTOI 5FLMI 3I07A 3IX0A 3GTLI 2OTLZ 5T64A 2ZAEB 1Q7Y2 1WCMI 4XX2A 1ZB9A 4RVDA 1VQMZ 4NOZA 3S1NI 3GTMS 1YHQZ 3NH8A 3CCVZ 1TWCI 1K731 3IFUA 1M902 2LIYA 3D6WA 3P5JB 2HF1A 1QF8A 3VTNA 3EERA 1K9M1 4MXUA 3S15I 1RO2A 5T6BA 3T4NB 3GCFA 2I3CA 1YIJ1 1VQ6Z 4A3KI 3S1QI 4X6AI 2QEX1 1VQK1 1YIT1 3S1RI 3HOYI 4Y7NI 5T67A 4NB8A 3GKQA 1YJWZ 1M901 2BJOA 3VMIA 4NFRA 4DK1A 3BG0B 3HKZA 5IT9f 2OOYB 2P3YA 2V8JA 3GTMI 3CCJZ 3NH5A 1W2BY 3HOVI 1YJ9Z 2V8KA 3CD6Z 4MD7A 2NVXI 2B63I 3CCSZ 1VQPZ 1YI2Z 2G2KA 1JJ2Z 3GTJI 1Z01A 4CL1A 3F3PC 3H0GI 2NVTI 3ESWA 3VMGA 4BBRI 1VQ4Z 3HOZI 4NH1C 1KRLA 4S1TA 4E2XA 1NUIA 3LUSA 1Q862 1KD11 3JAMb 5AN9F 1Z02A 3G711 2DE7A 4DGLA 3CC41 2QREB 1RO0A 5LL6f 4HGZA 3CC7Z 2WB1A 4NBEA 2QA41 1RO4A 4A3BI 2JA7I 2F4MA 2OTL1 1M1K2 2YADA 1RQFA 2GTIA 1LQLA 3CMEZ 2Q51A 1VQM1 1I3QI 1YHQ1 1TFIA 3CCV1 2J6AA 1Y1WI 2R6MA 2E2HI 3FQMA 2M48A 1NP6A 4HH4A 1P9NA 4A3EI 3CQZI 4E2WA 4A3II 2OTJZ 3QWUA 3HOXI 1KC81 2QRCB 2F4OA 3CPWY 3GTQI 3J81b 4BY7I 1VQLZ 2IZ3A 2HU9A 1S72Z 3I4NI 3RZDI 1Q811 1VQ61 2JA8I 2KPIA 2PK7A 3J7A4 1TWFI 2RT9A 4A3LI 2NVYI 4EWCA 3NH4A 2Y0SA 1RLYA 3S2HI 3VB9A 3GTPI 1YJW1 2VF1A 4NBHA 1ZB8A 2O53A 1WW9A 3CCLZ 1QVGY 3S2DI 3JAMf 1N8R2 2JA5I 1KQSY 3CCJ1 1YJ91 3CD61 3CCS1 3F3FC 3NDIA 4RVHA 4E30A 1VQP1 1YI21 3S16I 1VQ5Z 1Q7Y1 4MD8A 5C44I 4E2YA 2PM9A 2E2II 3CXCZ 2V8IA 1ML8A 1VQ41 3CMAZ 3OW2Z 4NBDA 2QKDA 3M3YI 2OOXB 4A3MI 2WAQA 2VUGA 1I50I 4NBCA 2R92I 3I56Z 2JS4A 3EEDA 4QTUA 4E2ZA 3CCUZ 5A2Qb 2QR1B 3CCQZ 3M4OI 3CC71 4RV9A 3CCRZ 1K8A2 1QVFY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLA A;  4NBG A;  5CM2 M;  5IP9 I;  1RO4 A;  4A3B I;  3I4M I;  2JA7 I;  3GTO I;  5FLM I;  2F4M A;  3I07 A;  5IP7 I;  4A3D I;  3GTL I;  1K83 I;  1Y1V S;  1LQL A;  2DE6 A;  4A3J I;  4BY1 I;  1I3Q I;  1WCM I;  4XX2 A;  1ZB9 A;  4A3F I;  1TFI A;  4NOZ A;  2J6A A;  3S1N I;  1TWA I;  1Y1W I;  3GTM S;  2E2H I;  1TWC I;  2NVQ I;  3PO3 I;  5C4X I;  3D6W A;  2DE5 A;  3H3V J;  2YU9 I;  2HF1 A;  4A3E I;  3CQZ I;  5C4J I;  4A3I I;  5C3E I;  2R7Z I;  1I6H I;  3RZO I;  3EER A;  3HOX I;  3HOU I;  2F4O A;  3GTQ I;  2RBL A;  3S15 I;  4BY7 I;  1N2F A;  3GTK I;  3I4N I;  3GCF A;  3RZD I;  1X3W A;  2JA8 I;  2KPI A;  1PFT A;  2PK7 A;  4MH4 A;  4A3K I;  3S1Q I;  1TWF I;  2R93 I;  4X6A I;  4A3L I;  2NVY I;  4A93 I;  1DL6 A;  3S1R I;  3S14 I;  1RLY A;  3S2H I;  3VB9 A;  1X3Z A;  2AKL A;  4Y7N I;  3GTP I;  3HOY I;  1SFO I;  4NBH A;  4NB8 A;  1ZB8 A;  3GKQ A;  1USP A;  4BXX I;  3HOW I;  1TWG I;  1WW9 A;  4QTT A;  2BJO A;  3VMI A;  2JR6 A;  3K7A I;  3S2D I;  3S1M I;  4A3G I;  1USP B;  1Y1V I;  3FKI I;  2JA5 I;  2P3Y A;  1R9T I;  3GTG I;  3GTM I;  3HOV I;  2JNY A;  4NBA A;  2B63 I;  2NVX I;  3S16 I;  3PO3 S;  3U50 C;  1QYP A;  3GTJ I;  1L1O C;  5C44 I;  1YUA A;  3Q87 A;  3PO2 I;  4Y52 I;  3H0G I;  2NVT I;  4NB9 A;  2E2I I;  2E2J I;  3ESW A;  1ML8 A;  4NBF A;  3VMG A;  4BBR I;  2VUM I;  2K5R A;  4NBD A;  3M3Y I;  4A3M I;  3HOZ I;  2JA6 I;  1I50 I;  4NBC A;  2R92 I;  1NUI A;  3LUS A;  3VMH A;  2JS4 A;  4QTU A;  1TWH I;  2DE7 A;  4BBS I;  3M4O I;  4NBE A;  3S17 I;  4NBB A;  4A3C I; 
#chains in the Genus database with same CATH topology
 5CM2 M;  3J81 f;  1Q82 2;  2VPY A;  5IP7 I;  3CME 1;  1K83 I;  1VQ7 Z;  2DE6 A;  4A3J I;  2RPR A;  1TWA I;  4MD9 A;  2NVQ I;  5C4X I;  1QXF A;  1RNI A;  2DE5 A;  3H3V J;  2OZK A;  2RHB A;  3FQQ A;  2OTJ 1;  4AYB A;  1VQO Z;  4E32 A;  3CCE Z;  1K8A 1;  2RBL A;  1VQL 1;  1S72 1;  1N2F A;  3GTK I;  2VPW A;  4RVG A;  1X3W A;  5FLX b;  1PFT A;  4MH4 A;  1NJI 2;  2R93 I;  1W2B Z;  3KIF A;  1Q86 1;  4A93 I;  2KI7 B;  3S14 I;  3MZK B;  1X3Z A;  1ZH1 A;  1YJN Z;  3NDJ A;  1VQN Z;  1USP A;  4BXX I;  3CCL 1;  3S1M I;  5D1O A;  1USP B;  1JWH C;  5A2Q f;  3I55 Z;  1K73 2;  2QRD B;  3NFZ A;  3CCM Z;  1VQ9 Z;  1Z03 A;  3KIH A;  1M1K 1;  3BG1 B;  3GTG I;  2JUB A;  3CC2 Z;  1VQ5 1;  2Q4Z A;  3PO3 S;  2LEX A;  3U50 C;  4E33 A;  1L1O C;  4RS4 A;  3Q87 A;  3PO2 I;  4Y52 I;  2E2J I;  3CMA 1;  4NBF A;  5D1P A;  3TDH B;  2K5R A;  1FDI A;  1S7M A;  3I56 1;  4MON A;  4E31 A;  3VMH A;  3G6E Z;  3CCU 1;  3J80 b;  3CCQ 1;  1VQ8 Z;  4BBS I;  3CCR 1;  1JJ2 Y;  2QLV B;  3MON A;  4DQY B;  4NBB A;  2EGT A;  2IZ4 A;  2NAP A;  4MRI A;  3D9X A;  5IP9 I;  3I4M I;  1VQ7 1;  3G4S 1;  4A3D I;  5FLX f;  1Y1V S;  3CPW Z;  4BY1 I;  4RVF A;  4A3F I;  2PMZ A;  1N8R 1;  3PO3 I;  2P28 A;  2E9H A;  2YU9 I;  1VQO 1;  1YUK A;  3CCE 1;  5C4J I;  5C3E I;  2R7Z I;  1I6H I;  3RZO I;  3HOU I;  1KD1 2;  2RIQ A;  3G4S Z;  1QVG Z;  3MZL B;  1KQS Z;  1YIJ Z;  4TNU A;  1DL6 A;  2QEX Z;  1YJN 1;  1VQK Z;  1YIT Z;  2AKL A;  1VQN 1;  1SFO I;  2JMO A;  2GU2 A;  3TE5 B;  3HOW I;  1TWG I;  4QTT A;  2JR6 A;  2AYD A;  3K7A I;  4A3G I;  3I55 1;  1Y1V I;  3J80 f;  3CCM 1;  1Q82 1;  3FKI I;  1VQ9 1;  2JIQ A;  1WZN A;  2GTH A;  2H85 A;  3CC2 1;  1R9T I;  2V3V A;  2JNY A;  4NBA A;  1KC8 2;  1QYP A;  2K3R A;  1YUA A;  2M6N A;  4NB9 A;  2W04 A;  1X0T A;  1QVF Z;  1AA6 A;  1Q81 2;  2VUM I;  4A3C I;  1WII A;  2JA6 I;  3G6E 1;  4HGY A;  3IF8 A;  1VQ8 1;  1TWH I;  5IT9 b;  5D1O B;  2W03 A;  3G71 Z;  3CC4 Z;  2LFU A;  3D2L A;  3CXC Y;  1K9M 2;  3S17 I;  1NJI 1;  1FDO A;  1VLA A;  4NBG A;  2QA4 Z;  3OW2 Y;  2O4H A;  3GTO I;  5FLM I;  3I07 A;  3IX0 A;  3GTL I;  2OTL Z;  5T64 A;  2VPX A;  2ZAE B;  1Q7Y 2;  1WCM I;  4XX2 A;  1ZB9 A;  4RVD A;  1VQM Z;  4NOZ A;  3S1N I;  3GTM S;  1YHQ Z;  3NH8 A;  3CCV Z;  1TWC I;  1K73 1;  3IFU A;  1M90 2;  2LIY A;  3D6W A;  3P5J B;  2HF1 A;  1QF8 A;  3VTN A;  3EER A;  1K9M 1;  4MXU A;  3S15 I;  1RO2 A;  5T6B A;  3T4N B;  3GCF A;  2I3C A;  1YIJ 1;  1VQ6 Z;  4A3K I;  3S1Q I;  4X6A I;  2QEX 1;  1VQK 1;  1YIT 1;  3S1R I;  3HOY I;  4Y7N I;  5T67 A;  4NB8 A;  3GKQ A;  2IV2 X;  1YJW Z;  1M90 1;  2E7Z A;  1SIW A;  2BJO A;  3VMI A;  4NFR A;  4DK1 A;  3BG0 B;  3HKZ A;  5IT9 f;  2OOY B;  2P3Y A;  2V8J A;  3GTM I;  3CCJ Z;  3NH5 A;  1W2B Y;  3HOV I;  1YJ9 Z;  2V8K A;  3CD6 Z;  4MD7 A;  2NVX I;  2B63 I;  2JIO A;  3CCS Z;  1VQP Z;  1YI2 Z;  2G2K A;  1JJ2 Z;  3GTJ I;  1Z01 A;  2V45 A;  4CL1 A;  3F3P C;  3H0G I;  2NVT I;  3ESW A;  3VMG A;  4BBR I;  1VQ4 Z;  3HOZ I;  4NH1 C;  1KRL A;  4S1T A;  4E2X A;  1NUI A;  3LUS A;  1Q86 2;  1KD1 1;  3JAM b;  5AN9 F;  1Z02 A;  3G71 1;  2DE7 A;  4DGL A;  3CC4 1;  2QRE B;  1RO0 A;  5LL6 f;  4HGZ A;  3CC7 Z;  2WB1 A;  4NBE A;  2QA4 1;  2VPZ A;  1RO4 A;  4A3B I;  2JA7 I;  2F4M A;  2OTL 1;  1M1K 2;  2YAD A;  1RQF A;  2GTI A;  1WJ2 A;  1LQL A;  3CME Z;  2Q51 A;  1VQM 1;  1I3Q I;  1YHQ 1;  1TFI A;  3CCV 1;  2J6A A;  2JIM A;  1Y1W I;  2R6M A;  2E2H I;  3FQM A;  2M48 A;  1NP6 A;  4HH4 A;  1P9N A;  4A3E I;  3CQZ I;  4E2W A;  4A3I I;  2OTJ Z;  3QWU A;  3HOX I;  1KC8 1;  2QRC B;  2F4O A;  3CPW Y;  3GTQ I;  3J81 b;  4BY7 I;  1VQL Z;  2IZ3 A;  2HU9 A;  1S72 Z;  3I4N I;  3RZD I;  1Q81 1;  1VQ6 1;  2JA8 I;  2KPI A;  1Q16 A;  2PK7 A;  3J7A 4;  1TWF I;  2RT9 A;  4A3L I;  2NVY I;  4EWC A;  3NH4 A;  2JIP A;  2Y0S A;  1RLY A;  3S2H I;  3VB9 A;  3GTP I;  1YJW 1;  2VF1 A;  4NBH A;  1ZB8 A;  2O53 A;  1WW9 A;  3CCL Z;  1QVG Y;  3S2D I;  3JAM f;  1N8R 2;  2JA5 I;  1KQS Y;  3CCJ 1;  1YJ9 1;  3CD6 1;  3CCS 1;  3F3F C;  3NDI A;  4RVH A;  4E30 A;  1VQP 1;  1YI2 1;  3S16 I;  1VQ5 Z;  1Q7Y 1;  4MD8 A;  5C44 I;  4E2Y A;  2PM9 A;  1Y8C A;  2E2I I;  3CXC Z;  2V8I A;  1ML8 A;  1VQ4 1;  3CMA Z;  2JIR A;  3OW2 Z;  4NBD A;  2QKD A;  3M3Y I;  2OOX B;  4A3M I;  2WAQ A;  2VUG A;  1I50 I;  4NBC A;  2R92 I;  3I56 Z;  2JS4 A;  3EED A;  4QTU A;  4E2Z A;  3CCU Z;  5A2Q b;  2QR1 B;  3CCQ Z;  3M4O I;  3CC7 1;  4RV9 A;  3CCR Z;  1K8A 2;  3IR7 A;  1QVF Y; 
#chains in the Genus database with same CATH homology
 5CM2 M;  3J81 f;  1Q82 2;  5IP7 I;  3CME 1;  1K83 I;  1VQ7 Z;  2DE6 A;  4A3J I;  2RPR A;  1TWA I;  4MD9 A;  2NVQ I;  5C4X I;  1RNI A;  2DE5 A;  3H3V J;  2OZK A;  2RHB A;  3FQQ A;  2OTJ 1;  4AYB A;  1VQO Z;  4E32 A;  3CCE Z;  1K8A 1;  2RBL A;  1VQL 1;  1S72 1;  1N2F A;  3GTK I;  4RVG A;  1X3W A;  5FLX b;  1PFT A;  4MH4 A;  1NJI 2;  2R93 I;  1W2B Z;  3KIF A;  1Q86 1;  4A93 I;  2KI7 B;  3S14 I;  3MZK B;  1X3Z A;  1ZH1 A;  1YJN Z;  3NDJ A;  1VQN Z;  1USP A;  4BXX I;  3CCL 1;  3S1M I;  5D1O A;  1USP B;  1JWH C;  5A2Q f;  3I55 Z;  1K73 2;  2QRD B;  3NFZ A;  3CCM Z;  1VQ9 Z;  1Z03 A;  3KIH A;  1M1K 1;  3BG1 B;  3GTG I;  2JUB A;  3CC2 Z;  1VQ5 1;  2Q4Z A;  3PO3 S;  3U50 C;  4E33 A;  1L1O C;  4RS4 A;  3Q87 A;  3PO2 I;  4Y52 I;  2E2J I;  3CMA 1;  4NBF A;  5D1P A;  3TDH B;  2K5R A;  1S7M A;  3I56 1;  4MON A;  4E31 A;  3VMH A;  3G6E Z;  3CCU 1;  3J80 b;  3CCQ 1;  1VQ8 Z;  4BBS I;  3CCR 1;  1JJ2 Y;  2QLV B;  3MON A;  4DQY B;  4NBB A;  2EGT A;  2IZ4 A;  4MRI A;  3D9X A;  5IP9 I;  3I4M I;  1VQ7 1;  3G4S 1;  4A3D I;  5FLX f;  1Y1V S;  3CPW Z;  4BY1 I;  4RVF A;  4A3F I;  2PMZ A;  1N8R 1;  3PO3 I;  2P28 A;  2E9H A;  2YU9 I;  1VQO 1;  1YUK A;  3CCE 1;  5C4J I;  5C3E I;  2R7Z I;  1I6H I;  3RZO I;  3HOU I;  1KD1 2;  2RIQ A;  3G4S Z;  1QVG Z;  3MZL B;  1KQS Z;  1YIJ Z;  4TNU A;  1DL6 A;  2QEX Z;  1YJN 1;  1VQK Z;  1YIT Z;  2AKL A;  1VQN 1;  1SFO I;  2JMO A;  2GU2 A;  3TE5 B;  3HOW I;  1TWG I;  4QTT A;  2JR6 A;  3K7A I;  4A3G I;  3I55 1;  1Y1V I;  3J80 f;  3CCM 1;  1Q82 1;  3FKI I;  1VQ9 1;  2GTH A;  2H85 A;  3CC2 1;  1R9T I;  2JNY A;  4NBA A;  1KC8 2;  1QYP A;  2K3R A;  1YUA A;  2M6N A;  4NB9 A;  2W04 A;  1X0T A;  1QVF Z;  1Q81 2;  2VUM I;  4A3C I;  1WII A;  2JA6 I;  3G6E 1;  4HGY A;  3IF8 A;  1VQ8 1;  1TWH I;  5IT9 b;  5D1O B;  2W03 A;  3G71 Z;  3CC4 Z;  2LFU A;  3CXC Y;  1K9M 2;  3S17 I;  1NJI 1;  1VLA A;  4NBG A;  2QA4 Z;  3OW2 Y;  2O4H A;  3GTO I;  5FLM I;  3I07 A;  3IX0 A;  3GTL I;  2OTL Z;  5T64 A;  2ZAE B;  1Q7Y 2;  1WCM I;  4XX2 A;  1ZB9 A;  4RVD A;  1VQM Z;  4NOZ A;  3S1N I;  3GTM S;  1YHQ Z;  3NH8 A;  3CCV Z;  1TWC I;  1K73 1;  3IFU A;  1M90 2;  2LIY A;  3D6W A;  3P5J B;  2HF1 A;  1QF8 A;  3VTN A;  3EER A;  1K9M 1;  4MXU A;  3S15 I;  1RO2 A;  5T6B A;  3T4N B;  3GCF A;  2I3C A;  1YIJ 1;  1VQ6 Z;  4A3K I;  3S1Q I;  4X6A I;  2QEX 1;  1VQK 1;  1YIT 1;  3S1R I;  3HOY I;  4Y7N I;  5T67 A;  4NB8 A;  3GKQ A;  1YJW Z;  1M90 1;  2BJO A;  3VMI A;  4NFR A;  4DK1 A;  3BG0 B;  3HKZ A;  5IT9 f;  2OOY B;  2P3Y A;  2V8J A;  3GTM I;  3CCJ Z;  3NH5 A;  1W2B Y;  3HOV I;  1YJ9 Z;  2V8K A;  3CD6 Z;  4MD7 A;  2NVX I;  2B63 I;  3CCS Z;  1VQP Z;  1YI2 Z;  2G2K A;  1JJ2 Z;  3GTJ I;  1Z01 A;  4CL1 A;  3F3P C;  3H0G I;  2NVT I;  3ESW A;  3VMG A;  4BBR I;  1VQ4 Z;  3HOZ I;  4NH1 C;  1KRL A;  4S1T A;  4E2X A;  1NUI A;  3LUS A;  1Q86 2;  1KD1 1;  3JAM b;  5AN9 F;  1Z02 A;  3G71 1;  2DE7 A;  4DGL A;  3CC4 1;  2QRE B;  1RO0 A;  5LL6 f;  4HGZ A;  3CC7 Z;  2WB1 A;  4NBE A;  2QA4 1;  1RO4 A;  4A3B I;  2JA7 I;  2F4M A;  2OTL 1;  1M1K 2;  2YAD A;  1RQF A;  2GTI A;  1LQL A;  3CME Z;  2Q51 A;  1VQM 1;  1I3Q I;  1YHQ 1;  1TFI A;  3CCV 1;  2J6A A;  1Y1W I;  2R6M A;  2E2H I;  3FQM A;  2M48 A;  1NP6 A;  4HH4 A;  1P9N A;  4A3E I;  3CQZ I;  4E2W A;  4A3I I;  2OTJ Z;  3QWU A;  3HOX I;  1KC8 1;  2QRC B;  2F4O A;  3CPW Y;  3GTQ I;  3J81 b;  4BY7 I;  1VQL Z;  2IZ3 A;  2HU9 A;  1S72 Z;  3I4N I;  3RZD I;  1Q81 1;  1VQ6 1;  2JA8 I;  2KPI A;  2PK7 A;  3J7A 4;  1TWF I;  2RT9 A;  4A3L I;  2NVY I;  4EWC A;  3NH4 A;  2Y0S A;  1RLY A;  3S2H I;  3VB9 A;  3GTP I;  1YJW 1;  2VF1 A;  4NBH A;  1ZB8 A;  2O53 A;  1WW9 A;  3CCL Z;  1QVG Y;  3S2D I;  3JAM f;  1N8R 2;  2JA5 I;  1KQS Y;  3CCJ 1;  1YJ9 1;  3CD6 1;  3CCS 1;  3F3F C;  3NDI A;  4RVH A;  4E30 A;  1VQP 1;  1YI2 1;  3S16 I;  1VQ5 Z;  1Q7Y 1;  4MD8 A;  5C44 I;  4E2Y A;  2PM9 A;  2E2I I;  3CXC Z;  2V8I A;  1ML8 A;  1VQ4 1;  3CMA Z;  3OW2 Z;  4NBD A;  2QKD A;  3M3Y I;  2OOX B;  4A3M I;  2WAQ A;  2VUG A;  1I50 I;  4NBC A;  2R92 I;  3I56 Z;  2JS4 A;  3EED A;  4QTU A;  4E2Z A;  3CCU Z;  5A2Q b;  2QR1 B;  3CCQ Z;  3M4O I;  3CC7 1;  4RV9 A;  3CCR Z;  1K8A 2;  1QVF Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...