2JR6A

Solution structure of upf0434 protein nma0874. northeast structural genomics target mr32
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
b'MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEEELKALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0434 protein NMA0874
publication title Solution structure of UPF0434 protein NMA0874.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jr6A01
2JA7I 2F4OA 2E2JI 3GTLI 3S1QI 4BBSI 3RZDI 2K5RA 3S1NI 5C3EI 3HOZI 1TWAI 2JS4A 3GTQI 2R93I 1Y1VI 2NVTI 2KPIA 5C4JI 4A3JI 1TWHI 1WW9A 3PO3I 3GTKI 1X3WA 4NBBA 1TWGI 3S1RI 4NBDA 2B63I 1QYPA 4NB9A 4QTUA 3U50C 1ML8A 4A3EI 4NBEA 2JA8I 2AKLA 4A3GI 1WCMI 2PK7A 3H0GI 3S15I 4NBAA 4NBHA 3S16I 1VLAA 3HOUI 3S1MI 2R92I 1PFTA 2DE7A 3VMHA 3HOYI 3I4MI 3HOVI 4BBRI 4X6AI 5FLMI 1K83I 4A3DI 2F4MA 3CQZI 5C44I 1LQLA 1ZB8A 3GTMS 3S2DI 4A93I 4A3LI 3LUSA 4A3II 1I50I 4XX2A 2YU9I 5IP7I 3K7AI 1USPB 1N2FA 3VB9A 4NBCA 3M3YI 4Y7NI 3GTJI 3GTPI 3M4OI 3GTGI 1R9TI 3PO3S 1SFOI 1RLYA 4A3BI 1DL6A 2J6AA 4Y52I 3H3VJ 4NB8A 3ESWA 3GKQA 4A3MI 2NVXI 1Y1WI 5C4XI 3VMGA 1X3ZA 2NVYI 4NOZA 3VMIA 5IP9I 3HOWI 1USPA 4MH4A 3GTOI 3I07A 3RZOI 4BY7I 3FKII 3Q87A 3S2HI 4QTTA 3S14I 4NBFA 3EERA 2JNYA 1Y1VS 2RBLA 2E2II 4A3CI 3PO2I 3D6WA 4A3KI 4A3FI 2DE6A 1I3QI 2DE5A 3GCFA 2VUMI 3S17I 1RO4A 3I4NI 3HOXI 2JA5I 2HF1A 2JA6I 1TWFI 2NVQI 2BJOA 2JR6A 1L1OC 1NUIA 4NBGA 1I6HI 5CM2M 2E2HI 4BXXI 1ZB9A 1TWCI 2P3YA 1TFIA 4BY1I 3GTMI 2R7ZI 1YUAA
chains in the Genus database with same CATH superfamily
2E2JI 3GTLI 3RZDI 2OTJZ 3CCSZ 2K5RA 1SIWA 2JS4A 2YADA 3OW2Z 1Y1VI 3I551 2NVTI 4A3JI 1TWHI 1FDIA 1X3WA 5AN9F 3J7A4 2W04A 4MD9A 2B63I 4QTUA 3VTNA 2V3VA 2P28A 5IT9b 3NFZA 1VLAA 1NP6A 3TE5B 5FLMI 4HGYA 1K83I 2OOXB 3CCVZ 3G711 4E33A 2KI7B 1ZB8A 2V8KA 4A3II 2QA41 1VQ91 3CC21 1K8A1 4NBCA 3M3YI 4Y7NI 1FDOA 1VQNZ 1VQ7Z 1WJ2A 1VQ51 2RIQA 1QVGY 2VPWA 1RLYA 1DL6A 4Y52I 2E7ZA 2JIMA 3NH8A 3CCJZ 5LL6f 3ESWA 2JIOA 3GKQA 3J80f 1Q821 4CL1A 1Q7Y1 1VQKZ 5IP9I 2OTLZ 3GTOI 3I07A 2QLVB 4TNUA 4BY7I 3S2HI 3S14I 3MONA 4A3CI 1NJI2 2RHBA 3JAMb 1I3QI 5D1PA 3CCQZ 1VQO1 3HOXI 2HF1A 1M1K2 2JA6I 4E31A 2V45A 4NBGA 4E2ZA 3CC71 2E2HI 4BXXI 1ZB9A 2VPYA 2W03A 1TFIA 2I3CA 2QEXZ 1W2BY 1ZH1A 2JA7I 3T4NB 2F4OA 2OTJ1 3MZKB 3CCS1 2QKDA 2QR1B 4BBSI 5T64A 1M901 3S1NI 1TWAI 2LFUA 4E2YA 1YIT1 2R93I 2KPIA 1WW9A 1S7MA 1Z02A 3PO3I 3CPWY 1TWGI 1X0TA 2RPRA 1QYPA 4NB9A 2JUBA 1ML8A 4A3EI 2JA8I 3CC4Z 2AKLA 1K732 5FLXb 4S1TA 1WCMI 3H0GI 3S15I 1YJWZ 3S16I 3HOUI 2OOYB 3MZLB 3S1MI 2R92I 4NH1C 1QVFY 3BG0B 3VMHA 4E32A 3J81f 3HOVI 4BBRI 4X6AI 1VQLZ 1KQSY 3CCV1 2VPZA 3CXCY 2G2KA 2F4MA 3CQZI 1Q862 5C44I 1YITZ 3GTMS 1JJ2Z 1VQ61 2YU9I 5IP7I 3K7AI 1YHQZ 2VPXA 1VQPZ 1VQN1 1VQ71 1R9TI 1AA6A 1YJNZ 3CMAZ 2J6AA 3CCJ1 3P5JB 2NVXI 1Q811 1VQ8Z 1Y1WI 1VQK1 5C4XI 2OTL1 1Z01A 1Y8CA 5A2Qb 1NJI1 4RV9A 1VQ6Z 3CD6Z 4QTTA 4MD7A 3D9XA 2RBLA 3D6WA 3FQMA 4HH4A 3OW2Y 1YUKA 1K9M2 2DE6A 3CCQ1 1RO2A 3GCFA 2VUMI 1RO4A 3I4NI 2GU2A 1YIJZ 2NVQI 1KC82 1I6HI 2QEX1 1TWCI 1N8R1 4RVHA 3NH5A 1W2BZ 1WZNA 4NFRA 3F3PC 4MXUA 5T67A 3NH4A 3HOZI 5IT9f 3GTQI 3CME1 5C4JI 3GTKI 4NBBA 3S1RI 3CC41 3G4SZ 4RVGA 2E9HA 2QRCB 1YJW1 2VUGA 4MRIA 1Q861 1PFTA 2IZ4A 1VQL1 3HOYI 1QVFZ 2IV2X 1S72Z 2QREB 2PMZA 3CMEZ 3CCMZ 3S2DI 4A3LI 3LUSA 1I50I 2M6NA 4RVDA 2VF1A 4XX2A 1YHQ1 3G6EZ 1VQP1 1USPB 3IFUA 1Q7Y2 3VB9A 3GTJI 3GTPI 4EWCA 3I56Z 2M48A 3KIHA 3GTGI 2PM9A 1YJN1 4DGLA 3EEDA 3CMA1 3PO3S 2V8IA 1SFOI 3IX0A 3D2LA 2O53A 3NDJA 1YI2Z 2WAQA 3H3VJ 4NB8A 4E30A 1VQMZ 1VQ81 3F3FC 4DK1A 4A3MI 1YJ9Z 1RO0A 4MD8A 2JIPA 2NVYI 1USPA 1QXFA 4MH4A 3JAMf 3CCUZ 1KD12 1Q16A 2HU9A 3RZOI 3FKII 3CD61 1K9M1 3CCLZ 1RNIA 2Q51A 4NBFA 2NAPA 2JNYA 3J80b 1Y1VS 2E2II 3PO2I 1RQFA 1QVGZ 1VQ4Z 5T6BA 4A3FI 1KC81 4MONA 2H85A 2AYDA 1YIJ1 3CCRZ 3QWUA 1M902 1P9NA 2GTHA 2ZAEB 2BJOA 2JR6A 1L1OC 5CM2M 4RS4A 2OZKA 1WIIA 3S1QI 3BG1B 5FLXf 1M1K1 5C3EI 3I55Z 1JJ2Y 3CCE1 3G4S1 4NBDA 3U50C 4NBEA 4E2XA 4RVFA 4A3GI 2PK7A 4NBAA 4NBHA 2R6MA 2DE7A 3I4MI 1S721 3IF8A 4A3DI 1KRLA 3CCM1 3HKZA 1K731 1LQLA 4A93I 3G71Z 3IR7A 3CPWZ 4HGZA 3G6E1 2O4HA 1Z03A 2JIRA 3CCEZ 2QA4Z 1VQ9Z 1Q812 3J81b 3CC2Z 3I561 1N2FA 2V8JA 3M4OI 5A2Qf 1VQ5Z 4A3BI 1YI21 1K8A2 1VQM1 1KD11 1KQSZ 1YJ91 3KIFA 3CXCZ 5D1OB 2Q4ZA 3VMGA 1X3ZA 3FQQA 2LIYA 3CCU1 4NOZA 3VMIA 4DQYB 3HOWI 4AYBA 3NDIA 2RT9A 3TDHB 1Q822 3CCL1 2JMOA 3Q87A 2WB1A 3EERA 1N8R2 1VQ41 4A3KI 2K3RA 2IZ3A 5D1OA 2DE5A 3CCR1 3S17I 2GTIA 1VQOZ 2JA5I 1TWFI 2QRDB 4E2WA 1JWHC 2JIQA 1NUIA 2LEXA 1QF8A 2P3YA 2Y0SA 2EGTA 3CC7Z 4BY1I 3GTMI 2R7ZI 1YUAA
chains in the Genus database with same CATH topology
2E2JI 3GTLI 3RZDI 2OTJZ 3CCSZ 2K5RA 2JS4A 2YADA 3OW2Z 1Y1VI 3I551 2NVTI 4A3JI 1TWHI 1X3WA 5AN9F 3J7A4 2W04A 4MD9A 2B63I 4QTUA 3VTNA 2P28A 5IT9b 3NFZA 1VLAA 1NP6A 3TE5B 5FLMI 4HGYA 1K83I 2OOXB 3CCVZ 3G711 4E33A 2KI7B 1ZB8A 2V8KA 4A3II 2QA41 1VQ91 3CC21 1K8A1 4NBCA 3M3YI 4Y7NI 1VQNZ 1VQ7Z 1VQ51 2RIQA 1QVGY 1RLYA 1DL6A 4Y52I 3CCJZ 3NH8A 5LL6f 3ESWA 3GKQA 3J80f 1Q821 4CL1A 1Q7Y1 1VQKZ 5IP9I 2OTLZ 3GTOI 3I07A 2QLVB 4TNUA 4BY7I 3S2HI 3S14I 3MONA 4A3CI 1NJI2 2RHBA 3JAMb 1I3QI 5D1PA 3CCQZ 1VQO1 3HOXI 2HF1A 1M1K2 2JA6I 4E31A 4NBGA 4E2ZA 3CC71 2E2HI 4BXXI 1ZB9A 2W03A 1TFIA 2I3CA 2QEXZ 1W2BY 1ZH1A 2JA7I 3T4NB 2F4OA 2OTJ1 3MZKB 3CCS1 2QKDA 2QR1B 4BBSI 5T64A 1M901 3S1NI 1TWAI 2LFUA 4E2YA 1YIT1 2R93I 2KPIA 1WW9A 1S7MA 1Z02A 3PO3I 3CPWY 1TWGI 1X0TA 2RPRA 1QYPA 4NB9A 2JUBA 1ML8A 4A3EI 2JA8I 3CC4Z 2AKLA 1K732 5FLXb 4S1TA 1WCMI 3H0GI 3S15I 1YJWZ 3S16I 3HOUI 2OOYB 3MZLB 3S1MI 2R92I 4NH1C 1QVFY 3BG0B 3VMHA 4E32A 3J81f 3HOVI 4BBRI 4X6AI 1VQLZ 1KQSY 3CCV1 3CXCY 2G2KA 2F4MA 3CQZI 1Q862 5C44I 1YITZ 3GTMS 1JJ2Z 1VQ61 2YU9I 5IP7I 3K7AI 1YHQZ 1VQPZ 1VQN1 1VQ71 1R9TI 1YJNZ 3CMAZ 2J6AA 3CCJ1 3P5JB 2NVXI 1Q811 1VQ8Z 1Y1WI 1VQK1 5C4XI 2OTL1 1Z01A 5A2Qb 1NJI1 4RV9A 1VQ6Z 3CD6Z 4QTTA 4MD7A 3D9XA 2RBLA 3D6WA 3FQMA 4HH4A 3OW2Y 1YUKA 1K9M2 2DE6A 3CCQ1 1RO2A 3GCFA 2VUMI 1RO4A 3I4NI 2GU2A 1YIJZ 2NVQI 1KC82 1I6HI 2QEX1 1TWCI 1N8R1 4RVHA 3NH5A 1W2BZ 4NFRA 3F3PC 4MXUA 5T67A 3NH4A 3HOZI 5IT9f 3GTQI 3CME1 5C4JI 3GTKI 4NBBA 3S1RI 3CC41 3G4SZ 4RVGA 2E9HA 2QRCB 1YJW1 2VUGA 4MRIA 1Q861 1PFTA 2IZ4A 1VQL1 3HOYI 1QVFZ 1S72Z 2QREB 2PMZA 3CMEZ 3CCMZ 3S2DI 4A3LI 3LUSA 1I50I 2M6NA 4RVDA 2VF1A 4XX2A 1YHQ1 3G6EZ 1VQP1 1USPB 3IFUA 1Q7Y2 3VB9A 3GTJI 3GTPI 4EWCA 3I56Z 2M48A 3KIHA 3GTGI 2PM9A 1YJN1 4DGLA 3EEDA 3CMA1 3PO3S 2V8IA 1SFOI 3IX0A 2O53A 3NDJA 1YI2Z 2WAQA 3H3VJ 4NB8A 4E30A 1VQMZ 1VQ81 3F3FC 4DK1A 4A3MI 1YJ9Z 1RO0A 4MD8A 2NVYI 1USPA 4MH4A 3JAMf 3CCUZ 1KD12 2HU9A 3RZOI 3FKII 3CD61 1K9M1 3CCLZ 1RNIA 2Q51A 4NBFA 2JNYA 3J80b 1Y1VS 2E2II 3PO2I 1RQFA 1QVGZ 1VQ4Z 5T6BA 4A3FI 1KC81 4MONA 2H85A 1YIJ1 3CCRZ 3QWUA 1M902 1P9NA 2GTHA 2ZAEB 2BJOA 2JR6A 1L1OC 5CM2M 4RS4A 2OZKA 1WIIA 3S1QI 3BG1B 5FLXf 1M1K1 5C3EI 3I55Z 1JJ2Y 3CCE1 3G4S1 4NBDA 3U50C 4NBEA 4E2XA 4RVFA 4A3GI 2PK7A 4NBAA 4NBHA 2R6MA 2DE7A 3I4MI 1S721 3IF8A 4A3DI 1KRLA 3CCM1 3HKZA 1K731 1LQLA 4A93I 3G71Z 3CPWZ 4HGZA 3G6E1 2O4HA 1Z03A 2QA4Z 3CCEZ 1VQ9Z 1Q812 3J81b 3CC2Z 3I561 1N2FA 2V8JA 3M4OI 5A2Qf 1VQ5Z 4A3BI 1YI21 1K8A2 1VQM1 1KD11 1KQSZ 1YJ91 3KIFA 3CXCZ 5D1OB 2Q4ZA 3VMGA 1X3ZA 3FQQA 2LIYA 3CCU1 4NOZA 3VMIA 4DQYB 3HOWI 4AYBA 3NDIA 2RT9A 3TDHB 1Q822 3CCL1 2JMOA 3Q87A 2WB1A 3EERA 1N8R2 1VQ41 4A3KI 2K3RA 2IZ3A 5D1OA 2DE5A 3CCR1 3S17I 2GTIA 1VQOZ 2JA5I 1TWFI 2QRDB 4E2WA 1JWHC 1NUIA 1QF8A 2P3YA 2Y0SA 2EGTA 3CC7Z 4BY1I 3GTMI 2R7ZI 1YUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA7 I;  2F4O A;  2E2J I;  3GTL I;  3S1Q I;  4BBS I;  3RZD I;  2K5R A;  3S1N I;  5C3E I;  3HOZ I;  1TWA I;  2JS4 A;  3GTQ I;  2R93 I;  1Y1V I;  2NVT I;  2KPI A;  5C4J I;  4A3J I;  1TWH I;  1WW9 A;  3PO3 I;  3GTK I;  1X3W A;  4NBB A;  1TWG I;  3S1R I;  4NBD A;  2B63 I;  1QYP A;  4NB9 A;  4QTU A;  3U50 C;  1ML8 A;  4A3E I;  4NBE A;  2JA8 I;  2AKL A;  4A3G I;  1WCM I;  2PK7 A;  3H0G I;  3S15 I;  4NBA A;  4NBH A;  3S16 I;  1VLA A;  3HOU I;  3S1M I;  2R92 I;  1PFT A;  2DE7 A;  3VMH A;  3HOY I;  3I4M I;  3HOV I;  4BBR I;  4X6A I;  5FLM I;  1K83 I;  4A3D I;  2F4M A;  3CQZ I;  5C44 I;  1LQL A;  1ZB8 A;  3GTM S;  3S2D I;  4A93 I;  4A3L I;  3LUS A;  4A3I I;  1I50 I;  4XX2 A;  2YU9 I;  5IP7 I;  3K7A I;  1USP B;  1N2F A;  3VB9 A;  4NBC A;  3M3Y I;  4Y7N I;  3GTJ I;  3GTP I;  3M4O I;  3GTG I;  1R9T I;  3PO3 S;  1SFO I;  1RLY A;  4A3B I;  1DL6 A;  2J6A A;  4Y52 I;  3H3V J;  4NB8 A;  3ESW A;  3GKQ A;  4A3M I;  2NVX I;  1Y1W I;  5C4X I;  3VMG A;  1X3Z A;  2NVY I;  4NOZ A;  3VMI A;  5IP9 I;  3HOW I;  1USP A;  4MH4 A;  3GTO I;  3I07 A;  3RZO I;  4BY7 I;  3FKI I;  3Q87 A;  3S2H I;  4QTT A;  3S14 I;  4NBF A;  3EER A;  2JNY A;  1Y1V S;  2RBL A;  2E2I I;  4A3C I;  3PO2 I;  3D6W A;  4A3K I;  4A3F I;  2DE6 A;  1I3Q I;  2DE5 A;  3GCF A;  2VUM I;  3S17 I;  1RO4 A;  3I4N I;  3HOX I;  2JA5 I;  2HF1 A;  2JA6 I;  1TWF I;  2NVQ I;  2BJO A;  2JR6 A;  1L1O C;  1NUI A;  4NBG A;  1I6H I;  5CM2 M;  2E2H I;  4BXX I;  1ZB9 A;  1TWC I;  2P3Y A;  1TFI A;  4BY1 I;  3GTM I;  2R7Z I;  1YUA A; 
#chains in the Genus database with same CATH topology
 2E2J I;  3GTL I;  3RZD I;  2OTJ Z;  3CCS Z;  2K5R A;  1SIW A;  2JS4 A;  2YAD A;  3OW2 Z;  1Y1V I;  3I55 1;  2NVT I;  4A3J I;  1TWH I;  1FDI A;  1X3W A;  5AN9 F;  3J7A 4;  2W04 A;  4MD9 A;  2B63 I;  4QTU A;  3VTN A;  2V3V A;  2P28 A;  5IT9 b;  3NFZ A;  1VLA A;  1NP6 A;  3TE5 B;  5FLM I;  4HGY A;  1K83 I;  2OOX B;  3CCV Z;  3G71 1;  4E33 A;  2KI7 B;  1ZB8 A;  2V8K A;  4A3I I;  2QA4 1;  1VQ9 1;  3CC2 1;  1K8A 1;  4NBC A;  3M3Y I;  4Y7N I;  1FDO A;  1VQN Z;  1VQ7 Z;  1WJ2 A;  1VQ5 1;  2RIQ A;  1QVG Y;  2VPW A;  1RLY A;  1DL6 A;  4Y52 I;  2E7Z A;  2JIM A;  3NH8 A;  3CCJ Z;  5LL6 f;  3ESW A;  2JIO A;  3GKQ A;  3J80 f;  1Q82 1;  4CL1 A;  1Q7Y 1;  1VQK Z;  5IP9 I;  2OTL Z;  3GTO I;  3I07 A;  2QLV B;  4TNU A;  4BY7 I;  3S2H I;  3S14 I;  3MON A;  4A3C I;  1NJI 2;  2RHB A;  3JAM b;  1I3Q I;  5D1P A;  3CCQ Z;  1VQO 1;  3HOX I;  2HF1 A;  1M1K 2;  2JA6 I;  4E31 A;  2V45 A;  4NBG A;  4E2Z A;  3CC7 1;  2E2H I;  4BXX I;  1ZB9 A;  2VPY A;  2W03 A;  1TFI A;  2I3C A;  2QEX Z;  1W2B Y;  1ZH1 A;  2JA7 I;  3T4N B;  2F4O A;  2OTJ 1;  3MZK B;  3CCS 1;  2QKD A;  2QR1 B;  4BBS I;  5T64 A;  1M90 1;  3S1N I;  1TWA I;  2LFU A;  4E2Y A;  1YIT 1;  2R93 I;  2KPI A;  1WW9 A;  1S7M A;  1Z02 A;  3PO3 I;  3CPW Y;  1TWG I;  1X0T A;  2RPR A;  1QYP A;  4NB9 A;  2JUB A;  1ML8 A;  4A3E I;  2JA8 I;  3CC4 Z;  2AKL A;  1K73 2;  5FLX b;  4S1T A;  1WCM I;  3H0G I;  3S15 I;  1YJW Z;  3S16 I;  3HOU I;  2OOY B;  3MZL B;  3S1M I;  2R92 I;  4NH1 C;  1QVF Y;  3BG0 B;  3VMH A;  4E32 A;  3J81 f;  3HOV I;  4BBR I;  4X6A I;  1VQL Z;  1KQS Y;  3CCV 1;  2VPZ A;  3CXC Y;  2G2K A;  2F4M A;  3CQZ I;  1Q86 2;  5C44 I;  1YIT Z;  3GTM S;  1JJ2 Z;  1VQ6 1;  2YU9 I;  5IP7 I;  3K7A I;  1YHQ Z;  2VPX A;  1VQP Z;  1VQN 1;  1VQ7 1;  1R9T I;  1AA6 A;  1YJN Z;  3CMA Z;  2J6A A;  3CCJ 1;  3P5J B;  2NVX I;  1Q81 1;  1VQ8 Z;  1Y1W I;  1VQK 1;  5C4X I;  2OTL 1;  1Z01 A;  1Y8C A;  5A2Q b;  1NJI 1;  4RV9 A;  1VQ6 Z;  3CD6 Z;  4QTT A;  4MD7 A;  3D9X A;  2RBL A;  3D6W A;  3FQM A;  4HH4 A;  3OW2 Y;  1YUK A;  1K9M 2;  2DE6 A;  3CCQ 1;  1RO2 A;  3GCF A;  2VUM I;  1RO4 A;  3I4N I;  2GU2 A;  1YIJ Z;  2NVQ I;  1KC8 2;  1I6H I;  2QEX 1;  1TWC I;  1N8R 1;  4RVH A;  3NH5 A;  1W2B Z;  1WZN A;  4NFR A;  3F3P C;  4MXU A;  5T67 A;  3NH4 A;  3HOZ I;  5IT9 f;  3GTQ I;  3CME 1;  5C4J I;  3GTK I;  4NBB A;  3S1R I;  3CC4 1;  3G4S Z;  4RVG A;  2E9H A;  2QRC B;  1YJW 1;  2VUG A;  4MRI A;  1Q86 1;  1PFT A;  2IZ4 A;  1VQL 1;  3HOY I;  1QVF Z;  2IV2 X;  1S72 Z;  2QRE B;  2PMZ A;  3CME Z;  3CCM Z;  3S2D I;  4A3L I;  3LUS A;  1I50 I;  2M6N A;  4RVD A;  2VF1 A;  4XX2 A;  1YHQ 1;  3G6E Z;  1VQP 1;  1USP B;  3IFU A;  1Q7Y 2;  3VB9 A;  3GTJ I;  3GTP I;  4EWC A;  3I56 Z;  2M48 A;  3KIH A;  3GTG I;  2PM9 A;  1YJN 1;  4DGL A;  3EED A;  3CMA 1;  3PO3 S;  2V8I A;  1SFO I;  3IX0 A;  3D2L A;  2O53 A;  3NDJ A;  1YI2 Z;  2WAQ A;  3H3V J;  4NB8 A;  4E30 A;  1VQM Z;  1VQ8 1;  3F3F C;  4DK1 A;  4A3M I;  1YJ9 Z;  1RO0 A;  4MD8 A;  2JIP A;  2NVY I;  1USP A;  1QXF A;  4MH4 A;  3JAM f;  3CCU Z;  1KD1 2;  1Q16 A;  2HU9 A;  3RZO I;  3FKI I;  3CD6 1;  1K9M 1;  3CCL Z;  1RNI A;  2Q51 A;  4NBF A;  2NAP A;  2JNY A;  3J80 b;  1Y1V S;  2E2I I;  3PO2 I;  1RQF A;  1QVG Z;  1VQ4 Z;  5T6B A;  4A3F I;  1KC8 1;  4MON A;  2H85 A;  2AYD A;  1YIJ 1;  3CCR Z;  3QWU A;  1M90 2;  1P9N A;  2GTH A;  2ZAE B;  2BJO A;  2JR6 A;  1L1O C;  5CM2 M;  4RS4 A;  2OZK A;  1WII A;  3S1Q I;  3BG1 B;  5FLX f;  1M1K 1;  5C3E I;  3I55 Z;  1JJ2 Y;  3CCE 1;  3G4S 1;  4NBD A;  3U50 C;  4NBE A;  4E2X A;  4RVF A;  4A3G I;  2PK7 A;  4NBA A;  4NBH A;  2R6M A;  2DE7 A;  3I4M I;  1S72 1;  3IF8 A;  4A3D I;  1KRL A;  3CCM 1;  3HKZ A;  1K73 1;  1LQL A;  4A93 I;  3G71 Z;  3IR7 A;  3CPW Z;  4HGZ A;  3G6E 1;  2O4H A;  1Z03 A;  2JIR A;  3CCE Z;  2QA4 Z;  1VQ9 Z;  1Q81 2;  3J81 b;  3CC2 Z;  3I56 1;  1N2F A;  2V8J A;  3M4O I;  5A2Q f;  1VQ5 Z;  4A3B I;  1YI2 1;  1K8A 2;  1VQM 1;  1KD1 1;  1KQS Z;  1YJ9 1;  3KIF A;  3CXC Z;  5D1O B;  2Q4Z A;  3VMG A;  1X3Z A;  3FQQ A;  2LIY A;  3CCU 1;  4NOZ A;  3VMI A;  4DQY B;  3HOW I;  4AYB A;  3NDI A;  2RT9 A;  3TDH B;  1Q82 2;  3CCL 1;  2JMO A;  3Q87 A;  2WB1 A;  3EER A;  1N8R 2;  1VQ4 1;  4A3K I;  2K3R A;  2IZ3 A;  5D1O A;  2DE5 A;  3CCR 1;  3S17 I;  2GTI A;  1VQO Z;  2JA5 I;  1TWF I;  2QRD B;  4E2W A;  1JWH C;  2JIQ A;  1NUI A;  2LEX A;  1QF8 A;  2P3Y A;  2Y0S A;  2EGT A;  3CC7 Z;  4BY1 I;  3GTM I;  2R7Z I;  1YUA A; 
#chains in the Genus database with same CATH homology
 2E2J I;  3GTL I;  3RZD I;  2OTJ Z;  3CCS Z;  2K5R A;  2JS4 A;  2YAD A;  3OW2 Z;  1Y1V I;  3I55 1;  2NVT I;  4A3J I;  1TWH I;  1X3W A;  5AN9 F;  3J7A 4;  2W04 A;  4MD9 A;  2B63 I;  4QTU A;  3VTN A;  2P28 A;  5IT9 b;  3NFZ A;  1VLA A;  1NP6 A;  3TE5 B;  5FLM I;  4HGY A;  1K83 I;  2OOX B;  3CCV Z;  3G71 1;  4E33 A;  2KI7 B;  1ZB8 A;  2V8K A;  4A3I I;  2QA4 1;  1VQ9 1;  3CC2 1;  1K8A 1;  4NBC A;  3M3Y I;  4Y7N I;  1VQN Z;  1VQ7 Z;  1VQ5 1;  2RIQ A;  1QVG Y;  1RLY A;  1DL6 A;  4Y52 I;  3CCJ Z;  3NH8 A;  5LL6 f;  3ESW A;  3GKQ A;  3J80 f;  1Q82 1;  4CL1 A;  1Q7Y 1;  1VQK Z;  5IP9 I;  2OTL Z;  3GTO I;  3I07 A;  2QLV B;  4TNU A;  4BY7 I;  3S2H I;  3S14 I;  3MON A;  4A3C I;  1NJI 2;  2RHB A;  3JAM b;  1I3Q I;  5D1P A;  3CCQ Z;  1VQO 1;  3HOX I;  2HF1 A;  1M1K 2;  2JA6 I;  4E31 A;  4NBG A;  4E2Z A;  3CC7 1;  2E2H I;  4BXX I;  1ZB9 A;  2W03 A;  1TFI A;  2I3C A;  2QEX Z;  1W2B Y;  1ZH1 A;  2JA7 I;  3T4N B;  2F4O A;  2OTJ 1;  3MZK B;  3CCS 1;  2QKD A;  2QR1 B;  4BBS I;  5T64 A;  1M90 1;  3S1N I;  1TWA I;  2LFU A;  4E2Y A;  1YIT 1;  2R93 I;  2KPI A;  1WW9 A;  1S7M A;  1Z02 A;  3PO3 I;  3CPW Y;  1TWG I;  1X0T A;  2RPR A;  1QYP A;  4NB9 A;  2JUB A;  1ML8 A;  4A3E I;  2JA8 I;  3CC4 Z;  2AKL A;  1K73 2;  5FLX b;  4S1T A;  1WCM I;  3H0G I;  3S15 I;  1YJW Z;  3S16 I;  3HOU I;  2OOY B;  3MZL B;  3S1M I;  2R92 I;  4NH1 C;  1QVF Y;  3BG0 B;  3VMH A;  4E32 A;  3J81 f;  3HOV I;  4BBR I;  4X6A I;  1VQL Z;  1KQS Y;  3CCV 1;  3CXC Y;  2G2K A;  2F4M A;  3CQZ I;  1Q86 2;  5C44 I;  1YIT Z;  3GTM S;  1JJ2 Z;  1VQ6 1;  2YU9 I;  5IP7 I;  3K7A I;  1YHQ Z;  1VQP Z;  1VQN 1;  1VQ7 1;  1R9T I;  1YJN Z;  3CMA Z;  2J6A A;  3CCJ 1;  3P5J B;  2NVX I;  1Q81 1;  1VQ8 Z;  1Y1W I;  1VQK 1;  5C4X I;  2OTL 1;  1Z01 A;  5A2Q b;  1NJI 1;  4RV9 A;  1VQ6 Z;  3CD6 Z;  4QTT A;  4MD7 A;  3D9X A;  2RBL A;  3D6W A;  3FQM A;  4HH4 A;  3OW2 Y;  1YUK A;  1K9M 2;  2DE6 A;  3CCQ 1;  1RO2 A;  3GCF A;  2VUM I;  1RO4 A;  3I4N I;  2GU2 A;  1YIJ Z;  2NVQ I;  1KC8 2;  1I6H I;  2QEX 1;  1TWC I;  1N8R 1;  4RVH A;  3NH5 A;  1W2B Z;  4NFR A;  3F3P C;  4MXU A;  5T67 A;  3NH4 A;  3HOZ I;  5IT9 f;  3GTQ I;  3CME 1;  5C4J I;  3GTK I;  4NBB A;  3S1R I;  3CC4 1;  3G4S Z;  4RVG A;  2E9H A;  2QRC B;  1YJW 1;  2VUG A;  4MRI A;  1Q86 1;  1PFT A;  2IZ4 A;  1VQL 1;  3HOY I;  1QVF Z;  1S72 Z;  2QRE B;  2PMZ A;  3CME Z;  3CCM Z;  3S2D I;  4A3L I;  3LUS A;  1I50 I;  2M6N A;  4RVD A;  2VF1 A;  4XX2 A;  1YHQ 1;  3G6E Z;  1VQP 1;  1USP B;  3IFU A;  1Q7Y 2;  3VB9 A;  3GTJ I;  3GTP I;  4EWC A;  3I56 Z;  2M48 A;  3KIH A;  3GTG I;  2PM9 A;  1YJN 1;  4DGL A;  3EED A;  3CMA 1;  3PO3 S;  2V8I A;  1SFO I;  3IX0 A;  2O53 A;  3NDJ A;  1YI2 Z;  2WAQ A;  3H3V J;  4NB8 A;  4E30 A;  1VQM Z;  1VQ8 1;  3F3F C;  4DK1 A;  4A3M I;  1YJ9 Z;  1RO0 A;  4MD8 A;  2NVY I;  1USP A;  4MH4 A;  3JAM f;  3CCU Z;  1KD1 2;  2HU9 A;  3RZO I;  3FKI I;  3CD6 1;  1K9M 1;  3CCL Z;  1RNI A;  2Q51 A;  4NBF A;  2JNY A;  3J80 b;  1Y1V S;  2E2I I;  3PO2 I;  1RQF A;  1QVG Z;  1VQ4 Z;  5T6B A;  4A3F I;  1KC8 1;  4MON A;  2H85 A;  1YIJ 1;  3CCR Z;  3QWU A;  1M90 2;  1P9N A;  2GTH A;  2ZAE B;  2BJO A;  2JR6 A;  1L1O C;  5CM2 M;  4RS4 A;  2OZK A;  1WII A;  3S1Q I;  3BG1 B;  5FLX f;  1M1K 1;  5C3E I;  3I55 Z;  1JJ2 Y;  3CCE 1;  3G4S 1;  4NBD A;  3U50 C;  4NBE A;  4E2X A;  4RVF A;  4A3G I;  2PK7 A;  4NBA A;  4NBH A;  2R6M A;  2DE7 A;  3I4M I;  1S72 1;  3IF8 A;  4A3D I;  1KRL A;  3CCM 1;  3HKZ A;  1K73 1;  1LQL A;  4A93 I;  3G71 Z;  3CPW Z;  4HGZ A;  3G6E 1;  2O4H A;  1Z03 A;  2QA4 Z;  3CCE Z;  1VQ9 Z;  1Q81 2;  3J81 b;  3CC2 Z;  3I56 1;  1N2F A;  2V8J A;  3M4O I;  5A2Q f;  1VQ5 Z;  4A3B I;  1YI2 1;  1K8A 2;  1VQM 1;  1KD1 1;  1KQS Z;  1YJ9 1;  3KIF A;  3CXC Z;  5D1O B;  2Q4Z A;  3VMG A;  1X3Z A;  3FQQ A;  2LIY A;  3CCU 1;  4NOZ A;  3VMI A;  4DQY B;  3HOW I;  4AYB A;  3NDI A;  2RT9 A;  3TDH B;  1Q82 2;  3CCL 1;  2JMO A;  3Q87 A;  2WB1 A;  3EER A;  1N8R 2;  1VQ4 1;  4A3K I;  2K3R A;  2IZ3 A;  5D1O A;  2DE5 A;  3CCR 1;  3S17 I;  2GTI A;  1VQO Z;  2JA5 I;  1TWF I;  2QRD B;  4E2W A;  1JWH C;  1NUI A;  1QF8 A;  2P3Y A;  2Y0S A;  2EGT A;  3CC7 Z;  4BY1 I;  3GTM I;  2R7Z I;  1YUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...