2JR6A

Solution structure of upf0434 protein nma0874. northeast structural genomics target mr32
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEEELKALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of UPF0434 protein NMA0874.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
molecule keywords UPF0434 protein NMA0874
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jr6A01
2JR6A 3CQZI 1QYPA 5IP7I 3HOYI 1I6HI 4BBSI 4A3GI 1ZB9A 4XX2A 3S2DI 1X3WA 1K83I 4NBHA 3GTOI 3ESWA 3GTKI 5CM2M 1ML8A 2NVTI 3S2HI 3FKII 3K7AI 2R93I 1TWAI 3PO3I 3GTMI 2HF1A 1RLYA 1TWGI 3S15I 3S1RI 1NUIA 5C4XI 3S16I 2F4MA 3HOZI 2RBLA 1I50I 3M3YI 3RZOI 3D6WA 4A3FI 2NVYI 1Y1VS 3GTJI 4A3MI 2F4OA 3H0GI 4A3II 1TWFI 4MH4A 1DL6A 2DE5A 3VB9A 4A3JI 2JA5I 3PO2I 4A3CI 2YU9I 3S1QI 4A3EI 3VMGA 1TWHI 3H3VJ 2NVQI 5C3EI 1USPB 4A3LI 2K5RA 1TWCI 3LUSA 3U50C 3HOXI 4A3KI 5C44I 1LQLA 5FLMI 2JA6I 3HOUI 1TFIA 4QTUA 4NOZA 2R92I 3S1NI 4BXXI 2VUMI 3S14I 1R9TI 2JA7I 2J6AA 3VMIA 3Q87A 4NBBA 1WW9A 3VMHA 2E2JI 1Y1WI 4NB9A 3S1MI 4A3DI 4NBFA 1WCMI 1Y1VI 4QTTA 1N2FA 2P3YA 4A3BI 3GTMS 5IP9I 1YUAA 2JA8I 1X3ZA 4NBGA 2BJOA 4NBDA 5C4JI 2JS4A 3HOWI 2JNYA 4NBCA 2B63I 1SFOI 3GTLI 3I4MI 3I4NI 3GTPI 2NVXI 3M4OI 1L1OC 3GCFA 2E2HI 3S17I 1RO4A 4Y52I 2AKLA 2KPIA 4NBEA 4NB8A 3EERA 4Y7NI 1I3QI 2DE7A 3GKQA 1USPA 1ZB8A 4X6AI 4BY1I 1PFTA 3PO3S 4BBRI 4A93I 3HOVI 3I07A 3RZDI 4NBAA 3GTQI 4BY7I 1VLAA 2DE6A 2R7ZI 3GTGI 2E2II 2PK7A
chains in the Genus database with same CATH superfamily
1QYPA 4BBSI 4XX2A 1RNIA 2QREB 2PMZA 3GTKI 1ML8A 2K3RA 3S2HI 3J81b 3J80f 2ZAEB 1VQL1 1TWGI 1Q811 3S15I 5C4XI 2AYDA 2F4MA 4RVFA 3NH8A 1M1K2 2M6NA 1I50I 1VQ9Z 1KC82 3CMAZ 1YHQZ 1Y1VS 2WB1A 1K732 4RVDA 2F4OA 3G711 3H0GI 3VTNA 2GTIA 3VB9A 4A3JI 3I56Z 3FQQA 4A3CI 1NJI2 3G6E1 4MD9A 1KRLA 3H3VJ 1TWHI 2KI7B 1YJ9Z 1USPB 5FLXb 3LUSA 4MONA 1LQLA 3HOUI 3KIFA 2V3VA 1Q821 1K8A1 4E2YA 2OTJZ 4A3DI 1VQ81 2LIYA 2GTHA 3CCR1 1N2FA 4QTTA 4A3BI 2JIRA 3CPWY 1KQSY 5A2Qb 2JNYA 2E7ZA 4DK1A 2B63I 3CCRZ 3I4NI 2QEX1 2NVXI 1FDIA 2IZ3A 5AN9F 2OTL1 2OOYB 2IV2X 3GKQA 1USPA 3CCV1 4NH1C 4X6AI 1VQ41 4BY1I 3CMA1 1PFTA 3PO3S 1VQP1 3I07A 2QLVB 3IFUA 2R7ZI 5A2Qf 2E2II 2VF1A 2JR6A 3CME1 1QVFZ 3HOYI 1I6HI 1ZB9A 2PM9A 2RHBA 1M1K1 3F3PC 1VQ4Z 3CD6Z 1M901 3GTOI 1QXFA 2G2KA 2NVTI 3FKII 3K7AI 1K731 5FLXf 3GTMI 1YIJ1 3S1RI 1VQKZ 3S16I 3IF8A 2EGTA 2JIQA 2RBLA 2RPRA 1YJW1 4A3FI 2NVYI 1Q862 1YIT1 2JUBA 1VQ5Z 3G4S1 4A3MI 1W2BZ 4A3II 1Y8CA 3CCVZ 2E9HA 4MH4A 2R6MA 3NFZA 1VQK1 2JA5I 2NAPA 3I551 1ZH1A 1JWHC 3P5JB 3VMGA 1Q7Y2 4A3LI 2K5RA 2JIMA 1VQ51 1X0TA 3CCQZ 3EEDA 3U50C 3D2LA 5FLMI 2JA6I 2GU2A 3MZKB 3IR7A 4NOZA 3CCM1 3S1NI 5D1OA 2P28A 3S14I 2JA7I 1QVGZ 1YHQ1 3VMIA 2JIOA 2IZ4A 1WW9A 1WJ2A 2V8JA 3JAMb 4NB9A 3BG0B 3S1MI 3MONA 3NH4A 2V8IA 3GTMS 5IP9I 4RS4A 2JA8I 3CCS1 2BJOA 4MXUA 2JS4A 5T67A 3HOWI 4NBCA 1YIJZ 1S721 3GTLI 3I4MI 1L1OC 3CCEZ 3G6EZ 4NB8A 3CC41 1AA6A 3TE5B 1Z03A 1N8R1 4A93I 5T6BA 3CCSZ 2V45A 3GTGI 2O53A 2JIPA 5IP7I 4DQYB 4A3GI 1VQ8Z 1P9NA 1X3WA 1Z02A 1K83I 1K9M1 3ESWA 5CM2M 3CCL1 2R93I 3PO3I 3CCMZ 1VQPZ 2QRCB 3QWUA 2VPZA 2QR1B 1S7MA 3D9XA 3HOZI 1KC81 1WIIA 3M3YI 3RZOI 4E32A 1NP6A 3GTJI 3CC21 4E2ZA 1KD12 2VPXA 2OTJ1 1VQ91 1TWFI 1QVFY 1VQ6Z 4E2XA 2W04A 2DE5A 3NDIA 3T4NB 1VQMZ 1Z01A 3OW2Z 3PO2I 1YJN1 2YU9I 4E31A 4TNUA 2NVQI 1RO0A 1NJI1 2O4HA 1VQ61 3CC71 3CC2Z 5IT9f 4MRIA 3FQMA 3HOXI 2OOXB 1TFIA 2QKDA 3CC4Z 4BXXI 2VUMI 3CXCZ 3F3FC 4E33A 3CCJ1 1JJ2Z 3CCUZ 1YI21 3Q87A 2QEXZ 1W2BY 4NBBA 2E2JI 2QRDB 2H85A 1Y1WI 3CCLZ 3BG1B 2I3CA 1WCMI 1YUAA 5IT9b 2Y0SA 1X3ZA 2HU9A 4NBDA 3TDHB 3CPWZ 1SFOI 1VQ7Z 4CL1A 2OZKA 1RQFA 4RV9A 3S17I 3GCFA 2E2HI 1RO4A 4Y52I 2M48A 2KPIA 1JJ2Y 4NBEA 1FDOA 3EERA 5D1PA 1I3QI 2DE7A 1YJWZ 1ZB8A 1YUKA 1VQLZ 3HOVI 4NBAA 3JAMf 2QA41 1VLAA 3GTQI 2DE6A 1Q16A 3OW2Y 3J81f 4E30A 3CQZI 4MD8A 1Q7Y1 1M902 3S2DI 3CCE1 2V8KA 4NBHA 1VQO1 3NH5A 2LEXA 1VQNZ 4EWCA 1TWAI 2HF1A 1RLYA 2JMOA 1NUIA 2OTLZ 1KQSZ 1YJ91 3D6WA 3CCU1 1YI2Z 4DGLA 3CXCY 1WZNA 1RO2A 4RVHA 2VPWA 1Q812 5T64A 2VUGA 1DL6A 3CCJZ 3CCQ1 1Q822 3NDJA 3S1QI 4A3EI 3CMEZ 5C3EI 1VQ71 1S72Z 1TWCI 1KD11 1VQM1 3MZLB 4E2WA 4NFRA 3G71Z 4A3KI 5C44I 3J7A4 2LFUA 4QTUA 2R92I 4HGYA 1R9TI 2J6AA 3KIHA 4S1TA 3J80b 2YADA 1YJNZ 2QA4Z 1YITZ 2RIQA 3HKZA 2WAQA 1K9M2 3VMHA 1VQN1 4NBFA 1Q861 1Y1VI 2P3YA 1SIWA 3CD61 2VPYA 4NBGA 5C4JI 4HH4A 3IX0A 4RVGA 1QVGY 1K8A2 4HGZA 3I561 2Q4ZA 3GTPI 3M4OI 2Q51A 3G4SZ 2W03A 3I55Z 2AKLA 1VQOZ 4Y7NI 4MD7A 4AYBA 1QF8A 5LL6f 5D1OB 3CC7Z 4BBRI 3RZDI 4BY7I 2RT9A 1N8R2 2PK7A
chains in the Genus database with same CATH topology
1QYPA 4BBSI 4XX2A 1RNIA 2QREB 2PMZA 3GTKI 1ML8A 2K3RA 3S2HI 3J81b 3J80f 2ZAEB 1VQL1 1TWGI 1Q811 3S15I 5C4XI 2F4MA 4RVFA 3NH8A 1M1K2 2M6NA 1I50I 1VQ9Z 1KC82 3CMAZ 1YHQZ 1Y1VS 2WB1A 1K732 4RVDA 2F4OA 3G711 3H0GI 3VTNA 2GTIA 3VB9A 4A3JI 3I56Z 3FQQA 4A3CI 1NJI2 3G6E1 4MD9A 1KRLA 3H3VJ 1TWHI 2KI7B 1YJ9Z 1USPB 5FLXb 3LUSA 4MONA 1LQLA 3HOUI 3KIFA 1Q821 1K8A1 4E2YA 2OTJZ 4A3DI 1VQ81 2LIYA 2GTHA 4QTTA 1N2FA 3CCR1 4A3BI 3CPWY 1KQSY 5A2Qb 2JNYA 4DK1A 2B63I 3CCRZ 3I4NI 2QEX1 2NVXI 2IZ3A 5AN9F 2OTL1 2OOYB 3GKQA 1USPA 3CCV1 4NH1C 4X6AI 1VQ41 4BY1I 3CMA1 1PFTA 3PO3S 1VQP1 3I07A 2QLVB 3IFUA 2R7ZI 5A2Qf 2E2II 2VF1A 2JR6A 3CME1 1QVFZ 3HOYI 1I6HI 1ZB9A 2PM9A 2RHBA 1M1K1 3F3PC 1VQ4Z 3CD6Z 1M901 3GTOI 2G2KA 2NVTI 3FKII 3K7AI 1K731 5FLXf 3GTMI 1YIJ1 3S1RI 1VQKZ 3S16I 3IF8A 2EGTA 2RBLA 2RPRA 1YJW1 4A3FI 2NVYI 1Q862 1YIT1 2JUBA 1VQ5Z 3G4S1 4A3MI 1W2BZ 4A3II 3CCVZ 2E9HA 4MH4A 2R6MA 3NFZA 1VQK1 2JA5I 3I551 1ZH1A 1JWHC 3P5JB 3VMGA 1Q7Y2 4A3LI 2K5RA 1VQ51 1X0TA 3CCQZ 3EEDA 3U50C 5FLMI 2JA6I 2GU2A 3MZKB 4NOZA 3CCM1 3S1NI 5D1OA 2P28A 3S14I 2JA7I 1QVGZ 1YHQ1 3VMIA 2IZ4A 1WW9A 2V8JA 3JAMb 4NB9A 3BG0B 3S1MI 3MONA 3NH4A 2V8IA 3GTMS 5IP9I 4RS4A 2JA8I 3CCS1 2BJOA 4MXUA 2JS4A 5T67A 3HOWI 4NBCA 1YIJZ 1S721 3GTLI 3I4MI 1L1OC 3CCEZ 3G6EZ 4NB8A 3CC41 3TE5B 1Z03A 1N8R1 4A93I 5T6BA 3CCSZ 3GTGI 2O53A 5IP7I 4DQYB 4A3GI 1VQ8Z 1P9NA 1X3WA 1Z02A 1K83I 1K9M1 3ESWA 5CM2M 3CCL1 2R93I 3PO3I 3CCMZ 1VQPZ 2QRCB 3QWUA 2QR1B 1S7MA 3D9XA 3HOZI 1KC81 1WIIA 3M3YI 3RZOI 4E32A 1NP6A 3GTJI 3CC21 4E2ZA 1KD12 2OTJ1 1VQ91 1TWFI 1QVFY 1VQ6Z 4E2XA 2W04A 2DE5A 3NDIA 3T4NB 1VQMZ 1Z01A 3OW2Z 3PO2I 1YJN1 2YU9I 4E31A 4TNUA 2NVQI 1RO0A 1NJI1 2O4HA 1VQ61 3CC71 3CC2Z 5IT9f 4MRIA 3FQMA 3HOXI 2OOXB 1TFIA 2QKDA 3CC4Z 4BXXI 2VUMI 3CXCZ 3F3FC 4E33A 3CCJ1 1JJ2Z 3CCUZ 1YI21 3Q87A 2QEXZ 1W2BY 4NBBA 2E2JI 2QRDB 2H85A 1Y1WI 3CCLZ 3BG1B 2I3CA 1WCMI 1YUAA 5IT9b 2Y0SA 1X3ZA 2HU9A 4NBDA 3TDHB 3CPWZ 1SFOI 1VQ7Z 4CL1A 2OZKA 1RQFA 4RV9A 3S17I 3GCFA 2E2HI 1RO4A 4Y52I 2M48A 2KPIA 1JJ2Y 4NBEA 3EERA 5D1PA 1YJWZ 1I3QI 2DE7A 1ZB8A 1YUKA 1VQLZ 3HOVI 4NBAA 3JAMf 2QA41 1VLAA 3GTQI 2DE6A 3OW2Y 3J81f 4E30A 3CQZI 4MD8A 1Q7Y1 1M902 3S2DI 3CCE1 2V8KA 4NBHA 1VQO1 3NH5A 1VQNZ 4EWCA 1TWAI 2HF1A 1RLYA 2JMOA 1NUIA 2OTLZ 1KQSZ 1YJ91 3D6WA 3CCU1 1YI2Z 4DGLA 3CXCY 1RO2A 4RVHA 1Q812 5T64A 2VUGA 1DL6A 3CCJZ 3CCQ1 1Q822 3NDJA 3S1QI 4A3EI 3CMEZ 5C3EI 1VQ71 1S72Z 1TWCI 1KD11 1VQM1 3MZLB 4E2WA 4NFRA 3G71Z 4A3KI 5C44I 3J7A4 2LFUA 4QTUA 2R92I 4HGYA 1R9TI 2J6AA 3KIHA 4S1TA 3J80b 2YADA 1YJNZ 2QA4Z 1YITZ 2RIQA 3HKZA 2WAQA 1K9M2 3VMHA 1VQN1 4NBFA 1Q861 1Y1VI 2P3YA 3CD61 4NBGA 5C4JI 4HH4A 3IX0A 4RVGA 1QVGY 1K8A2 4HGZA 3I561 2Q4ZA 3GTPI 3M4OI 2Q51A 3G4SZ 2W03A 3I55Z 2AKLA 1VQOZ 4Y7NI 4MD7A 4AYBA 1QF8A 5LL6f 5D1OB 3CC7Z 4BBRI 3RZDI 4BY7I 2RT9A 1N8R2 2PK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR6 A;  3CQZ I;  1QYP A;  5IP7 I;  3HOY I;  1I6H I;  4BBS I;  4A3G I;  1ZB9 A;  4XX2 A;  3S2D I;  1X3W A;  1K83 I;  4NBH A;  3GTO I;  3ESW A;  3GTK I;  5CM2 M;  1ML8 A;  2NVT I;  3S2H I;  3FKI I;  3K7A I;  2R93 I;  1TWA I;  3PO3 I;  3GTM I;  2HF1 A;  1RLY A;  1TWG I;  3S15 I;  3S1R I;  1NUI A;  5C4X I;  3S16 I;  2F4M A;  3HOZ I;  2RBL A;  1I50 I;  3M3Y I;  3RZO I;  3D6W A;  4A3F I;  2NVY I;  1Y1V S;  3GTJ I;  4A3M I;  2F4O A;  3H0G I;  4A3I I;  1TWF I;  4MH4 A;  1DL6 A;  2DE5 A;  3VB9 A;  4A3J I;  2JA5 I;  3PO2 I;  4A3C I;  2YU9 I;  3S1Q I;  4A3E I;  3VMG A;  1TWH I;  3H3V J;  2NVQ I;  5C3E I;  1USP B;  4A3L I;  2K5R A;  1TWC I;  3LUS A;  3U50 C;  3HOX I;  4A3K I;  5C44 I;  1LQL A;  5FLM I;  2JA6 I;  3HOU I;  1TFI A;  4QTU A;  4NOZ A;  2R92 I;  3S1N I;  4BXX I;  2VUM I;  3S14 I;  1R9T I;  2JA7 I;  2J6A A;  3VMI A;  3Q87 A;  4NBB A;  1WW9 A;  3VMH A;  2E2J I;  1Y1W I;  4NB9 A;  3S1M I;  4A3D I;  4NBF A;  1WCM I;  1Y1V I;  4QTT A;  1N2F A;  2P3Y A;  4A3B I;  3GTM S;  5IP9 I;  1YUA A;  2JA8 I;  1X3Z A;  4NBG A;  2BJO A;  4NBD A;  5C4J I;  2JS4 A;  3HOW I;  2JNY A;  4NBC A;  2B63 I;  1SFO I;  3GTL I;  3I4M I;  3I4N I;  3GTP I;  2NVX I;  3M4O I;  1L1O C;  3GCF A;  2E2H I;  3S17 I;  1RO4 A;  4Y52 I;  2AKL A;  2KPI A;  4NBE A;  4NB8 A;  3EER A;  4Y7N I;  1I3Q I;  2DE7 A;  3GKQ A;  1USP A;  1ZB8 A;  4X6A I;  4BY1 I;  1PFT A;  3PO3 S;  4BBR I;  4A93 I;  3HOV I;  3I07 A;  3RZD I;  4NBA A;  3GTQ I;  4BY7 I;  1VLA A;  2DE6 A;  2R7Z I;  3GTG I;  2E2I I;  2PK7 A; 
#chains in the Genus database with same CATH topology
 1QYP A;  4BBS I;  4XX2 A;  1RNI A;  2QRE B;  2PMZ A;  3GTK I;  1ML8 A;  2K3R A;  3S2H I;  3J81 b;  3J80 f;  2ZAE B;  1VQL 1;  1TWG I;  1Q81 1;  3S15 I;  5C4X I;  2AYD A;  2F4M A;  4RVF A;  3NH8 A;  1M1K 2;  2M6N A;  1I50 I;  1VQ9 Z;  1KC8 2;  3CMA Z;  1YHQ Z;  1Y1V S;  2WB1 A;  1K73 2;  4RVD A;  2F4O A;  3G71 1;  3H0G I;  3VTN A;  2GTI A;  3VB9 A;  4A3J I;  3I56 Z;  3FQQ A;  4A3C I;  1NJI 2;  3G6E 1;  4MD9 A;  1KRL A;  3H3V J;  1TWH I;  2KI7 B;  1YJ9 Z;  1USP B;  5FLX b;  3LUS A;  4MON A;  1LQL A;  3HOU I;  3KIF A;  2V3V A;  1Q82 1;  1K8A 1;  4E2Y A;  2OTJ Z;  4A3D I;  1VQ8 1;  2LIY A;  2GTH A;  3CCR 1;  1N2F A;  4QTT A;  4A3B I;  2JIR A;  3CPW Y;  1KQS Y;  5A2Q b;  2JNY A;  2E7Z A;  4DK1 A;  2B63 I;  3CCR Z;  3I4N I;  2QEX 1;  2NVX I;  1FDI A;  2IZ3 A;  5AN9 F;  2OTL 1;  2OOY B;  2IV2 X;  3GKQ A;  1USP A;  3CCV 1;  4NH1 C;  4X6A I;  1VQ4 1;  4BY1 I;  3CMA 1;  1PFT A;  3PO3 S;  1VQP 1;  3I07 A;  2QLV B;  3IFU A;  2R7Z I;  5A2Q f;  2E2I I;  2VF1 A;  2JR6 A;  3CME 1;  1QVF Z;  3HOY I;  1I6H I;  1ZB9 A;  2PM9 A;  2RHB A;  1M1K 1;  3F3P C;  1VQ4 Z;  3CD6 Z;  1M90 1;  3GTO I;  1QXF A;  2G2K A;  2NVT I;  3FKI I;  3K7A I;  1K73 1;  5FLX f;  3GTM I;  1YIJ 1;  3S1R I;  1VQK Z;  3S16 I;  3IF8 A;  2EGT A;  2JIQ A;  2RBL A;  2RPR A;  1YJW 1;  4A3F I;  2NVY I;  1Q86 2;  1YIT 1;  2JUB A;  1VQ5 Z;  3G4S 1;  4A3M I;  1W2B Z;  4A3I I;  1Y8C A;  3CCV Z;  2E9H A;  4MH4 A;  2R6M A;  3NFZ A;  1VQK 1;  2JA5 I;  2NAP A;  3I55 1;  1ZH1 A;  1JWH C;  3P5J B;  3VMG A;  1Q7Y 2;  4A3L I;  2K5R A;  2JIM A;  1VQ5 1;  1X0T A;  3CCQ Z;  3EED A;  3U50 C;  3D2L A;  5FLM I;  2JA6 I;  2GU2 A;  3MZK B;  3IR7 A;  4NOZ A;  3CCM 1;  3S1N I;  5D1O A;  2P28 A;  3S14 I;  2JA7 I;  1QVG Z;  1YHQ 1;  3VMI A;  2JIO A;  2IZ4 A;  1WW9 A;  1WJ2 A;  2V8J A;  3JAM b;  4NB9 A;  3BG0 B;  3S1M I;  3MON A;  3NH4 A;  2V8I A;  3GTM S;  5IP9 I;  4RS4 A;  2JA8 I;  3CCS 1;  2BJO A;  4MXU A;  2JS4 A;  5T67 A;  3HOW I;  4NBC A;  1YIJ Z;  1S72 1;  3GTL I;  3I4M I;  1L1O C;  3CCE Z;  3G6E Z;  4NB8 A;  3CC4 1;  1AA6 A;  3TE5 B;  1Z03 A;  1N8R 1;  4A93 I;  5T6B A;  3CCS Z;  2V45 A;  3GTG I;  2O53 A;  2JIP A;  5IP7 I;  4DQY B;  4A3G I;  1VQ8 Z;  1P9N A;  1X3W A;  1Z02 A;  1K83 I;  1K9M 1;  3ESW A;  5CM2 M;  3CCL 1;  2R93 I;  3PO3 I;  3CCM Z;  1VQP Z;  2QRC B;  3QWU A;  2VPZ A;  2QR1 B;  1S7M A;  3D9X A;  3HOZ I;  1KC8 1;  1WII A;  3M3Y I;  3RZO I;  4E32 A;  1NP6 A;  3GTJ I;  3CC2 1;  4E2Z A;  1KD1 2;  2VPX A;  2OTJ 1;  1VQ9 1;  1TWF I;  1QVF Y;  1VQ6 Z;  4E2X A;  2W04 A;  2DE5 A;  3NDI A;  3T4N B;  1VQM Z;  1Z01 A;  3OW2 Z;  3PO2 I;  1YJN 1;  2YU9 I;  4E31 A;  4TNU A;  2NVQ I;  1RO0 A;  1NJI 1;  2O4H A;  1VQ6 1;  3CC7 1;  3CC2 Z;  5IT9 f;  4MRI A;  3FQM A;  3HOX I;  2OOX B;  1TFI A;  2QKD A;  3CC4 Z;  4BXX I;  2VUM I;  3CXC Z;  3F3F C;  4E33 A;  3CCJ 1;  1JJ2 Z;  3CCU Z;  1YI2 1;  3Q87 A;  2QEX Z;  1W2B Y;  4NBB A;  2E2J I;  2QRD B;  2H85 A;  1Y1W I;  3CCL Z;  3BG1 B;  2I3C A;  1WCM I;  1YUA A;  5IT9 b;  2Y0S A;  1X3Z A;  2HU9 A;  4NBD A;  3TDH B;  3CPW Z;  1SFO I;  1VQ7 Z;  4CL1 A;  2OZK A;  1RQF A;  4RV9 A;  3S17 I;  3GCF A;  2E2H I;  1RO4 A;  4Y52 I;  2M48 A;  2KPI A;  1JJ2 Y;  4NBE A;  1FDO A;  3EER A;  5D1P A;  1I3Q I;  2DE7 A;  1YJW Z;  1ZB8 A;  1YUK A;  1VQL Z;  3HOV I;  4NBA A;  3JAM f;  2QA4 1;  1VLA A;  3GTQ I;  2DE6 A;  1Q16 A;  3OW2 Y;  3J81 f;  4E30 A;  3CQZ I;  4MD8 A;  1Q7Y 1;  1M90 2;  3S2D I;  3CCE 1;  2V8K A;  4NBH A;  1VQO 1;  3NH5 A;  2LEX A;  1VQN Z;  4EWC A;  1TWA I;  2HF1 A;  1RLY A;  2JMO A;  1NUI A;  2OTL Z;  1KQS Z;  1YJ9 1;  3D6W A;  3CCU 1;  1YI2 Z;  4DGL A;  3CXC Y;  1WZN A;  1RO2 A;  4RVH A;  2VPW A;  1Q81 2;  5T64 A;  2VUG A;  1DL6 A;  3CCJ Z;  3CCQ 1;  1Q82 2;  3NDJ A;  3S1Q I;  4A3E I;  3CME Z;  5C3E I;  1VQ7 1;  1S72 Z;  1TWC I;  1KD1 1;  1VQM 1;  3MZL B;  4E2W A;  4NFR A;  3G71 Z;  4A3K I;  5C44 I;  3J7A 4;  2LFU A;  4QTU A;  2R92 I;  4HGY A;  1R9T I;  2J6A A;  3KIH A;  4S1T A;  3J80 b;  2YAD A;  1YJN Z;  2QA4 Z;  1YIT Z;  2RIQ A;  3HKZ A;  2WAQ A;  1K9M 2;  3VMH A;  1VQN 1;  4NBF A;  1Q86 1;  1Y1V I;  2P3Y A;  1SIW A;  3CD6 1;  2VPY A;  4NBG A;  5C4J I;  4HH4 A;  3IX0 A;  4RVG A;  1QVG Y;  1K8A 2;  4HGZ A;  3I56 1;  2Q4Z A;  3GTP I;  3M4O I;  2Q51 A;  3G4S Z;  2W03 A;  3I55 Z;  2AKL A;  1VQO Z;  4Y7N I;  4MD7 A;  4AYB A;  1QF8 A;  5LL6 f;  5D1O B;  3CC7 Z;  4BBR I;  3RZD I;  4BY7 I;  2RT9 A;  1N8R 2;  2PK7 A; 
#chains in the Genus database with same CATH homology
 1QYP A;  4BBS I;  4XX2 A;  1RNI A;  2QRE B;  2PMZ A;  3GTK I;  1ML8 A;  2K3R A;  3S2H I;  3J81 b;  3J80 f;  2ZAE B;  1VQL 1;  1TWG I;  1Q81 1;  3S15 I;  5C4X I;  2F4M A;  4RVF A;  3NH8 A;  1M1K 2;  2M6N A;  1I50 I;  1VQ9 Z;  1KC8 2;  3CMA Z;  1YHQ Z;  1Y1V S;  2WB1 A;  1K73 2;  4RVD A;  2F4O A;  3G71 1;  3H0G I;  3VTN A;  2GTI A;  3VB9 A;  4A3J I;  3I56 Z;  3FQQ A;  4A3C I;  1NJI 2;  3G6E 1;  4MD9 A;  1KRL A;  3H3V J;  1TWH I;  2KI7 B;  1YJ9 Z;  1USP B;  5FLX b;  3LUS A;  4MON A;  1LQL A;  3HOU I;  3KIF A;  1Q82 1;  1K8A 1;  4E2Y A;  2OTJ Z;  4A3D I;  1VQ8 1;  2LIY A;  2GTH A;  4QTT A;  1N2F A;  3CCR 1;  4A3B I;  3CPW Y;  1KQS Y;  5A2Q b;  2JNY A;  4DK1 A;  2B63 I;  3CCR Z;  3I4N I;  2QEX 1;  2NVX I;  2IZ3 A;  5AN9 F;  2OTL 1;  2OOY B;  3GKQ A;  1USP A;  3CCV 1;  4NH1 C;  4X6A I;  1VQ4 1;  4BY1 I;  3CMA 1;  1PFT A;  3PO3 S;  1VQP 1;  3I07 A;  2QLV B;  3IFU A;  2R7Z I;  5A2Q f;  2E2I I;  2VF1 A;  2JR6 A;  3CME 1;  1QVF Z;  3HOY I;  1I6H I;  1ZB9 A;  2PM9 A;  2RHB A;  1M1K 1;  3F3P C;  1VQ4 Z;  3CD6 Z;  1M90 1;  3GTO I;  2G2K A;  2NVT I;  3FKI I;  3K7A I;  1K73 1;  5FLX f;  3GTM I;  1YIJ 1;  3S1R I;  1VQK Z;  3S16 I;  3IF8 A;  2EGT A;  2RBL A;  2RPR A;  1YJW 1;  4A3F I;  2NVY I;  1Q86 2;  1YIT 1;  2JUB A;  1VQ5 Z;  3G4S 1;  4A3M I;  1W2B Z;  4A3I I;  3CCV Z;  2E9H A;  4MH4 A;  2R6M A;  3NFZ A;  1VQK 1;  2JA5 I;  3I55 1;  1ZH1 A;  1JWH C;  3P5J B;  3VMG A;  1Q7Y 2;  4A3L I;  2K5R A;  1VQ5 1;  1X0T A;  3CCQ Z;  3EED A;  3U50 C;  5FLM I;  2JA6 I;  2GU2 A;  3MZK B;  4NOZ A;  3CCM 1;  3S1N I;  5D1O A;  2P28 A;  3S14 I;  2JA7 I;  1QVG Z;  1YHQ 1;  3VMI A;  2IZ4 A;  1WW9 A;  2V8J A;  3JAM b;  4NB9 A;  3BG0 B;  3S1M I;  3MON A;  3NH4 A;  2V8I A;  3GTM S;  5IP9 I;  4RS4 A;  2JA8 I;  3CCS 1;  2BJO A;  4MXU A;  2JS4 A;  5T67 A;  3HOW I;  4NBC A;  1YIJ Z;  1S72 1;  3GTL I;  3I4M I;  1L1O C;  3CCE Z;  3G6E Z;  4NB8 A;  3CC4 1;  3TE5 B;  1Z03 A;  1N8R 1;  4A93 I;  5T6B A;  3CCS Z;  3GTG I;  2O53 A;  5IP7 I;  4DQY B;  4A3G I;  1VQ8 Z;  1P9N A;  1X3W A;  1Z02 A;  1K83 I;  1K9M 1;  3ESW A;  5CM2 M;  3CCL 1;  2R93 I;  3PO3 I;  3CCM Z;  1VQP Z;  2QRC B;  3QWU A;  2QR1 B;  1S7M A;  3D9X A;  3HOZ I;  1KC8 1;  1WII A;  3M3Y I;  3RZO I;  4E32 A;  1NP6 A;  3GTJ I;  3CC2 1;  4E2Z A;  1KD1 2;  2OTJ 1;  1VQ9 1;  1TWF I;  1QVF Y;  1VQ6 Z;  4E2X A;  2W04 A;  2DE5 A;  3NDI A;  3T4N B;  1VQM Z;  1Z01 A;  3OW2 Z;  3PO2 I;  1YJN 1;  2YU9 I;  4E31 A;  4TNU A;  2NVQ I;  1RO0 A;  1NJI 1;  2O4H A;  1VQ6 1;  3CC7 1;  3CC2 Z;  5IT9 f;  4MRI A;  3FQM A;  3HOX I;  2OOX B;  1TFI A;  2QKD A;  3CC4 Z;  4BXX I;  2VUM I;  3CXC Z;  3F3F C;  4E33 A;  3CCJ 1;  1JJ2 Z;  3CCU Z;  1YI2 1;  3Q87 A;  2QEX Z;  1W2B Y;  4NBB A;  2E2J I;  2QRD B;  2H85 A;  1Y1W I;  3CCL Z;  3BG1 B;  2I3C A;  1WCM I;  1YUA A;  5IT9 b;  2Y0S A;  1X3Z A;  2HU9 A;  4NBD A;  3TDH B;  3CPW Z;  1SFO I;  1VQ7 Z;  4CL1 A;  2OZK A;  1RQF A;  4RV9 A;  3S17 I;  3GCF A;  2E2H I;  1RO4 A;  4Y52 I;  2M48 A;  2KPI A;  1JJ2 Y;  4NBE A;  3EER A;  5D1P A;  1YJW Z;  1I3Q I;  2DE7 A;  1ZB8 A;  1YUK A;  1VQL Z;  3HOV I;  4NBA A;  3JAM f;  2QA4 1;  1VLA A;  3GTQ I;  2DE6 A;  3OW2 Y;  3J81 f;  4E30 A;  3CQZ I;  4MD8 A;  1Q7Y 1;  1M90 2;  3S2D I;  3CCE 1;  2V8K A;  4NBH A;  1VQO 1;  3NH5 A;  1VQN Z;  4EWC A;  1TWA I;  2HF1 A;  1RLY A;  2JMO A;  1NUI A;  2OTL Z;  1KQS Z;  1YJ9 1;  3D6W A;  3CCU 1;  1YI2 Z;  4DGL A;  3CXC Y;  1RO2 A;  4RVH A;  1Q81 2;  5T64 A;  2VUG A;  1DL6 A;  3CCJ Z;  3CCQ 1;  1Q82 2;  3NDJ A;  3S1Q I;  4A3E I;  3CME Z;  5C3E I;  1VQ7 1;  1S72 Z;  1TWC I;  1KD1 1;  1VQM 1;  3MZL B;  4E2W A;  4NFR A;  3G71 Z;  4A3K I;  5C44 I;  3J7A 4;  2LFU A;  4QTU A;  2R92 I;  4HGY A;  1R9T I;  2J6A A;  3KIH A;  4S1T A;  3J80 b;  2YAD A;  1YJN Z;  2QA4 Z;  1YIT Z;  2RIQ A;  3HKZ A;  2WAQ A;  1K9M 2;  3VMH A;  1VQN 1;  4NBF A;  1Q86 1;  1Y1V I;  2P3Y A;  3CD6 1;  4NBG A;  5C4J I;  4HH4 A;  3IX0 A;  4RVG A;  1QVG Y;  1K8A 2;  4HGZ A;  3I56 1;  2Q4Z A;  3GTP I;  3M4O I;  2Q51 A;  3G4S Z;  2W03 A;  3I55 Z;  2AKL A;  1VQO Z;  4Y7N I;  4MD7 A;  4AYB A;  1QF8 A;  5LL6 f;  5D1O B;  3CC7 Z;  4BBR I;  3RZD I;  4BY7 I;  2RT9 A;  1N8R 2;  2PK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...