2OTLZ

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otlZ00
1W2BY 3CME1 1Q7Y2 1VQ91 1VQ71 3CC41 1QVGY 2QA4Z 3CD6Z 3G71Z 3CPWZ 1K8A2 1JJ2Z 1VQ4Z 1VQNZ 1M1K1 1VQ81 1VQ6Z 1KQSY 1Q7Y1 3CC7Z 2QA41 1YIJZ 1K9M2 3G4S1 3CCV1 1VQN1 1K8A1 3CXCZ 3CCE1 3CCR1 3CCLZ 1YJN1 1QVFY 3G6E1 1K732 3CCS1 3CCU1 1VQO1 3CC71 1YITZ 1VQKZ 1S72Z 1KD12 3I56Z 3CCJZ 1W2BZ 1YJ91 1K9M1 2OTJ1 3CCL1 1QVGZ 1YJWZ 1NJI2 3CC2Z 2OTLZ 3I55Z 1VQMZ 1YIT1 3CD61 1K731 2QEXZ 3G711 3CCJ1 1VQ41 1KQSZ 1KD11 1VQ5Z 1VQ61 3OW2Y 1YHQZ 3CC21 3I551 1NJI1 1YIJ1 2QEX1 3CMEZ 1VQ9Z 1M902 1Q812 3CC4Z 1Q862 1QVFZ 1Q822 1YI2Z 1VQPZ 1N8R2 3CMAZ 1JJ2Y 3CPWY 3CCQZ 1VQK1 1S721 1VQ8Z 1VQLZ 3I561 1YI21 1M901 1VQP1 1YJW1 3G4SZ 1Q811 3CCMZ 1Q861 1KC82 3CCVZ 2OTL1 1Q821 3CMA1 1VQM1 3CCQ1 1N8R1 3CCEZ 3CCRZ 1YJNZ 1VQL1 3G6EZ 3CXCY 3CCSZ 3CCUZ 1VQ7Z 1VQOZ 3OW2Z 1VQ51 1YHQ1 1M1K2 3CCM1 1YJ9Z 1KC81 2OTJZ
chains in the Genus database with same CATH superfamily
4Y7NI 1VQ71 4MRIA 1AA6A 2JA7I 3BG1B 3CPWZ 1K8A2 1Z01A 2JA6I 2Q4ZA 3HOZI 2HF1A 4HGYA 3ESWA 1TWGI 4NB9A 1Q7Y1 1YIJZ 1JWHC 3S14I 4MD9A 4RV9A 1N2FA 5IT9f 1VQN1 3CXCZ 4QTTA 3IFUA 3CCE1 3CCR1 2YU9I 2R7ZI 1K732 3FKII 5C4JI 1VQO1 3CC71 4A3CI 2E7ZA 4RVFA 3GTLI 1KD12 1YJ91 2R93I 3NDJA 2OTJ1 3VMGA 3GTGI 3Q87A 2PM9A 1VQMZ 1TFIA 3CQZI 3EERA 2Y0SA 1VQ61 3OW2Y 2O4HA 1ZB9A 4NBAA 1QXFA 2R6MA 4DK1A 3U50C 2W03A 2E9HA 3F3PC 3CC4Z 4NFRA 2P28A 3HKZA 4XX2A 5IT9b 1JJ2Y 4NH1C 3CCQZ 2JA5I 1VQ8Z 2B63I 2EGTA 1X0TA 2QKDA 1YI21 1YJW1 3MZLB 3G4SZ 3CCMZ 1Q861 1KC82 4A3JI 2LIYA 1N8R1 1YJNZ 2JIPA 3G6EZ 2G2KA 1WZNA 3CCUZ 3IR7A 2GTHA 2JNYA 4A3DI 4DQYB 4MD8A 1TWFI 3M4OI 2IV2X 1W2BY 2H85A 2V8IA 4HGZA 2GTIA 2QRCB 2Q51A 1QVGY 5C4XI 2QA4Z 3CD6Z 3I07A 1I3QI 1VQ4Z 1M1K1 1TWAI 2KI7B 3H3VJ 4E30A 2VPZA 1K9M2 2RBLA 1WCMI 4RVGA 2OOXB 5LL6f 1K8A1 5IP7I 4MXUA 3J7A4 3GTKI 1YITZ 2JIQA 1VQKZ 1S72Z 2BJOA 1TWHI 4E32A 3I56Z 2IZ3A 3CCJZ 2DE6A 2NVYI 2F4OA 4QTUA 1DL6A 2WB1A 4A3LI 2LEXA 3T4NB 1I50I 3CC2Z 3HOXI 3GTQI 4TNUA 3I55Z 3PO2I 1X3ZA 1K731 3HOVI 3G711 5T64A 3NH4A 4HH4A 5AN9F 2VPYA 3NH5A 1KD11 1VQ5Z 2KPIA 1YHQZ 1SIWA 3NH8A 2ZAEB 2NVTI 2QRDB 2JIMA 5D1OB 3VTNA 4BBSI 1M902 3QWUA 4NB8A 1Q822 1VQPZ 3S16I 3S1NI 3CMAZ 4A93I 2JIRA 4RVDA 3K7AI 3KIHA 3I4MI 2OTL1 3NFZA 2R92I 3CCQ1 4NBGA 3EEDA 3GTMS 2V3VA 3CCEZ 3CCRZ 4A3BI 1SFOI 3S15I 1WJ2A 1VQOZ 2DE7A 3OW2Z 4NBDA 4NOZA 1R9TI 3HOYI 3CCM1 2RPRA 4A3II 4E2WA 1YJ9Z 1KC81 4NBFA 2K3RA 2OTJZ 2JS4A 3CME1 2VUGA 4MONA 1VQ91 3I4NI 3RZOI 1YUKA 2HU9A 4A3FI 3S1RI 1VLAA 1JJ2Z 2V8JA 3KIFA 2QREB 1VQ6Z 1KQSY 2AKLA 1Z02A 3GKQA 2QA41 4E2ZA 4MH4A 3M3YI 3CCV1 4RVHA 2RT9A 3CCLZ 2M6NA 1RO4A 3PO3I 1QVFY 1Y1WI 3CCS1 1WIIA 1TWCI 5T67A 1YUAA 3GTPI 4BXXI 1Y1VI 2VPXA 2RHBA 3MZKB 3D9XA 1W2BZ 1K9M1 5C3EI 1S7MA 4BBRI 4E2YA 3HOWI 1QVGZ 1YJWZ 1NJI2 1YIT1 2QEXZ 5D1OA 2AYDA 1RNIA 5A2Qf 5FLMI 3CCJ1 4DGLA 4A3EI 2JUBA 1RLYA 3CC21 1ZH1A 3J80f 1P9NA 3I551 1YIJ1 4AYBA 2W04A 1K83I 1Q812 1Z03A 4S1TA 4BY7I 2NVQI 4A3MI 5C44I 3TDHB 3CPWY 4E31A 2VPWA 1RQFA 2JA8I 3MONA 3GTJI 3BG0B 2VUMI 1VQLZ 3LUSA 2O53A 1M901 3S1QI 1VQP1 2QR1B 1Q821 3CMA1 1VQM1 3S17I 2V45A 3CXCY 3NDIA 1VQ7Z 4E2XA 5A2Qb 1USPB 4Y52I 2VF1A 4MD7A 3J80b 1Q7Y2 1X3WA 3J81f 1FDIA 3CC41 1QF8A 2PMZA 3G71Z 3VMIA 2E2JI 1VQNZ 2JR6A 2P3YA 3GTMI 2I3CA 2IZ4A 3RZDI 1VQ81 3H0GI 2OOYB 3TE5B 1PFTA 4X6AI 1I6HI 3CC7Z 3FQMA 3G4S1 2JIOA 4NBEA 1YJN1 1QYPA 3G6E1 1RO0A 2QLVB 3CCU1 2V8KA 2K5RA 3HOUI 2DE5A 3D2LA 3CCL1 4NBBA 5CM2M 2RIQA 3IX0A 4E33A 2OTLZ 5FLXf 4CL1A 3CD61 3J81b 2NVXI 2J6AA 3JAMf 1Y8CA 1KQSZ 1VQ41 4NBCA 1WW9A 1Q16A 3S1MI 2NAPA 2WAQA 1NJI1 1RO2A 2QEX1 3CMEZ 3S2DI 2E2HI 1VQ9Z 1L1OC 3P5JB 2GU2A 1Q862 1QVFZ 4EWCA 1ZB8A 5D1PA 1YI2Z 1N8R2 2YADA 1KRLA 1NUIA 3GTOI 1VQK1 1S721 3PO3S 3I561 5IP9I 3FQQA 4RS4A 1FDOA 5T6BA 1USPA 1Q811 3VB9A 3CCVZ 4BY1I 1Y1VS 3S2HI 3IF8A 4A3KI 2E2II 1NP6A 2F4MA 4A3GI 3VMHA 5FLXb 1VQL1 4NBHA 3CCSZ 1ML8A 2M48A 3D6WA 1VQ51 3GCFA 3JAMb 2OZKA 1YHQ1 1M1K2 2JMOA 1LQLA 2PK7A 3F3FC 2LFUA
chains in the Genus database with same CATH topology
4Y7NI 1VQ71 4MRIA 2JA7I 3BG1B 3CPWZ 1K8A2 1Z01A 2JA6I 2Q4ZA 3HOZI 2HF1A 4HGYA 3ESWA 1TWGI 4NB9A 1Q7Y1 1YIJZ 1JWHC 3S14I 4MD9A 4RV9A 1N2FA 5IT9f 1VQN1 3CXCZ 4QTTA 3IFUA 3CCE1 3CCR1 2YU9I 2R7ZI 1K732 3FKII 5C4JI 1VQO1 3CC71 4A3CI 4RVFA 3GTLI 1KD12 1YJ91 2R93I 3NDJA 2OTJ1 3VMGA 3GTGI 3Q87A 2PM9A 1VQMZ 1TFIA 3CQZI 3EERA 2Y0SA 1VQ61 3OW2Y 2O4HA 1ZB9A 4NBAA 2R6MA 4DK1A 3U50C 2W03A 2E9HA 3F3PC 3CC4Z 4NFRA 2P28A 3HKZA 4XX2A 5IT9b 1JJ2Y 4NH1C 3CCQZ 2JA5I 1VQ8Z 2B63I 2EGTA 1X0TA 2QKDA 1YI21 1YJW1 3MZLB 3G4SZ 3CCMZ 1Q861 1KC82 4A3JI 2LIYA 1N8R1 1YJNZ 3G6EZ 2G2KA 3CCUZ 2GTHA 2JNYA 4A3DI 4DQYB 4MD8A 1TWFI 3M4OI 1W2BY 2H85A 2V8IA 4HGZA 2GTIA 2QRCB 2Q51A 1QVGY 5C4XI 2QA4Z 3CD6Z 3I07A 1I3QI 1VQ4Z 1M1K1 1TWAI 2KI7B 3H3VJ 4E30A 1K9M2 2RBLA 1WCMI 4RVGA 2OOXB 5LL6f 1K8A1 5IP7I 4MXUA 3J7A4 3GTKI 1YITZ 1VQKZ 1S72Z 2BJOA 1TWHI 4E32A 3I56Z 2IZ3A 3CCJZ 2DE6A 2NVYI 2F4OA 4QTUA 1DL6A 2WB1A 4A3LI 3T4NB 1I50I 3CC2Z 3HOXI 3GTQI 4TNUA 3I55Z 3PO2I 1X3ZA 1K731 3HOVI 3G711 5T64A 3NH4A 4HH4A 5AN9F 3NH5A 1KD11 1VQ5Z 2KPIA 1YHQZ 3NH8A 2ZAEB 2NVTI 2QRDB 5D1OB 3VTNA 4BBSI 1M902 3QWUA 4NB8A 1Q822 1VQPZ 3S16I 3S1NI 3CMAZ 4A93I 4RVDA 3K7AI 3KIHA 3I4MI 2OTL1 3NFZA 2R92I 3CCQ1 4NBGA 3EEDA 3GTMS 3CCEZ 3CCRZ 4A3BI 1SFOI 3S15I 1VQOZ 2DE7A 3OW2Z 4NBDA 4NOZA 1R9TI 3HOYI 3CCM1 2RPRA 4A3II 4E2WA 1YJ9Z 1KC81 4NBFA 2K3RA 2OTJZ 2JS4A 3CME1 2VUGA 4MONA 1VQ91 3I4NI 3RZOI 1YUKA 2HU9A 4A3FI 3S1RI 1VLAA 1JJ2Z 2V8JA 3KIFA 2QREB 1VQ6Z 1KQSY 2AKLA 1Z02A 3GKQA 2QA41 4E2ZA 4MH4A 3M3YI 3CCV1 4RVHA 2RT9A 3CCLZ 2M6NA 1RO4A 3PO3I 1QVFY 1Y1WI 3CCS1 1WIIA 1TWCI 5T67A 1YUAA 3GTPI 4BXXI 1Y1VI 2RHBA 3MZKB 3D9XA 1W2BZ 1K9M1 5C3EI 1S7MA 4BBRI 4E2YA 3HOWI 1QVGZ 1YJWZ 1NJI2 1YIT1 2QEXZ 5D1OA 5A2Qf 1RNIA 3CCJ1 5FLMI 4DGLA 4A3EI 2JUBA 1RLYA 3CC21 1ZH1A 3J80f 1P9NA 3I551 1YIJ1 4AYBA 2W04A 1K83I 1Q812 1Z03A 4S1TA 4BY7I 2NVQI 4A3MI 5C44I 3TDHB 3CPWY 4E31A 1RQFA 2JA8I 3MONA 3GTJI 3BG0B 2VUMI 1VQLZ 3LUSA 2O53A 1M901 3S1QI 1VQP1 2QR1B 1Q821 3CMA1 1VQM1 3S17I 3CXCY 3NDIA 1VQ7Z 4E2XA 5A2Qb 1USPB 4Y52I 2VF1A 4MD7A 3J80b 1Q7Y2 1X3WA 3J81f 3CC41 1QF8A 2PMZA 3G71Z 3VMIA 2E2JI 1VQNZ 2JR6A 2P3YA 3GTMI 2I3CA 2IZ4A 3RZDI 1VQ81 3H0GI 2OOYB 3TE5B 1PFTA 4X6AI 1I6HI 3CC7Z 3FQMA 3G4S1 4NBEA 1YJN1 1QYPA 3G6E1 1RO0A 2QLVB 3CCU1 2V8KA 2K5RA 3HOUI 2DE5A 3CCL1 4NBBA 5CM2M 2RIQA 3IX0A 4E33A 2OTLZ 5FLXf 4CL1A 3CD61 3J81b 2NVXI 2J6AA 3JAMf 1VQ41 1KQSZ 4NBCA 1WW9A 3S1MI 2WAQA 1NJI1 1RO2A 2QEX1 3CMEZ 3S2DI 2E2HI 1VQ9Z 1L1OC 3P5JB 2GU2A 1Q862 1QVFZ 4EWCA 1ZB8A 5D1PA 1YI2Z 1N8R2 2YADA 1KRLA 1NUIA 3GTOI 1VQK1 1S721 3PO3S 3I561 5IP9I 3FQQA 4RS4A 5T6BA 1USPA 1Q811 3VB9A 3CCVZ 4BY1I 1Y1VS 3S2HI 3IF8A 4A3KI 2E2II 1NP6A 2F4MA 4A3GI 3VMHA 5FLXb 1VQL1 4NBHA 3CCSZ 1ML8A 2M48A 3D6WA 1VQ51 3GCFA 3JAMb 2OZKA 1YHQ1 1M1K2 2JMOA 1LQLA 2PK7A 3F3FC 2LFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B Y;  3CME 1;  1Q7Y 2;  1VQ9 1;  1VQ7 1;  3CC4 1;  1QVG Y;  2QA4 Z;  3CD6 Z;  3G71 Z;  3CPW Z;  1K8A 2;  1JJ2 Z;  1VQ4 Z;  1VQN Z;  1M1K 1;  1VQ8 1;  1VQ6 Z;  1KQS Y;  1Q7Y 1;  3CC7 Z;  2QA4 1;  1YIJ Z;  1K9M 2;  3G4S 1;  3CCV 1;  1VQN 1;  1K8A 1;  3CXC Z;  3CCE 1;  3CCR 1;  3CCL Z;  1YJN 1;  1QVF Y;  3G6E 1;  1K73 2;  3CCS 1;  3CCU 1;  1VQO 1;  3CC7 1;  1YIT Z;  1VQK Z;  1S72 Z;  1KD1 2;  3I56 Z;  3CCJ Z;  1W2B Z;  1YJ9 1;  1K9M 1;  2OTJ 1;  3CCL 1;  1QVG Z;  1YJW Z;  1NJI 2;  3CC2 Z;  2OTL Z;  3I55 Z;  1VQM Z;  1YIT 1;  3CD6 1;  1K73 1;  2QEX Z;  3G71 1;  3CCJ 1;  1VQ4 1;  1KQS Z;  1KD1 1;  1VQ5 Z;  1VQ6 1;  3OW2 Y;  1YHQ Z;  3CC2 1;  3I55 1;  1NJI 1;  1YIJ 1;  2QEX 1;  3CME Z;  1VQ9 Z;  1M90 2;  1Q81 2;  3CC4 Z;  1Q86 2;  1QVF Z;  1Q82 2;  1YI2 Z;  1VQP Z;  1N8R 2;  3CMA Z;  1JJ2 Y;  3CPW Y;  3CCQ Z;  1VQK 1;  1S72 1;  1VQ8 Z;  1VQL Z;  3I56 1;  1YI2 1;  1M90 1;  1VQP 1;  1YJW 1;  3G4S Z;  1Q81 1;  3CCM Z;  1Q86 1;  1KC8 2;  3CCV Z;  2OTL 1;  1Q82 1;  3CMA 1;  1VQM 1;  3CCQ 1;  1N8R 1;  3CCE Z;  3CCR Z;  1YJN Z;  1VQL 1;  3G6E Z;  3CXC Y;  3CCS Z;  3CCU Z;  1VQ7 Z;  1VQO Z;  3OW2 Z;  1VQ5 1;  1YHQ 1;  1M1K 2;  3CCM 1;  1YJ9 Z;  1KC8 1;  2OTJ Z; 
#chains in the Genus database with same CATH topology
 4Y7N I;  1VQ7 1;  4MRI A;  1AA6 A;  2JA7 I;  3BG1 B;  3CPW Z;  1K8A 2;  1Z01 A;  2JA6 I;  2Q4Z A;  3HOZ I;  2HF1 A;  4HGY A;  3ESW A;  1TWG I;  4NB9 A;  1Q7Y 1;  1YIJ Z;  1JWH C;  3S14 I;  4MD9 A;  4RV9 A;  1N2F A;  5IT9 f;  1VQN 1;  3CXC Z;  4QTT A;  3IFU A;  3CCE 1;  3CCR 1;  2YU9 I;  2R7Z I;  1K73 2;  3FKI I;  5C4J I;  1VQO 1;  3CC7 1;  4A3C I;  2E7Z A;  4RVF A;  3GTL I;  1KD1 2;  1YJ9 1;  2R93 I;  3NDJ A;  2OTJ 1;  3VMG A;  3GTG I;  3Q87 A;  2PM9 A;  1VQM Z;  1TFI A;  3CQZ I;  3EER A;  2Y0S A;  1VQ6 1;  3OW2 Y;  2O4H A;  1ZB9 A;  4NBA A;  1QXF A;  2R6M A;  4DK1 A;  3U50 C;  2W03 A;  2E9H A;  3F3P C;  3CC4 Z;  4NFR A;  2P28 A;  3HKZ A;  4XX2 A;  5IT9 b;  1JJ2 Y;  4NH1 C;  3CCQ Z;  2JA5 I;  1VQ8 Z;  2B63 I;  2EGT A;  1X0T A;  2QKD A;  1YI2 1;  1YJW 1;  3MZL B;  3G4S Z;  3CCM Z;  1Q86 1;  1KC8 2;  4A3J I;  2LIY A;  1N8R 1;  1YJN Z;  2JIP A;  3G6E Z;  2G2K A;  1WZN A;  3CCU Z;  3IR7 A;  2GTH A;  2JNY A;  4A3D I;  4DQY B;  4MD8 A;  1TWF I;  3M4O I;  2IV2 X;  1W2B Y;  2H85 A;  2V8I A;  4HGZ A;  2GTI A;  2QRC B;  2Q51 A;  1QVG Y;  5C4X I;  2QA4 Z;  3CD6 Z;  3I07 A;  1I3Q I;  1VQ4 Z;  1M1K 1;  1TWA I;  2KI7 B;  3H3V J;  4E30 A;  2VPZ A;  1K9M 2;  2RBL A;  1WCM I;  4RVG A;  2OOX B;  5LL6 f;  1K8A 1;  5IP7 I;  4MXU A;  3J7A 4;  3GTK I;  1YIT Z;  2JIQ A;  1VQK Z;  1S72 Z;  2BJO A;  1TWH I;  4E32 A;  3I56 Z;  2IZ3 A;  3CCJ Z;  2DE6 A;  2NVY I;  2F4O A;  4QTU A;  1DL6 A;  2WB1 A;  4A3L I;  2LEX A;  3T4N B;  1I50 I;  3CC2 Z;  3HOX I;  3GTQ I;  4TNU A;  3I55 Z;  3PO2 I;  1X3Z A;  1K73 1;  3HOV I;  3G71 1;  5T64 A;  3NH4 A;  4HH4 A;  5AN9 F;  2VPY A;  3NH5 A;  1KD1 1;  1VQ5 Z;  2KPI A;  1YHQ Z;  1SIW A;  3NH8 A;  2ZAE B;  2NVT I;  2QRD B;  2JIM A;  5D1O B;  3VTN A;  4BBS I;  1M90 2;  3QWU A;  4NB8 A;  1Q82 2;  1VQP Z;  3S16 I;  3S1N I;  3CMA Z;  4A93 I;  2JIR A;  4RVD A;  3K7A I;  3KIH A;  3I4M I;  2OTL 1;  3NFZ A;  2R92 I;  3CCQ 1;  4NBG A;  3EED A;  3GTM S;  2V3V A;  3CCE Z;  3CCR Z;  4A3B I;  1SFO I;  3S15 I;  1WJ2 A;  1VQO Z;  2DE7 A;  3OW2 Z;  4NBD A;  4NOZ A;  1R9T I;  3HOY I;  3CCM 1;  2RPR A;  4A3I I;  4E2W A;  1YJ9 Z;  1KC8 1;  4NBF A;  2K3R A;  2OTJ Z;  2JS4 A;  3CME 1;  2VUG A;  4MON A;  1VQ9 1;  3I4N I;  3RZO I;  1YUK A;  2HU9 A;  4A3F I;  3S1R I;  1VLA A;  1JJ2 Z;  2V8J A;  3KIF A;  2QRE B;  1VQ6 Z;  1KQS Y;  2AKL A;  1Z02 A;  3GKQ A;  2QA4 1;  4E2Z A;  4MH4 A;  3M3Y I;  3CCV 1;  4RVH A;  2RT9 A;  3CCL Z;  2M6N A;  1RO4 A;  3PO3 I;  1QVF Y;  1Y1W I;  3CCS 1;  1WII A;  1TWC I;  5T67 A;  1YUA A;  3GTP I;  4BXX I;  1Y1V I;  2VPX A;  2RHB A;  3MZK B;  3D9X A;  1W2B Z;  1K9M 1;  5C3E I;  1S7M A;  4BBR I;  4E2Y A;  3HOW I;  1QVG Z;  1YJW Z;  1NJI 2;  1YIT 1;  2QEX Z;  5D1O A;  2AYD A;  1RNI A;  5A2Q f;  5FLM I;  3CCJ 1;  4DGL A;  4A3E I;  2JUB A;  1RLY A;  3CC2 1;  1ZH1 A;  3J80 f;  1P9N A;  3I55 1;  1YIJ 1;  4AYB A;  2W04 A;  1K83 I;  1Q81 2;  1Z03 A;  4S1T A;  4BY7 I;  2NVQ I;  4A3M I;  5C44 I;  3TDH B;  3CPW Y;  4E31 A;  2VPW A;  1RQF A;  2JA8 I;  3MON A;  3GTJ I;  3BG0 B;  2VUM I;  1VQL Z;  3LUS A;  2O53 A;  1M90 1;  3S1Q I;  1VQP 1;  2QR1 B;  1Q82 1;  3CMA 1;  1VQM 1;  3S17 I;  2V45 A;  3CXC Y;  3NDI A;  1VQ7 Z;  4E2X A;  5A2Q b;  1USP B;  4Y52 I;  2VF1 A;  4MD7 A;  3J80 b;  1Q7Y 2;  1X3W A;  3J81 f;  1FDI A;  3CC4 1;  1QF8 A;  2PMZ A;  3G71 Z;  3VMI A;  2E2J I;  1VQN Z;  2JR6 A;  2P3Y A;  3GTM I;  2I3C A;  2IZ4 A;  3RZD I;  1VQ8 1;  3H0G I;  2OOY B;  3TE5 B;  1PFT A;  4X6A I;  1I6H I;  3CC7 Z;  3FQM A;  3G4S 1;  2JIO A;  4NBE A;  1YJN 1;  1QYP A;  3G6E 1;  1RO0 A;  2QLV B;  3CCU 1;  2V8K A;  2K5R A;  3HOU I;  2DE5 A;  3D2L A;  3CCL 1;  4NBB A;  5CM2 M;  2RIQ A;  3IX0 A;  4E33 A;  2OTL Z;  5FLX f;  4CL1 A;  3CD6 1;  3J81 b;  2NVX I;  2J6A A;  3JAM f;  1Y8C A;  1KQS Z;  1VQ4 1;  4NBC A;  1WW9 A;  1Q16 A;  3S1M I;  2NAP A;  2WAQ A;  1NJI 1;  1RO2 A;  2QEX 1;  3CME Z;  3S2D I;  2E2H I;  1VQ9 Z;  1L1O C;  3P5J B;  2GU2 A;  1Q86 2;  1QVF Z;  4EWC A;  1ZB8 A;  5D1P A;  1YI2 Z;  1N8R 2;  2YAD A;  1KRL A;  1NUI A;  3GTO I;  1VQK 1;  1S72 1;  3PO3 S;  3I56 1;  5IP9 I;  3FQQ A;  4RS4 A;  1FDO A;  5T6B A;  1USP A;  1Q81 1;  3VB9 A;  3CCV Z;  4BY1 I;  1Y1V S;  3S2H I;  3IF8 A;  4A3K I;  2E2I I;  1NP6 A;  2F4M A;  4A3G I;  3VMH A;  5FLX b;  1VQL 1;  4NBH A;  3CCS Z;  1ML8 A;  2M48 A;  3D6W A;  1VQ5 1;  3GCF A;  3JAM b;  2OZK A;  1YHQ 1;  1M1K 2;  2JMO A;  1LQL A;  2PK7 A;  3F3F C;  2LFU A; 
#chains in the Genus database with same CATH homology
 4Y7N I;  1VQ7 1;  4MRI A;  2JA7 I;  3BG1 B;  3CPW Z;  1K8A 2;  1Z01 A;  2JA6 I;  2Q4Z A;  3HOZ I;  2HF1 A;  4HGY A;  3ESW A;  1TWG I;  4NB9 A;  1Q7Y 1;  1YIJ Z;  1JWH C;  3S14 I;  4MD9 A;  4RV9 A;  1N2F A;  5IT9 f;  1VQN 1;  3CXC Z;  4QTT A;  3IFU A;  3CCE 1;  3CCR 1;  2YU9 I;  2R7Z I;  1K73 2;  3FKI I;  5C4J I;  1VQO 1;  3CC7 1;  4A3C I;  4RVF A;  3GTL I;  1KD1 2;  1YJ9 1;  2R93 I;  3NDJ A;  2OTJ 1;  3VMG A;  3GTG I;  3Q87 A;  2PM9 A;  1VQM Z;  1TFI A;  3CQZ I;  3EER A;  2Y0S A;  1VQ6 1;  3OW2 Y;  2O4H A;  1ZB9 A;  4NBA A;  2R6M A;  4DK1 A;  3U50 C;  2W03 A;  2E9H A;  3F3P C;  3CC4 Z;  4NFR A;  2P28 A;  3HKZ A;  4XX2 A;  5IT9 b;  1JJ2 Y;  4NH1 C;  3CCQ Z;  2JA5 I;  1VQ8 Z;  2B63 I;  2EGT A;  1X0T A;  2QKD A;  1YI2 1;  1YJW 1;  3MZL B;  3G4S Z;  3CCM Z;  1Q86 1;  1KC8 2;  4A3J I;  2LIY A;  1N8R 1;  1YJN Z;  3G6E Z;  2G2K A;  3CCU Z;  2GTH A;  2JNY A;  4A3D I;  4DQY B;  4MD8 A;  1TWF I;  3M4O I;  1W2B Y;  2H85 A;  2V8I A;  4HGZ A;  2GTI A;  2QRC B;  2Q51 A;  1QVG Y;  5C4X I;  2QA4 Z;  3CD6 Z;  3I07 A;  1I3Q I;  1VQ4 Z;  1M1K 1;  1TWA I;  2KI7 B;  3H3V J;  4E30 A;  1K9M 2;  2RBL A;  1WCM I;  4RVG A;  2OOX B;  5LL6 f;  1K8A 1;  5IP7 I;  4MXU A;  3J7A 4;  3GTK I;  1YIT Z;  1VQK Z;  1S72 Z;  2BJO A;  1TWH I;  4E32 A;  3I56 Z;  2IZ3 A;  3CCJ Z;  2DE6 A;  2NVY I;  2F4O A;  4QTU A;  1DL6 A;  2WB1 A;  4A3L I;  3T4N B;  1I50 I;  3CC2 Z;  3HOX I;  3GTQ I;  4TNU A;  3I55 Z;  3PO2 I;  1X3Z A;  1K73 1;  3HOV I;  3G71 1;  5T64 A;  3NH4 A;  4HH4 A;  5AN9 F;  3NH5 A;  1KD1 1;  1VQ5 Z;  2KPI A;  1YHQ Z;  3NH8 A;  2ZAE B;  2NVT I;  2QRD B;  5D1O B;  3VTN A;  4BBS I;  1M90 2;  3QWU A;  4NB8 A;  1Q82 2;  1VQP Z;  3S16 I;  3S1N I;  3CMA Z;  4A93 I;  4RVD A;  3K7A I;  3KIH A;  3I4M I;  2OTL 1;  3NFZ A;  2R92 I;  3CCQ 1;  4NBG A;  3EED A;  3GTM S;  3CCE Z;  3CCR Z;  4A3B I;  1SFO I;  3S15 I;  1VQO Z;  2DE7 A;  3OW2 Z;  4NBD A;  4NOZ A;  1R9T I;  3HOY I;  3CCM 1;  2RPR A;  4A3I I;  4E2W A;  1YJ9 Z;  1KC8 1;  4NBF A;  2K3R A;  2OTJ Z;  2JS4 A;  3CME 1;  2VUG A;  4MON A;  1VQ9 1;  3I4N I;  3RZO I;  1YUK A;  2HU9 A;  4A3F I;  3S1R I;  1VLA A;  1JJ2 Z;  2V8J A;  3KIF A;  2QRE B;  1VQ6 Z;  1KQS Y;  2AKL A;  1Z02 A;  3GKQ A;  2QA4 1;  4E2Z A;  4MH4 A;  3M3Y I;  3CCV 1;  4RVH A;  2RT9 A;  3CCL Z;  2M6N A;  1RO4 A;  3PO3 I;  1QVF Y;  1Y1W I;  3CCS 1;  1WII A;  1TWC I;  5T67 A;  1YUA A;  3GTP I;  4BXX I;  1Y1V I;  2RHB A;  3MZK B;  3D9X A;  1W2B Z;  1K9M 1;  5C3E I;  1S7M A;  4BBR I;  4E2Y A;  3HOW I;  1QVG Z;  1YJW Z;  1NJI 2;  1YIT 1;  2QEX Z;  5D1O A;  5A2Q f;  1RNI A;  3CCJ 1;  5FLM I;  4DGL A;  4A3E I;  2JUB A;  1RLY A;  3CC2 1;  1ZH1 A;  3J80 f;  1P9N A;  3I55 1;  1YIJ 1;  4AYB A;  2W04 A;  1K83 I;  1Q81 2;  1Z03 A;  4S1T A;  4BY7 I;  2NVQ I;  4A3M I;  5C44 I;  3TDH B;  3CPW Y;  4E31 A;  1RQF A;  2JA8 I;  3MON A;  3GTJ I;  3BG0 B;  2VUM I;  1VQL Z;  3LUS A;  2O53 A;  1M90 1;  3S1Q I;  1VQP 1;  2QR1 B;  1Q82 1;  3CMA 1;  1VQM 1;  3S17 I;  3CXC Y;  3NDI A;  1VQ7 Z;  4E2X A;  5A2Q b;  1USP B;  4Y52 I;  2VF1 A;  4MD7 A;  3J80 b;  1Q7Y 2;  1X3W A;  3J81 f;  3CC4 1;  1QF8 A;  2PMZ A;  3G71 Z;  3VMI A;  2E2J I;  1VQN Z;  2JR6 A;  2P3Y A;  3GTM I;  2I3C A;  2IZ4 A;  3RZD I;  1VQ8 1;  3H0G I;  2OOY B;  3TE5 B;  1PFT A;  4X6A I;  1I6H I;  3CC7 Z;  3FQM A;  3G4S 1;  4NBE A;  1YJN 1;  1QYP A;  3G6E 1;  1RO0 A;  2QLV B;  3CCU 1;  2V8K A;  2K5R A;  3HOU I;  2DE5 A;  3CCL 1;  4NBB A;  5CM2 M;  2RIQ A;  3IX0 A;  4E33 A;  2OTL Z;  5FLX f;  4CL1 A;  3CD6 1;  3J81 b;  2NVX I;  2J6A A;  3JAM f;  1VQ4 1;  1KQS Z;  4NBC A;  1WW9 A;  3S1M I;  2WAQ A;  1NJI 1;  1RO2 A;  2QEX 1;  3CME Z;  3S2D I;  2E2H I;  1VQ9 Z;  1L1O C;  3P5J B;  2GU2 A;  1Q86 2;  1QVF Z;  4EWC A;  1ZB8 A;  5D1P A;  1YI2 Z;  1N8R 2;  2YAD A;  1KRL A;  1NUI A;  3GTO I;  1VQK 1;  1S72 1;  3PO3 S;  3I56 1;  5IP9 I;  3FQQ A;  4RS4 A;  5T6B A;  1USP A;  1Q81 1;  3VB9 A;  3CCV Z;  4BY1 I;  1Y1V S;  3S2H I;  3IF8 A;  4A3K I;  2E2I I;  1NP6 A;  2F4M A;  4A3G I;  3VMH A;  5FLX b;  1VQL 1;  4NBH A;  3CCS Z;  1ML8 A;  2M48 A;  3D6W A;  1VQ5 1;  3GCF A;  3JAM b;  2OZK A;  1YHQ 1;  1M1K 2;  2JMO A;  1LQL A;  2PK7 A;  3F3F C;  2LFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...