2JR6A

Solution structure of upf0434 protein nma0874. northeast structural genomics target mr32
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEEELKALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0434 protein NMA0874
publication title Solution structure of UPF0434 protein NMA0874.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jr6A01
2PK7A 3RZDI 4X6AI 1ZB9A 1ML8A 4Y7NI 4A3JI 4NBCA 2E2II 3GTGI 3S1RI 2KPIA 3HOXI 5C4JI 4A3FI 3HOUI 2JNYA 1Y1WI 3HOWI 3VMIA 4NB9A 4A3KI 2AKLA 2JA6I 3S16I 4NBFA 4NOZA 3EERA 2DE7A 1RLYA 4NBDA 4XX2A 2R92I 3RZOI 1TFIA 3S2HI 4A3CI 1VLAA 2NVTI 4BBSI 2R93I 1I6HI 1YUAA 4A3II 5C44I 2NVXI 2F4MA 3CQZI 1USPA 4NBBA 3ESWA 1Y1VS 5C3EI 3M3YI 3S1MI 3Q87A 3S1NI 4A3MI 3GTQI 4BXXI 2JA5I 3M4OI 1TWHI 1TWAI 3I07A 2K5RA 3HOVI 1TWFI 2J6AA 1K83I 1USPB 1QYPA 4A3GI 2YU9I 1LQLA 5IP9I 4BBRI 2P3YA 3LUSA 1N2FA 3GTPI 3GTJI 3S2DI 2BJOA 2HF1A 4NBAA 3GTMI 3PO3I 1X3WA 1ZB8A 3VB9A 3GCFA 3D6WA 2DE6A 3HOYI 1RO4A 3H3VJ 4A3BI 2JA7I 4NB8A 4A93I 2E2JI 4QTUA 2DE5A 3S15I 4BY7I 1WCMI 2NVYI 3GKQA 1R9TI 3VMHA 1X3ZA 2JA8I 1L1OC 2JR6A 1I3QI 3H0GI 5IP7I 4Y52I 3GTLI 4A3DI 1PFTA 2F4OA 4NBHA 2B63I 4A3LI 4NBEA 2E2HI 2R7ZI 2VUMI 2RBLA 3VMGA 2JS4A 5C4XI 3K7AI 3I4NI 4A3EI 3HOZI 1I50I 3FKII 4QTTA 3GTMS 1TWCI 3PO2I 3GTOI 3PO3S 1SFOI 5CM2M 1TWGI 1WW9A 2NVQI 3S1QI 4BY1I 1DL6A 3U50C 1NUIA 3GTKI 4NBGA 4MH4A 5FLMI 3I4MI 3S17I 3S14I 1Y1VI
chains in the Genus database with same CATH superfamily
1YJN1 1NJI1 2WAQA 1ZB9A 1ML8A 1W2BY 3EEDA 4NBCA 4A3FI 1VQN1 5T6BA 4EWCA 2JUBA 3QWUA 3CC41 2G2KA 2AKLA 3OW2Y 1WZNA 1Q822 2JA6I 4NOZA 2DE7A 2Y0SA 1VQKZ 2OTJ1 1YITZ 4A3CI 3IR7A 1N8R2 4BBSI 4A3II 5C44I 2NVXI 2F4MA 4MONA 1YJNZ 1Y1VS 1VQM1 4HH4A 1VQNZ 1TWHI 3HOVI 3FQMA 3CC4Z 2RT9A 2J6AA 2YU9I 2OOXB 5FLXf 3CCQ1 2Q4ZA 1N2FA 4E33A 2OTJZ 4NBAA 3MONA 1Q16A 3NDIA 2E7ZA 2DE6A 2E9HA 3OW2Z 3H3VJ 2LEXA 1VQMZ 4NB8A 2E2JI 1M901 1VQ91 1Q862 2DE5A 3TE5B 1WCMI 3F3FC 4MD9A 1X3ZA 2JR6A 1I3QI 5IP7I 1KC82 4NFRA 3CD61 4NBHA 4RV9A 4A3LI 2R7ZI 4E2XA 3CMA1 3CCQZ 2O4HA 5T64A 3KIFA 4AYBA 4HGZA 1YI21 3CC71 3GTMS 3CCL1 1TWGI 2NVQI 2VPXA 2HU9A 3I4MI 2VPZA 1YIJ1 2V3VA 1VQ9Z 1YUKA 2PK7A 3RZDI 3VTNA 1X0TA 3MZLB 5A2Qf 2QR1B 4DGLA 2YADA 4A3JI 2E2II 3FQQA 5IT9b 2KPIA 3HOXI 3CD6Z 3HOUI 3CMAZ 3G711 1K731 1YJW1 2GTIA 2NAPA 3D2LA 4NBFA 3CCE1 1YI2Z 5FLXb 3I551 3RZOI 2R92I 3CC7Z 2ZAEB 3CCLZ 2WB1A 1Q811 3CC21 3S2HI 2NVTI 1RO0A 1YIJZ 2JIQA 1VQ71 1I6HI 2OZKA 3F3PC 5D1PA 3I56Z 1NP6A 1USPA 3M3YI 1VQP1 3IX0A 3GTQI 3JAMf 3M4OI 1YHQ1 3I07A 2K5RA 4RVDA 3CCU1 3G71Z 3BG1B 1YJWZ 1K83I 3HKZA 1USPB 1FDOA 1Z01A 3CCEZ 3I55Z 3CXCZ 1Q821 3GTPI 1K9M2 3NDJA 3S2DI 3CC2Z 2HF1A 4RVHA 1X3WA 1ZB8A 1VQ7Z 2VUGA 3VB9A 3D6WA 3KIHA 1JWHC 4A3BI 2M6NA 1VQPZ 4QTUA 3J80f 3S15I 2NVYI 3GKQA 3CPWY 3VMHA 1YHQZ 3CCUZ 2V45A 1PFTA 2F4OA 2B63I 3J81f 4NBEA 5D1OA 2OTL1 5C4XI 1YJ91 3I4NI 4A3EI 1M1K2 4RVFA 1RQFA 1TWCI 4E32A 4MD7A 3GTOI 1VQO1 4E31A 4BY1I 1DL6A 4RS4A 1NUIA 4NBGA 3S14I 4MRIA 5D1OB 2JIOA 2EGTA 1ZH1A 2JMOA 2JIRA 1Q861 4Y7NI 3GTGI 2V8IA 3S1RI 1VQ41 4E30A 2V8KA 5C4JI 3G4S1 1Y1WI 1KC81 3HOWI 2OTLZ 3J7A4 4NB9A 4A3KI 2LIYA 1YJ9Z 3CPWZ 4S1TA 4NBDA 1VQOZ 2GU2A 2KI7B 1RO2A 3IFUA 2GTHA 3CME1 2R93I 1Z03A 2LFUA 2QEX1 1K8A2 1JJ2Y 3P5JB 3CXCY 4NBBA 3ESWA 5C3EI 3NFZA 2IV2X 3Q87A 3S1NI 1QVGY 3T4NB 3J80b 2QA41 5AN9F 1VQ4Z 1KD11 3G4SZ 1S721 1TWFI 2QKDA 1QYPA 2RHBA 4A3GI 1QVFY 1LQLA 1Q7Y2 2IZ3A 4BBRI 2P3YA 3LUSA 1Y8CA 2RIQA 3GTJI 2BJOA 3PO3I 3BG0B 3CMEZ 1VQ61 3GCFA 2QEXZ 4NH1C 4TNUA 1NJI2 2JA7I 4A93I 2H85A 3CCJ1 4BY7I 2QA4Z 3NH8A 2IZ4A 3TDHB 2JA8I 1L1OC 2R6MA 2W04A 1S72Z 3H0GI 4Y52I 1JJ2Z 4A3DI 1QXFA 1FDIA 4DQYB 2OOYB 5LL6f 2V8JA 3D9XA 3NH5A 2VUMI 3CCM1 1QVGZ 5T67A 4MD8A 1I50I 1WIIA 1N8R1 1VQ6Z 3PO2I 1K9M1 1SFOI 1SIWA 5CM2M 2O53A 1QVFZ 3GTKI 3S17I 2QRCB 3CCJZ 5A2Qb 2PM9A 1Y1VI 4RVGA 4X6AI 1RNIA 2K3RA 1Z02A 2QRDB 2VF1A 4E2ZA 3CCS1 2JNYA 5IT9f 3MZKB 3VMIA 3CCV1 3CCMZ 1KQSY 3S16I 3EERA 1S7MA 2JIMA 1RLYA 1VQ81 4XX2A 2AYDA 1M1K1 1W2BZ 1TFIA 1VLAA 4DK1A 1YUAA 4E2WA 3CCR1 1M902 3CQZI 3S1MI 3JAMb 4A3MI 1VQ51 2QLVB 3CCSZ 4BXXI 2JA5I 2RPRA 1TWAI 1AA6A 3CCVZ 2Q51A 5IP9I 1VQ8Z 3G6E1 3GTMI 4CL1A 3CCRZ 2P28A 1KQSZ 3HOYI 1WJ2A 1RO4A 1P9NA 1K8A1 2M48A 2JIPA 1VQL1 1VQ5Z 2PMZA 2I3CA 2VPYA 2W03A 1R9TI 4MXUA 3I561 3J81b 3GTLI 1K732 4HGYA 1KD12 1KRLA 2E2HI 1QF8A 2RBLA 3VMGA 2JS4A 3G6EZ 2VPWA 3K7AI 1Q7Y1 1Q812 3HOZI 2QREB 4E2YA 3FKII 4QTTA 3PO3S 1VQK1 1YIT1 3NH4A 1WW9A 3S1QI 3U50C 5FLMI 4MH4A 3IF8A 1VQLZ
chains in the Genus database with same CATH topology
1YJN1 1NJI1 2WAQA 1ZB9A 1ML8A 1W2BY 3EEDA 4NBCA 4A3FI 1VQN1 5T6BA 4EWCA 2JUBA 3QWUA 3CC41 2G2KA 2AKLA 3OW2Y 1Q822 2JA6I 4NOZA 2DE7A 2Y0SA 1VQKZ 2OTJ1 1YITZ 4A3CI 1N8R2 4BBSI 4A3II 5C44I 2NVXI 2F4MA 4MONA 1YJNZ 1Y1VS 1VQM1 4HH4A 1VQNZ 1TWHI 3HOVI 3FQMA 3CC4Z 2RT9A 2J6AA 2YU9I 2OOXB 5FLXf 3CCQ1 2Q4ZA 1N2FA 4E33A 2OTJZ 4NBAA 3MONA 3NDIA 2DE6A 2E9HA 3OW2Z 3H3VJ 1VQMZ 4NB8A 2E2JI 1M901 1VQ91 1Q862 2DE5A 3TE5B 1WCMI 3F3FC 4MD9A 1X3ZA 2JR6A 1I3QI 5IP7I 1KC82 4NFRA 3CD61 4NBHA 4RV9A 4A3LI 2R7ZI 4E2XA 3CMA1 3CCQZ 2O4HA 5T64A 3KIFA 4AYBA 4HGZA 1YI21 3CC71 3GTMS 3CCL1 1TWGI 2NVQI 2HU9A 3I4MI 1YIJ1 1VQ9Z 1YUKA 2PK7A 3RZDI 3VTNA 1X0TA 3MZLB 5A2Qf 2QR1B 4DGLA 2YADA 4A3JI 2E2II 3FQQA 5IT9b 2KPIA 3HOXI 3CD6Z 3HOUI 3CMAZ 3G711 1K731 1YJW1 2GTIA 1YI2Z 4NBFA 3CCE1 5FLXb 3I551 3RZOI 2R92I 3CC7Z 2ZAEB 3CCLZ 2WB1A 1Q811 3CC21 3S2HI 2NVTI 1RO0A 1YIJZ 1VQ71 1I6HI 2OZKA 3F3PC 5D1PA 3I56Z 1NP6A 1USPA 3M3YI 1VQP1 3IX0A 3GTQI 3JAMf 3M4OI 1YHQ1 3I07A 2K5RA 4RVDA 3CCU1 3G71Z 3BG1B 1YJWZ 1K83I 3HKZA 1USPB 1Z01A 3CCEZ 3I55Z 3CXCZ 1Q821 3GTPI 1K9M2 3NDJA 3S2DI 3CC2Z 2HF1A 4RVHA 1X3WA 1ZB8A 1VQ7Z 2VUGA 3VB9A 3D6WA 3KIHA 1JWHC 4A3BI 2M6NA 1VQPZ 4QTUA 3J80f 3S15I 2NVYI 3GKQA 3CPWY 3VMHA 1YHQZ 3CCUZ 1PFTA 2F4OA 2B63I 3J81f 4NBEA 5D1OA 2OTL1 5C4XI 1YJ91 3I4NI 4A3EI 1M1K2 4RVFA 1RQFA 1TWCI 4E32A 4MD7A 3GTOI 1VQO1 4E31A 4BY1I 1DL6A 4RS4A 1NUIA 4NBGA 3S14I 4MRIA 5D1OB 2EGTA 1ZH1A 2JMOA 1Q861 4Y7NI 3GTGI 2V8IA 3S1RI 1VQ41 4E30A 2V8KA 5C4JI 3G4S1 1Y1WI 1KC81 3HOWI 2OTLZ 3J7A4 4NB9A 4A3KI 2LIYA 1YJ9Z 3CPWZ 4S1TA 4NBDA 1VQOZ 2GU2A 2KI7B 1RO2A 3IFUA 2GTHA 3CME1 2R93I 1Z03A 2LFUA 2QEX1 1K8A2 1JJ2Y 3P5JB 3CXCY 4NBBA 3ESWA 5C3EI 3NFZA 3Q87A 3S1NI 1QVGY 3T4NB 3J80b 2QA41 5AN9F 1VQ4Z 1KD11 3G4SZ 1S721 1TWFI 2QKDA 1QYPA 2RHBA 4A3GI 1QVFY 1LQLA 1Q7Y2 2IZ3A 4BBRI 2P3YA 3LUSA 2RIQA 3GTJI 2BJOA 3PO3I 3BG0B 3CMEZ 1VQ61 3GCFA 2QEXZ 4NH1C 4TNUA 1NJI2 2JA7I 4A93I 2H85A 3CCJ1 4BY7I 3NH8A 2QA4Z 2IZ4A 3TDHB 2JA8I 1L1OC 2R6MA 2W04A 1S72Z 3H0GI 4Y52I 1JJ2Z 4A3DI 4DQYB 2OOYB 5LL6f 2V8JA 3D9XA 3NH5A 2VUMI 3CCM1 1QVGZ 5T67A 4MD8A 1I50I 1WIIA 1N8R1 1VQ6Z 3PO2I 1K9M1 1SFOI 5CM2M 2O53A 1QVFZ 3GTKI 3S17I 2QRCB 3CCJZ 5A2Qb 2PM9A 1Y1VI 4RVGA 4X6AI 1RNIA 2K3RA 1Z02A 2QRDB 2VF1A 4E2ZA 3CCS1 2JNYA 5IT9f 3MZKB 3VMIA 3CCV1 3CCMZ 1KQSY 3S16I 3EERA 1S7MA 1RLYA 1VQ81 4XX2A 1M1K1 1W2BZ 1TFIA 1VLAA 4DK1A 1YUAA 4E2WA 3CCR1 1M902 3CQZI 3S1MI 3JAMb 4A3MI 1VQ51 2QLVB 3CCSZ 4BXXI 2JA5I 2RPRA 1TWAI 3CCVZ 2Q51A 5IP9I 1VQ8Z 3G6E1 3GTMI 4CL1A 3CCRZ 2P28A 1KQSZ 3HOYI 1RO4A 1P9NA 1K8A1 2M48A 1VQL1 1VQ5Z 2PMZA 2I3CA 2W03A 1R9TI 4MXUA 3I561 3J81b 3GTLI 1K732 4HGYA 1KD12 1KRLA 2E2HI 1QF8A 2RBLA 3VMGA 2JS4A 3G6EZ 3K7AI 1Q7Y1 1Q812 3HOZI 2QREB 4E2YA 3FKII 4QTTA 3PO3S 1VQK1 1YIT1 3NH4A 1WW9A 3S1QI 3U50C 5FLMI 4MH4A 3IF8A 1VQLZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PK7 A;  3RZD I;  4X6A I;  1ZB9 A;  1ML8 A;  4Y7N I;  4A3J I;  4NBC A;  2E2I I;  3GTG I;  3S1R I;  2KPI A;  3HOX I;  5C4J I;  4A3F I;  3HOU I;  2JNY A;  1Y1W I;  3HOW I;  3VMI A;  4NB9 A;  4A3K I;  2AKL A;  2JA6 I;  3S16 I;  4NBF A;  4NOZ A;  3EER A;  2DE7 A;  1RLY A;  4NBD A;  4XX2 A;  2R92 I;  3RZO I;  1TFI A;  3S2H I;  4A3C I;  1VLA A;  2NVT I;  4BBS I;  2R93 I;  1I6H I;  1YUA A;  4A3I I;  5C44 I;  2NVX I;  2F4M A;  3CQZ I;  1USP A;  4NBB A;  3ESW A;  1Y1V S;  5C3E I;  3M3Y I;  3S1M I;  3Q87 A;  3S1N I;  4A3M I;  3GTQ I;  4BXX I;  2JA5 I;  3M4O I;  1TWH I;  1TWA I;  3I07 A;  2K5R A;  3HOV I;  1TWF I;  2J6A A;  1K83 I;  1USP B;  1QYP A;  4A3G I;  2YU9 I;  1LQL A;  5IP9 I;  4BBR I;  2P3Y A;  3LUS A;  1N2F A;  3GTP I;  3GTJ I;  3S2D I;  2BJO A;  2HF1 A;  4NBA A;  3GTM I;  3PO3 I;  1X3W A;  1ZB8 A;  3VB9 A;  3GCF A;  3D6W A;  2DE6 A;  3HOY I;  1RO4 A;  3H3V J;  4A3B I;  2JA7 I;  4NB8 A;  4A93 I;  2E2J I;  4QTU A;  2DE5 A;  3S15 I;  4BY7 I;  1WCM I;  2NVY I;  3GKQ A;  1R9T I;  3VMH A;  1X3Z A;  2JA8 I;  1L1O C;  2JR6 A;  1I3Q I;  3H0G I;  5IP7 I;  4Y52 I;  3GTL I;  4A3D I;  1PFT A;  2F4O A;  4NBH A;  2B63 I;  4A3L I;  4NBE A;  2E2H I;  2R7Z I;  2VUM I;  2RBL A;  3VMG A;  2JS4 A;  5C4X I;  3K7A I;  3I4N I;  4A3E I;  3HOZ I;  1I50 I;  3FKI I;  4QTT A;  3GTM S;  1TWC I;  3PO2 I;  3GTO I;  3PO3 S;  1SFO I;  5CM2 M;  1TWG I;  1WW9 A;  2NVQ I;  3S1Q I;  4BY1 I;  1DL6 A;  3U50 C;  1NUI A;  3GTK I;  4NBG A;  4MH4 A;  5FLM I;  3I4M I;  3S17 I;  3S14 I;  1Y1V I; 
#chains in the Genus database with same CATH topology
 1YJN 1;  1NJI 1;  2WAQ A;  1ZB9 A;  1ML8 A;  1W2B Y;  3EED A;  4NBC A;  4A3F I;  1VQN 1;  5T6B A;  4EWC A;  2JUB A;  3QWU A;  3CC4 1;  2G2K A;  2AKL A;  3OW2 Y;  1WZN A;  1Q82 2;  2JA6 I;  4NOZ A;  2DE7 A;  2Y0S A;  1VQK Z;  2OTJ 1;  1YIT Z;  4A3C I;  3IR7 A;  1N8R 2;  4BBS I;  4A3I I;  5C44 I;  2NVX I;  2F4M A;  4MON A;  1YJN Z;  1Y1V S;  1VQM 1;  4HH4 A;  1VQN Z;  1TWH I;  3HOV I;  3FQM A;  3CC4 Z;  2RT9 A;  2J6A A;  2YU9 I;  2OOX B;  5FLX f;  3CCQ 1;  2Q4Z A;  1N2F A;  4E33 A;  2OTJ Z;  4NBA A;  3MON A;  1Q16 A;  3NDI A;  2E7Z A;  2DE6 A;  2E9H A;  3OW2 Z;  3H3V J;  2LEX A;  1VQM Z;  4NB8 A;  2E2J I;  1M90 1;  1VQ9 1;  1Q86 2;  2DE5 A;  3TE5 B;  1WCM I;  3F3F C;  4MD9 A;  1X3Z A;  2JR6 A;  1I3Q I;  5IP7 I;  1KC8 2;  4NFR A;  3CD6 1;  4NBH A;  4RV9 A;  4A3L I;  2R7Z I;  4E2X A;  3CMA 1;  3CCQ Z;  2O4H A;  5T64 A;  3KIF A;  4AYB A;  4HGZ A;  1YI2 1;  3CC7 1;  3GTM S;  3CCL 1;  1TWG I;  2NVQ I;  2VPX A;  2HU9 A;  3I4M I;  2VPZ A;  1YIJ 1;  2V3V A;  1VQ9 Z;  1YUK A;  2PK7 A;  3RZD I;  3VTN A;  1X0T A;  3MZL B;  5A2Q f;  2QR1 B;  4DGL A;  2YAD A;  4A3J I;  2E2I I;  3FQQ A;  5IT9 b;  2KPI A;  3HOX I;  3CD6 Z;  3HOU I;  3CMA Z;  3G71 1;  1K73 1;  1YJW 1;  2GTI A;  2NAP A;  3D2L A;  4NBF A;  3CCE 1;  1YI2 Z;  5FLX b;  3I55 1;  3RZO I;  2R92 I;  3CC7 Z;  2ZAE B;  3CCL Z;  2WB1 A;  1Q81 1;  3CC2 1;  3S2H I;  2NVT I;  1RO0 A;  1YIJ Z;  2JIQ A;  1VQ7 1;  1I6H I;  2OZK A;  3F3P C;  5D1P A;  3I56 Z;  1NP6 A;  1USP A;  3M3Y I;  1VQP 1;  3IX0 A;  3GTQ I;  3JAM f;  3M4O I;  1YHQ 1;  3I07 A;  2K5R A;  4RVD A;  3CCU 1;  3G71 Z;  3BG1 B;  1YJW Z;  1K83 I;  3HKZ A;  1USP B;  1FDO A;  1Z01 A;  3CCE Z;  3I55 Z;  3CXC Z;  1Q82 1;  3GTP I;  1K9M 2;  3NDJ A;  3S2D I;  3CC2 Z;  2HF1 A;  4RVH A;  1X3W A;  1ZB8 A;  1VQ7 Z;  2VUG A;  3VB9 A;  3D6W A;  3KIH A;  1JWH C;  4A3B I;  2M6N A;  1VQP Z;  4QTU A;  3J80 f;  3S15 I;  2NVY I;  3GKQ A;  3CPW Y;  3VMH A;  1YHQ Z;  3CCU Z;  2V45 A;  1PFT A;  2F4O A;  2B63 I;  3J81 f;  4NBE A;  5D1O A;  2OTL 1;  5C4X I;  1YJ9 1;  3I4N I;  4A3E I;  1M1K 2;  4RVF A;  1RQF A;  1TWC I;  4E32 A;  4MD7 A;  3GTO I;  1VQO 1;  4E31 A;  4BY1 I;  1DL6 A;  4RS4 A;  1NUI A;  4NBG A;  3S14 I;  4MRI A;  5D1O B;  2JIO A;  2EGT A;  1ZH1 A;  2JMO A;  2JIR A;  1Q86 1;  4Y7N I;  3GTG I;  2V8I A;  3S1R I;  1VQ4 1;  4E30 A;  2V8K A;  5C4J I;  3G4S 1;  1Y1W I;  1KC8 1;  3HOW I;  2OTL Z;  3J7A 4;  4NB9 A;  4A3K I;  2LIY A;  1YJ9 Z;  3CPW Z;  4S1T A;  4NBD A;  1VQO Z;  2GU2 A;  2KI7 B;  1RO2 A;  3IFU A;  2GTH A;  3CME 1;  2R93 I;  1Z03 A;  2LFU A;  2QEX 1;  1K8A 2;  1JJ2 Y;  3P5J B;  3CXC Y;  4NBB A;  3ESW A;  5C3E I;  3NFZ A;  2IV2 X;  3Q87 A;  3S1N I;  1QVG Y;  3T4N B;  3J80 b;  2QA4 1;  5AN9 F;  1VQ4 Z;  1KD1 1;  3G4S Z;  1S72 1;  1TWF I;  2QKD A;  1QYP A;  2RHB A;  4A3G I;  1QVF Y;  1LQL A;  1Q7Y 2;  2IZ3 A;  4BBR I;  2P3Y A;  3LUS A;  1Y8C A;  2RIQ A;  3GTJ I;  2BJO A;  3PO3 I;  3BG0 B;  3CME Z;  1VQ6 1;  3GCF A;  2QEX Z;  4NH1 C;  4TNU A;  1NJI 2;  2JA7 I;  4A93 I;  2H85 A;  3CCJ 1;  4BY7 I;  2QA4 Z;  3NH8 A;  2IZ4 A;  3TDH B;  2JA8 I;  1L1O C;  2R6M A;  2W04 A;  1S72 Z;  3H0G I;  4Y52 I;  1JJ2 Z;  4A3D I;  1QXF A;  1FDI A;  4DQY B;  2OOY B;  5LL6 f;  2V8J A;  3D9X A;  3NH5 A;  2VUM I;  3CCM 1;  1QVG Z;  5T67 A;  4MD8 A;  1I50 I;  1WII A;  1N8R 1;  1VQ6 Z;  3PO2 I;  1K9M 1;  1SFO I;  1SIW A;  5CM2 M;  2O53 A;  1QVF Z;  3GTK I;  3S17 I;  2QRC B;  3CCJ Z;  5A2Q b;  2PM9 A;  1Y1V I;  4RVG A;  4X6A I;  1RNI A;  2K3R A;  1Z02 A;  2QRD B;  2VF1 A;  4E2Z A;  3CCS 1;  2JNY A;  5IT9 f;  3MZK B;  3VMI A;  3CCV 1;  3CCM Z;  1KQS Y;  3S16 I;  3EER A;  1S7M A;  2JIM A;  1RLY A;  1VQ8 1;  4XX2 A;  2AYD A;  1M1K 1;  1W2B Z;  1TFI A;  1VLA A;  4DK1 A;  1YUA A;  4E2W A;  3CCR 1;  1M90 2;  3CQZ I;  3S1M I;  3JAM b;  4A3M I;  1VQ5 1;  2QLV B;  3CCS Z;  4BXX I;  2JA5 I;  2RPR A;  1TWA I;  1AA6 A;  3CCV Z;  2Q51 A;  5IP9 I;  1VQ8 Z;  3G6E 1;  3GTM I;  4CL1 A;  3CCR Z;  2P28 A;  1KQS Z;  3HOY I;  1WJ2 A;  1RO4 A;  1P9N A;  1K8A 1;  2M48 A;  2JIP A;  1VQL 1;  1VQ5 Z;  2PMZ A;  2I3C A;  2VPY A;  2W03 A;  1R9T I;  4MXU A;  3I56 1;  3J81 b;  3GTL I;  1K73 2;  4HGY A;  1KD1 2;  1KRL A;  2E2H I;  1QF8 A;  2RBL A;  3VMG A;  2JS4 A;  3G6E Z;  2VPW A;  3K7A I;  1Q7Y 1;  1Q81 2;  3HOZ I;  2QRE B;  4E2Y A;  3FKI I;  4QTT A;  3PO3 S;  1VQK 1;  1YIT 1;  3NH4 A;  1WW9 A;  3S1Q I;  3U50 C;  5FLM I;  4MH4 A;  3IF8 A;  1VQL Z; 
#chains in the Genus database with same CATH homology
 1YJN 1;  1NJI 1;  2WAQ A;  1ZB9 A;  1ML8 A;  1W2B Y;  3EED A;  4NBC A;  4A3F I;  1VQN 1;  5T6B A;  4EWC A;  2JUB A;  3QWU A;  3CC4 1;  2G2K A;  2AKL A;  3OW2 Y;  1Q82 2;  2JA6 I;  4NOZ A;  2DE7 A;  2Y0S A;  1VQK Z;  2OTJ 1;  1YIT Z;  4A3C I;  1N8R 2;  4BBS I;  4A3I I;  5C44 I;  2NVX I;  2F4M A;  4MON A;  1YJN Z;  1Y1V S;  1VQM 1;  4HH4 A;  1VQN Z;  1TWH I;  3HOV I;  3FQM A;  3CC4 Z;  2RT9 A;  2J6A A;  2YU9 I;  2OOX B;  5FLX f;  3CCQ 1;  2Q4Z A;  1N2F A;  4E33 A;  2OTJ Z;  4NBA A;  3MON A;  3NDI A;  2DE6 A;  2E9H A;  3OW2 Z;  3H3V J;  1VQM Z;  4NB8 A;  2E2J I;  1M90 1;  1VQ9 1;  1Q86 2;  2DE5 A;  3TE5 B;  1WCM I;  3F3F C;  4MD9 A;  1X3Z A;  2JR6 A;  1I3Q I;  5IP7 I;  1KC8 2;  4NFR A;  3CD6 1;  4NBH A;  4RV9 A;  4A3L I;  2R7Z I;  4E2X A;  3CMA 1;  3CCQ Z;  2O4H A;  5T64 A;  3KIF A;  4AYB A;  4HGZ A;  1YI2 1;  3CC7 1;  3GTM S;  3CCL 1;  1TWG I;  2NVQ I;  2HU9 A;  3I4M I;  1YIJ 1;  1VQ9 Z;  1YUK A;  2PK7 A;  3RZD I;  3VTN A;  1X0T A;  3MZL B;  5A2Q f;  2QR1 B;  4DGL A;  2YAD A;  4A3J I;  2E2I I;  3FQQ A;  5IT9 b;  2KPI A;  3HOX I;  3CD6 Z;  3HOU I;  3CMA Z;  3G71 1;  1K73 1;  1YJW 1;  2GTI A;  1YI2 Z;  4NBF A;  3CCE 1;  5FLX b;  3I55 1;  3RZO I;  2R92 I;  3CC7 Z;  2ZAE B;  3CCL Z;  2WB1 A;  1Q81 1;  3CC2 1;  3S2H I;  2NVT I;  1RO0 A;  1YIJ Z;  1VQ7 1;  1I6H I;  2OZK A;  3F3P C;  5D1P A;  3I56 Z;  1NP6 A;  1USP A;  3M3Y I;  1VQP 1;  3IX0 A;  3GTQ I;  3JAM f;  3M4O I;  1YHQ 1;  3I07 A;  2K5R A;  4RVD A;  3CCU 1;  3G71 Z;  3BG1 B;  1YJW Z;  1K83 I;  3HKZ A;  1USP B;  1Z01 A;  3CCE Z;  3I55 Z;  3CXC Z;  1Q82 1;  3GTP I;  1K9M 2;  3NDJ A;  3S2D I;  3CC2 Z;  2HF1 A;  4RVH A;  1X3W A;  1ZB8 A;  1VQ7 Z;  2VUG A;  3VB9 A;  3D6W A;  3KIH A;  1JWH C;  4A3B I;  2M6N A;  1VQP Z;  4QTU A;  3J80 f;  3S15 I;  2NVY I;  3GKQ A;  3CPW Y;  3VMH A;  1YHQ Z;  3CCU Z;  1PFT A;  2F4O A;  2B63 I;  3J81 f;  4NBE A;  5D1O A;  2OTL 1;  5C4X I;  1YJ9 1;  3I4N I;  4A3E I;  1M1K 2;  4RVF A;  1RQF A;  1TWC I;  4E32 A;  4MD7 A;  3GTO I;  1VQO 1;  4E31 A;  4BY1 I;  1DL6 A;  4RS4 A;  1NUI A;  4NBG A;  3S14 I;  4MRI A;  5D1O B;  2EGT A;  1ZH1 A;  2JMO A;  1Q86 1;  4Y7N I;  3GTG I;  2V8I A;  3S1R I;  1VQ4 1;  4E30 A;  2V8K A;  5C4J I;  3G4S 1;  1Y1W I;  1KC8 1;  3HOW I;  2OTL Z;  3J7A 4;  4NB9 A;  4A3K I;  2LIY A;  1YJ9 Z;  3CPW Z;  4S1T A;  4NBD A;  1VQO Z;  2GU2 A;  2KI7 B;  1RO2 A;  3IFU A;  2GTH A;  3CME 1;  2R93 I;  1Z03 A;  2LFU A;  2QEX 1;  1K8A 2;  1JJ2 Y;  3P5J B;  3CXC Y;  4NBB A;  3ESW A;  5C3E I;  3NFZ A;  3Q87 A;  3S1N I;  1QVG Y;  3T4N B;  3J80 b;  2QA4 1;  5AN9 F;  1VQ4 Z;  1KD1 1;  3G4S Z;  1S72 1;  1TWF I;  2QKD A;  1QYP A;  2RHB A;  4A3G I;  1QVF Y;  1LQL A;  1Q7Y 2;  2IZ3 A;  4BBR I;  2P3Y A;  3LUS A;  2RIQ A;  3GTJ I;  2BJO A;  3PO3 I;  3BG0 B;  3CME Z;  1VQ6 1;  3GCF A;  2QEX Z;  4NH1 C;  4TNU A;  1NJI 2;  2JA7 I;  4A93 I;  2H85 A;  3CCJ 1;  4BY7 I;  3NH8 A;  2QA4 Z;  2IZ4 A;  3TDH B;  2JA8 I;  1L1O C;  2R6M A;  2W04 A;  1S72 Z;  3H0G I;  4Y52 I;  1JJ2 Z;  4A3D I;  4DQY B;  2OOY B;  5LL6 f;  2V8J A;  3D9X A;  3NH5 A;  2VUM I;  3CCM 1;  1QVG Z;  5T67 A;  4MD8 A;  1I50 I;  1WII A;  1N8R 1;  1VQ6 Z;  3PO2 I;  1K9M 1;  1SFO I;  5CM2 M;  2O53 A;  1QVF Z;  3GTK I;  3S17 I;  2QRC B;  3CCJ Z;  5A2Q b;  2PM9 A;  1Y1V I;  4RVG A;  4X6A I;  1RNI A;  2K3R A;  1Z02 A;  2QRD B;  2VF1 A;  4E2Z A;  3CCS 1;  2JNY A;  5IT9 f;  3MZK B;  3VMI A;  3CCV 1;  3CCM Z;  1KQS Y;  3S16 I;  3EER A;  1S7M A;  1RLY A;  1VQ8 1;  4XX2 A;  1M1K 1;  1W2B Z;  1TFI A;  1VLA A;  4DK1 A;  1YUA A;  4E2W A;  3CCR 1;  1M90 2;  3CQZ I;  3S1M I;  3JAM b;  4A3M I;  1VQ5 1;  2QLV B;  3CCS Z;  4BXX I;  2JA5 I;  2RPR A;  1TWA I;  3CCV Z;  2Q51 A;  5IP9 I;  1VQ8 Z;  3G6E 1;  3GTM I;  4CL1 A;  3CCR Z;  2P28 A;  1KQS Z;  3HOY I;  1RO4 A;  1P9N A;  1K8A 1;  2M48 A;  1VQL 1;  1VQ5 Z;  2PMZ A;  2I3C A;  2W03 A;  1R9T I;  4MXU A;  3I56 1;  3J81 b;  3GTL I;  1K73 2;  4HGY A;  1KD1 2;  1KRL A;  2E2H I;  1QF8 A;  2RBL A;  3VMG A;  2JS4 A;  3G6E Z;  3K7A I;  1Q7Y 1;  1Q81 2;  3HOZ I;  2QRE B;  4E2Y A;  3FKI I;  4QTT A;  3PO3 S;  1VQK 1;  1YIT 1;  3NH4 A;  1WW9 A;  3S1Q I;  3U50 C;  5FLM I;  4MH4 A;  3IF8 A;  1VQL Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...