2OTLZ

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otlZ00
3CPWZ 1YHQZ 1NJI1 2OTLZ 1K8A1 3OW2Z 3CCUZ 1VQOZ 2OTJZ 2OTL1 1K9M2 3CCR1 1VQ91 1Q7Y2 1N8R2 1VQ7Z 3CCVZ 1VQO1 1KD11 1YJ91 3I56Z 1VQ9Z 1Q822 1VQM1 1Q811 1K9M1 3CD6Z 1VQ71 3CME1 2QA41 3CMA1 3OW2Y 1YITZ 1W2BY 1QVFY 3CCE1 1KD12 1YI2Z 1KC81 1NJI2 1Q862 2QA4Z 1VQ41 3CCMZ 1VQL1 1KQSZ 3CCS1 3CCLZ 1VQN1 1Q7Y1 3CPWY 1YI21 1M1K2 3G71Z 1M902 3I55Z 3CC7Z 3CCU1 1S721 1VQK1 1N8R1 3G6E1 1Q812 3CCJZ 1VQ8Z 1JJ2Y 1YJWZ 1YJNZ 1VQP1 1VQLZ 2OTJ1 3CC4Z 3G711 3CCV1 3G4S1 1VQNZ 1YJ9Z 1VQKZ 1KQSY 3I561 1YJN1 1K731 3CCJ1 1KC82 3CD61 3CMEZ 3G4SZ 1VQ61 1VQMZ 1QVGZ 3CC41 3CC21 1JJ2Z 3CXCY 1YIT1 3CCQ1 1M1K1 1M901 1YIJZ 1VQ4Z 1VQ6Z 3CCL1 3CCSZ 3CC2Z 3CCRZ 1VQ5Z 3I551 3CC71 1S72Z 1YIJ1 1VQ81 3CCQZ 1YJW1 1QVGY 2QEX1 1YHQ1 1VQPZ 3G6EZ 1W2BZ 1QVFZ 3CXCZ 3CMAZ 1Q821 1K8A2 1VQ51 2QEXZ 3CCEZ 3CCM1 1K732 1Q861
chains in the Genus database with same CATH superfamily
2OZKA 2E2HI 4A93I 1PFTA 2KPIA 3J7A4 2OTLZ 2JIOA 3BG0B 5AN9F 1YUKA 1RNIA 2BJOA 2OTJZ 4E2ZA 3I4NI 1L1OC 4A3EI 2QLVB 4NBFA 1YJ91 2KI7B 1Y8CA 1I50I 2JA6I 1Q822 4E32A 1K9M1 4MXUA 3CD6Z 3QWUA 1SFOI 1W2BY 2NVYI 3CCE1 2J6AA 2JIPA 2WB1A 2YADA 3HOXI 1X0TA 5D1PA 1KQSZ 3K7AI 5C44I 3CQZI 3CCS1 3CCLZ 4A3JI 3TDHB 3RZDI 3D2LA 3HOVI 2O53A 1YI21 1M902 1VQK1 3P5JB 3CCJZ 4MRIA 1YJWZ 1YJNZ 3FQMA 1YUAA 5C4JI 1WIIA 1I6HI 1TWCI 2GU2A 2OOXB 1QVGZ 3CC41 3S17I 1WCMI 4A3II 3J81b 3GTLI 1M1K1 3GTKI 1YIJZ 1FDOA 1VQ6Z 2M6NA 4HH4A 1AA6A 2GTIA 3I4MI 5T67A 3J81f 2E9HA 1Q16A 2Q51A 2GTHA 4MONA 2P3YA 4CL1A 4BXXI 1YJW1 2I3CA 2QEX1 1QVFZ 3CXCZ 3H0GI 1ZB9A 3CMAZ 2RBLA 2AKLA 3CCM1 3Q87A 2JA7I 4MD8A 5T6BA 1RO4A 2LEXA 3J80b 4DQYB 3GTGI 5D1OA 3T4NB 2LIYA 3GTOI 3D9XA 1R9TI 3MZKB 1RLYA 2VUMI 3PO2I 2EGTA 1TFIA 1QXFA 2OOYB 1N8R2 1VLAA 4A3MI 2ZAEB 4RVHA 2JUBA 1VQ9Z 4S1TA 1VQM1 1SIWA 1VQ71 2QA41 3CMA1 2F4MA 2R92I 1QVFY 2JMOA 1ZH1A 5C4XI 4Y52I 2R93I 3M3YI 2QA4Z 3J80f 3CCMZ 1TWAI 2JA5I 3KIFA 3GTMI 2NVQI 2WAQA 3S2DI 4E33A 1Q7Y1 1M1K2 3CC7Z 3HOZI 2JNYA 4BBRI 3TE5B 2Q4ZA 2NVXI 1VQP1 3M4OI 1NP6A 4XX2A 3CC4Z 4A3KI 3F3PC 1S7MA 5A2Qb 1YJN1 1K731 2QREB 1KC82 3CMEZ 1JJ2Z 1ZB8A 5C3EI 4NBCA 3CXCY 3GTMS 2RIQA 1NUIA 2VUGA 2DE5A 3EERA 2JIMA 4NBEA 3CC2Z 4BY1I 3CCRZ 1RO0A 3GTQI 2DE6A 3CC71 1FDIA 5LL6f 2IV2X 2B63I 1VQPZ 2HU9A 4DGLA 3GTJI 3U50C 3HOUI 1Q821 5FLXf 3NDJA 1WJ2A 3D6WA 3VB9A 2G2KA 2AYDA 3FQQA 3S1NI 2Y0SA 3S14I 3VMGA 1NJI1 2IZ3A 1USPB 1K83I 1X3WA 4NBHA 4RV9A 3CCUZ 2V8KA 1VQOZ 1WW9A 3NH5A 3FKII 4BY7I 3CCR1 3S1RI 1VQ91 1Q7Y2 4RVFA 4A3LI 3CCVZ 2IZ4A 2RPRA 1VQO1 4NBBA 3VTNA 3PO3I 2PMZA 2QKDA 3LUSA 4NBAA 1Q811 3OW2Y 2VPWA 2NAPA 1Z03A 5FLMI 3EEDA 1KC81 1Q862 1RO2A 4NOZA 1VQ41 1VQL1 1QF8A 2V3VA 3IF8A 2VPZA 3CCU1 3G6E1 1Q812 3IX0A 1VQ8Z 1JJ2Y 3GTPI 1TWFI 4NB8A 1VQLZ 2OTJ1 1I3QI 3G711 1VQNZ 2E2JI 1VQKZ 4A3BI 5IP9I 3I561 4E30A 3NH8A 3S15I 2V8IA 5T64A 3CCJ1 3CD61 3HOWI 1WZNA 3G4SZ 4BBSI 1VQ61 4NFRA 4NBGA 2P28A 4EWCA 4RVDA 2JIQA 2QRCB 2VPXA 2V8JA 2VF1A 3JAMf 3CCQ1 1Y1WI 4X6AI 3VMHA 5IT9f 2R6MA 1VQ5Z 4QTTA 4E2WA 1S72Z 1YIJ1 3H3VJ 4E2YA 4NB9A 3CCQZ 4RVGA 2PK7A 2QR1B 3PO3S 3F3FC 2RT9A 2K5RA 1K8A2 2PM9A 3S1QI 4HGYA 3MONA 1JWHC 3CPWZ 3KIHA 1YHQZ 1ML8A 5CM2M 1Z01A 5IP7I 1K8A1 1RQFA 2E7ZA 3OW2Z 2JS4A 1Y1VS 3BG1B 2QRDB 2R7ZI 2VPYA 4MH4A 1K9M2 2OTL1 1TWHI 1VQ7Z 1KD11 3NFZA 3I56Z 4A3DI 3IR7A 3CME1 3RZOI 5IT9b 2LFUA 5D1OB 1YITZ 4AYBA 2K3RA 2YU9I 1KD12 4NH1C 1YI2Z 1NJI2 4MD7A 3HOYI 4A3FI 2V45A 1VQN1 2JR6A 3ESWA 3CPWY 3G71Z 3GCFA 3I55Z 1S721 3S2HI 1N8R1 3HKZA 3I07A 3S1MI 4Y7NI 3MZLB 3IFUA 3CCV1 4HGZA 3NDIA 3G4S1 1P9NA 1YJ9Z 5FLXb 2M48A 1N2FA 1KQSY 4QTUA 4TNUA 4MD9A 3NH4A 2JA8I 1X3ZA 1LQLA 1VQMZ 2W03A 3CC21 4E2XA 3JAMb 2HF1A 4DK1A 1YIT1 1M901 1TWGI 1VQ4Z 4A3GI 2JIRA 4RS4A 3CCSZ 3CCL1 2W04A 1Y1VI 1DL6A 2O4HA 3I551 2H85A 3VMIA 2DE7A 1USPA 4NBDA 1QYPA 4E31A 1KRLA 1VQ81 1QVGY 2NVTI 1YHQ1 1W2BZ 3G6EZ 2F4OA 3GKQA 5A2Qf 3S16I 1VQ51 2RHBA 2QEXZ 3CCEZ 1Z02A 1K732 4A3CI 2E2II 1Q861
chains in the Genus database with same CATH topology
2OZKA 2E2HI 4A93I 1PFTA 2KPIA 3J7A4 2OTLZ 3BG0B 5AN9F 1YUKA 1RNIA 2BJOA 2OTJZ 4E2ZA 3I4NI 1L1OC 4A3EI 2QLVB 4NBFA 1YJ91 2KI7B 1I50I 2JA6I 1Q822 4E32A 1K9M1 4MXUA 3CD6Z 3QWUA 1SFOI 1W2BY 2NVYI 3CCE1 2J6AA 2WB1A 2YADA 3HOXI 1X0TA 5D1PA 1KQSZ 3K7AI 5C44I 3CQZI 3CCS1 3CCLZ 4A3JI 3TDHB 3RZDI 3HOVI 2O53A 1YI21 1M902 1VQK1 3P5JB 3CCJZ 4MRIA 1YJWZ 1YJNZ 3FQMA 1YUAA 5C4JI 1WIIA 1I6HI 1TWCI 2GU2A 2OOXB 1QVGZ 3CC41 3S17I 1WCMI 4A3II 3J81b 3GTLI 1M1K1 3GTKI 1YIJZ 1VQ6Z 2M6NA 4HH4A 2GTIA 3I4MI 5T67A 3J81f 2E9HA 2Q51A 2GTHA 4MONA 2P3YA 4CL1A 4BXXI 1YJW1 2I3CA 2QEX1 1QVFZ 3CXCZ 3H0GI 1ZB9A 3CMAZ 2RBLA 2AKLA 3CCM1 3Q87A 2JA7I 4MD8A 5T6BA 1RO4A 3J80b 4DQYB 3GTGI 5D1OA 3T4NB 2LIYA 3GTOI 3D9XA 1R9TI 3MZKB 1RLYA 2VUMI 3PO2I 2EGTA 1TFIA 2OOYB 1N8R2 1VLAA 4A3MI 2ZAEB 4RVHA 2JUBA 1VQ9Z 4S1TA 1VQM1 1VQ71 2QA41 3CMA1 2F4MA 2R92I 1QVFY 2JMOA 1ZH1A 5C4XI 4Y52I 2R93I 3M3YI 2QA4Z 3J80f 3CCMZ 1TWAI 2JA5I 3KIFA 3GTMI 2NVQI 2WAQA 3S2DI 4E33A 1Q7Y1 1M1K2 3CC7Z 3HOZI 2JNYA 4BBRI 3TE5B 2Q4ZA 2NVXI 1VQP1 3M4OI 1NP6A 4XX2A 3CC4Z 4A3KI 3F3PC 1S7MA 5A2Qb 1YJN1 1K731 2QREB 1KC82 3CMEZ 1JJ2Z 1ZB8A 5C3EI 4NBCA 3CXCY 3GTMS 2RIQA 1NUIA 2VUGA 2DE5A 3EERA 4NBEA 3CC2Z 4BY1I 3CCRZ 1RO0A 3GTQI 2DE6A 3CC71 5LL6f 2B63I 1VQPZ 2HU9A 4DGLA 3GTJI 3U50C 3HOUI 1Q821 5FLXf 3NDJA 3D6WA 3VB9A 2G2KA 3FQQA 3S1NI 2Y0SA 3S14I 3VMGA 1NJI1 2IZ3A 1USPB 1K83I 1X3WA 4NBHA 4RV9A 3CCUZ 2V8KA 1VQOZ 1WW9A 3NH5A 3FKII 4BY7I 3CCR1 3S1RI 1VQ91 1Q7Y2 4RVFA 4A3LI 3CCVZ 2IZ4A 2RPRA 1VQO1 4NBBA 3VTNA 3PO3I 2PMZA 2QKDA 3LUSA 4NBAA 1Q811 3OW2Y 1Z03A 5FLMI 3EEDA 1KC81 1Q862 1RO2A 4NOZA 1VQ41 1VQL1 1QF8A 3IF8A 3CCU1 3G6E1 1Q812 3IX0A 1VQ8Z 1JJ2Y 3GTPI 1TWFI 4NB8A 1VQLZ 2OTJ1 1I3QI 3G711 1VQNZ 2E2JI 1VQKZ 4A3BI 5IP9I 3I561 4E30A 3NH8A 3S15I 2V8IA 5T64A 3CCJ1 3CD61 3HOWI 3G4SZ 4BBSI 1VQ61 4NFRA 4NBGA 2P28A 4EWCA 4RVDA 2QRCB 2V8JA 2VF1A 3JAMf 3CCQ1 1Y1WI 4X6AI 3VMHA 5IT9f 2R6MA 1VQ5Z 4QTTA 4E2WA 1S72Z 1YIJ1 3H3VJ 4E2YA 4NB9A 3CCQZ 4RVGA 2PK7A 2QR1B 3PO3S 3F3FC 2RT9A 2K5RA 1K8A2 2PM9A 3S1QI 4HGYA 3MONA 1JWHC 3CPWZ 3KIHA 1YHQZ 1ML8A 5CM2M 1Z01A 5IP7I 1K8A1 1RQFA 3OW2Z 2JS4A 1Y1VS 3BG1B 2QRDB 2R7ZI 4MH4A 2OTL1 1K9M2 1TWHI 1VQ7Z 1KD11 3NFZA 3I56Z 4A3DI 3CME1 3RZOI 5IT9b 2LFUA 5D1OB 1YITZ 4AYBA 2K3RA 2YU9I 1KD12 4NH1C 1YI2Z 1NJI2 4MD7A 3HOYI 4A3FI 1VQN1 2JR6A 3ESWA 3CPWY 3G71Z 3GCFA 3I55Z 1S721 3S2HI 1N8R1 3HKZA 3I07A 3S1MI 4Y7NI 3MZLB 3IFUA 3CCV1 4HGZA 3NDIA 3G4S1 1P9NA 1YJ9Z 5FLXb 2M48A 1N2FA 1KQSY 4QTUA 4TNUA 4MD9A 3NH4A 2JA8I 1X3ZA 1LQLA 1VQMZ 2W03A 3CC21 4E2XA 3JAMb 2HF1A 4DK1A 1YIT1 1M901 1TWGI 1VQ4Z 4A3GI 4RS4A 3CCL1 3CCSZ 2W04A 1Y1VI 1DL6A 2O4HA 3I551 2H85A 3VMIA 2DE7A 1USPA 4NBDA 1QYPA 4E31A 1KRLA 1VQ81 1QVGY 2NVTI 1YHQ1 1W2BZ 3G6EZ 2F4OA 3GKQA 5A2Qf 3S16I 1VQ51 2RHBA 2QEXZ 3CCEZ 1Z02A 1K732 4A3CI 2E2II 1Q861
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW Z;  1YHQ Z;  1NJI 1;  2OTL Z;  1K8A 1;  3OW2 Z;  3CCU Z;  1VQO Z;  2OTJ Z;  2OTL 1;  1K9M 2;  3CCR 1;  1VQ9 1;  1Q7Y 2;  1N8R 2;  1VQ7 Z;  3CCV Z;  1VQO 1;  1KD1 1;  1YJ9 1;  3I56 Z;  1VQ9 Z;  1Q82 2;  1VQM 1;  1Q81 1;  1K9M 1;  3CD6 Z;  1VQ7 1;  3CME 1;  2QA4 1;  3CMA 1;  3OW2 Y;  1YIT Z;  1W2B Y;  1QVF Y;  3CCE 1;  1KD1 2;  1YI2 Z;  1KC8 1;  1NJI 2;  1Q86 2;  2QA4 Z;  1VQ4 1;  3CCM Z;  1VQL 1;  1KQS Z;  3CCS 1;  3CCL Z;  1VQN 1;  1Q7Y 1;  3CPW Y;  1YI2 1;  1M1K 2;  3G71 Z;  1M90 2;  3I55 Z;  3CC7 Z;  3CCU 1;  1S72 1;  1VQK 1;  1N8R 1;  3G6E 1;  1Q81 2;  3CCJ Z;  1VQ8 Z;  1JJ2 Y;  1YJW Z;  1YJN Z;  1VQP 1;  1VQL Z;  2OTJ 1;  3CC4 Z;  3G71 1;  3CCV 1;  3G4S 1;  1VQN Z;  1YJ9 Z;  1VQK Z;  1KQS Y;  3I56 1;  1YJN 1;  1K73 1;  3CCJ 1;  1KC8 2;  3CD6 1;  3CME Z;  3G4S Z;  1VQ6 1;  1VQM Z;  1QVG Z;  3CC4 1;  3CC2 1;  1JJ2 Z;  3CXC Y;  1YIT 1;  3CCQ 1;  1M1K 1;  1M90 1;  1YIJ Z;  1VQ4 Z;  1VQ6 Z;  3CCL 1;  3CCS Z;  3CC2 Z;  3CCR Z;  1VQ5 Z;  3I55 1;  3CC7 1;  1S72 Z;  1YIJ 1;  1VQ8 1;  3CCQ Z;  1YJW 1;  1QVG Y;  2QEX 1;  1YHQ 1;  1VQP Z;  3G6E Z;  1W2B Z;  1QVF Z;  3CXC Z;  3CMA Z;  1Q82 1;  1K8A 2;  1VQ5 1;  2QEX Z;  3CCE Z;  3CCM 1;  1K73 2;  1Q86 1; 
#chains in the Genus database with same CATH topology
 2OZK A;  2E2H I;  4A93 I;  1PFT A;  2KPI A;  3J7A 4;  2OTL Z;  2JIO A;  3BG0 B;  5AN9 F;  1YUK A;  1RNI A;  2BJO A;  2OTJ Z;  4E2Z A;  3I4N I;  1L1O C;  4A3E I;  2QLV B;  4NBF A;  1YJ9 1;  2KI7 B;  1Y8C A;  1I50 I;  2JA6 I;  1Q82 2;  4E32 A;  1K9M 1;  4MXU A;  3CD6 Z;  3QWU A;  1SFO I;  1W2B Y;  2NVY I;  3CCE 1;  2J6A A;  2JIP A;  2WB1 A;  2YAD A;  3HOX I;  1X0T A;  5D1P A;  1KQS Z;  3K7A I;  5C44 I;  3CQZ I;  3CCS 1;  3CCL Z;  4A3J I;  3TDH B;  3RZD I;  3D2L A;  3HOV I;  2O53 A;  1YI2 1;  1M90 2;  1VQK 1;  3P5J B;  3CCJ Z;  4MRI A;  1YJW Z;  1YJN Z;  3FQM A;  1YUA A;  5C4J I;  1WII A;  1I6H I;  1TWC I;  2GU2 A;  2OOX B;  1QVG Z;  3CC4 1;  3S17 I;  1WCM I;  4A3I I;  3J81 b;  3GTL I;  1M1K 1;  3GTK I;  1YIJ Z;  1FDO A;  1VQ6 Z;  2M6N A;  4HH4 A;  1AA6 A;  2GTI A;  3I4M I;  5T67 A;  3J81 f;  2E9H A;  1Q16 A;  2Q51 A;  2GTH A;  4MON A;  2P3Y A;  4CL1 A;  4BXX I;  1YJW 1;  2I3C A;  2QEX 1;  1QVF Z;  3CXC Z;  3H0G I;  1ZB9 A;  3CMA Z;  2RBL A;  2AKL A;  3CCM 1;  3Q87 A;  2JA7 I;  4MD8 A;  5T6B A;  1RO4 A;  2LEX A;  3J80 b;  4DQY B;  3GTG I;  5D1O A;  3T4N B;  2LIY A;  3GTO I;  3D9X A;  1R9T I;  3MZK B;  1RLY A;  2VUM I;  3PO2 I;  2EGT A;  1TFI A;  1QXF A;  2OOY B;  1N8R 2;  1VLA A;  4A3M I;  2ZAE B;  4RVH A;  2JUB A;  1VQ9 Z;  4S1T A;  1VQM 1;  1SIW A;  1VQ7 1;  2QA4 1;  3CMA 1;  2F4M A;  2R92 I;  1QVF Y;  2JMO A;  1ZH1 A;  5C4X I;  4Y52 I;  2R93 I;  3M3Y I;  2QA4 Z;  3J80 f;  3CCM Z;  1TWA I;  2JA5 I;  3KIF A;  3GTM I;  2NVQ I;  2WAQ A;  3S2D I;  4E33 A;  1Q7Y 1;  1M1K 2;  3CC7 Z;  3HOZ I;  2JNY A;  4BBR I;  3TE5 B;  2Q4Z A;  2NVX I;  1VQP 1;  3M4O I;  1NP6 A;  4XX2 A;  3CC4 Z;  4A3K I;  3F3P C;  1S7M A;  5A2Q b;  1YJN 1;  1K73 1;  2QRE B;  1KC8 2;  3CME Z;  1JJ2 Z;  1ZB8 A;  5C3E I;  4NBC A;  3CXC Y;  3GTM S;  2RIQ A;  1NUI A;  2VUG A;  2DE5 A;  3EER A;  2JIM A;  4NBE A;  3CC2 Z;  4BY1 I;  3CCR Z;  1RO0 A;  3GTQ I;  2DE6 A;  3CC7 1;  1FDI A;  5LL6 f;  2IV2 X;  2B63 I;  1VQP Z;  2HU9 A;  4DGL A;  3GTJ I;  3U50 C;  3HOU I;  1Q82 1;  5FLX f;  3NDJ A;  1WJ2 A;  3D6W A;  3VB9 A;  2G2K A;  2AYD A;  3FQQ A;  3S1N I;  2Y0S A;  3S14 I;  3VMG A;  1NJI 1;  2IZ3 A;  1USP B;  1K83 I;  1X3W A;  4NBH A;  4RV9 A;  3CCU Z;  2V8K A;  1VQO Z;  1WW9 A;  3NH5 A;  3FKI I;  4BY7 I;  3CCR 1;  3S1R I;  1VQ9 1;  1Q7Y 2;  4RVF A;  4A3L I;  3CCV Z;  2IZ4 A;  2RPR A;  1VQO 1;  4NBB A;  3VTN A;  3PO3 I;  2PMZ A;  2QKD A;  3LUS A;  4NBA A;  1Q81 1;  3OW2 Y;  2VPW A;  2NAP A;  1Z03 A;  5FLM I;  3EED A;  1KC8 1;  1Q86 2;  1RO2 A;  4NOZ A;  1VQ4 1;  1VQL 1;  1QF8 A;  2V3V A;  3IF8 A;  2VPZ A;  3CCU 1;  3G6E 1;  1Q81 2;  3IX0 A;  1VQ8 Z;  1JJ2 Y;  3GTP I;  1TWF I;  4NB8 A;  1VQL Z;  2OTJ 1;  1I3Q I;  3G71 1;  1VQN Z;  2E2J I;  1VQK Z;  4A3B I;  5IP9 I;  3I56 1;  4E30 A;  3NH8 A;  3S15 I;  2V8I A;  5T64 A;  3CCJ 1;  3CD6 1;  3HOW I;  1WZN A;  3G4S Z;  4BBS I;  1VQ6 1;  4NFR A;  4NBG A;  2P28 A;  4EWC A;  4RVD A;  2JIQ A;  2QRC B;  2VPX A;  2V8J A;  2VF1 A;  3JAM f;  3CCQ 1;  1Y1W I;  4X6A I;  3VMH A;  5IT9 f;  2R6M A;  1VQ5 Z;  4QTT A;  4E2W A;  1S72 Z;  1YIJ 1;  3H3V J;  4E2Y A;  4NB9 A;  3CCQ Z;  4RVG A;  2PK7 A;  2QR1 B;  3PO3 S;  3F3F C;  2RT9 A;  2K5R A;  1K8A 2;  2PM9 A;  3S1Q I;  4HGY A;  3MON A;  1JWH C;  3CPW Z;  3KIH A;  1YHQ Z;  1ML8 A;  5CM2 M;  1Z01 A;  5IP7 I;  1K8A 1;  1RQF A;  2E7Z A;  3OW2 Z;  2JS4 A;  1Y1V S;  3BG1 B;  2QRD B;  2R7Z I;  2VPY A;  4MH4 A;  1K9M 2;  2OTL 1;  1TWH I;  1VQ7 Z;  1KD1 1;  3NFZ A;  3I56 Z;  4A3D I;  3IR7 A;  3CME 1;  3RZO I;  5IT9 b;  2LFU A;  5D1O B;  1YIT Z;  4AYB A;  2K3R A;  2YU9 I;  1KD1 2;  4NH1 C;  1YI2 Z;  1NJI 2;  4MD7 A;  3HOY I;  4A3F I;  2V45 A;  1VQN 1;  2JR6 A;  3ESW A;  3CPW Y;  3G71 Z;  3GCF A;  3I55 Z;  1S72 1;  3S2H I;  1N8R 1;  3HKZ A;  3I07 A;  3S1M I;  4Y7N I;  3MZL B;  3IFU A;  3CCV 1;  4HGZ A;  3NDI A;  3G4S 1;  1P9N A;  1YJ9 Z;  5FLX b;  2M48 A;  1N2F A;  1KQS Y;  4QTU A;  4TNU A;  4MD9 A;  3NH4 A;  2JA8 I;  1X3Z A;  1LQL A;  1VQM Z;  2W03 A;  3CC2 1;  4E2X A;  3JAM b;  2HF1 A;  4DK1 A;  1YIT 1;  1M90 1;  1TWG I;  1VQ4 Z;  4A3G I;  2JIR A;  4RS4 A;  3CCS Z;  3CCL 1;  2W04 A;  1Y1V I;  1DL6 A;  2O4H A;  3I55 1;  2H85 A;  3VMI A;  2DE7 A;  1USP A;  4NBD A;  1QYP A;  4E31 A;  1KRL A;  1VQ8 1;  1QVG Y;  2NVT I;  1YHQ 1;  1W2B Z;  3G6E Z;  2F4O A;  3GKQ A;  5A2Q f;  3S16 I;  1VQ5 1;  2RHB A;  2QEX Z;  3CCE Z;  1Z02 A;  1K73 2;  4A3C I;  2E2I I;  1Q86 1; 
#chains in the Genus database with same CATH homology
 2OZK A;  2E2H I;  4A93 I;  1PFT A;  2KPI A;  3J7A 4;  2OTL Z;  3BG0 B;  5AN9 F;  1YUK A;  1RNI A;  2BJO A;  2OTJ Z;  4E2Z A;  3I4N I;  1L1O C;  4A3E I;  2QLV B;  4NBF A;  1YJ9 1;  2KI7 B;  1I50 I;  2JA6 I;  1Q82 2;  4E32 A;  1K9M 1;  4MXU A;  3CD6 Z;  3QWU A;  1SFO I;  1W2B Y;  2NVY I;  3CCE 1;  2J6A A;  2WB1 A;  2YAD A;  3HOX I;  1X0T A;  5D1P A;  1KQS Z;  3K7A I;  5C44 I;  3CQZ I;  3CCS 1;  3CCL Z;  4A3J I;  3TDH B;  3RZD I;  3HOV I;  2O53 A;  1YI2 1;  1M90 2;  1VQK 1;  3P5J B;  3CCJ Z;  4MRI A;  1YJW Z;  1YJN Z;  3FQM A;  1YUA A;  5C4J I;  1WII A;  1I6H I;  1TWC I;  2GU2 A;  2OOX B;  1QVG Z;  3CC4 1;  3S17 I;  1WCM I;  4A3I I;  3J81 b;  3GTL I;  1M1K 1;  3GTK I;  1YIJ Z;  1VQ6 Z;  2M6N A;  4HH4 A;  2GTI A;  3I4M I;  5T67 A;  3J81 f;  2E9H A;  2Q51 A;  2GTH A;  4MON A;  2P3Y A;  4CL1 A;  4BXX I;  1YJW 1;  2I3C A;  2QEX 1;  1QVF Z;  3CXC Z;  3H0G I;  1ZB9 A;  3CMA Z;  2RBL A;  2AKL A;  3CCM 1;  3Q87 A;  2JA7 I;  4MD8 A;  5T6B A;  1RO4 A;  3J80 b;  4DQY B;  3GTG I;  5D1O A;  3T4N B;  2LIY A;  3GTO I;  3D9X A;  1R9T I;  3MZK B;  1RLY A;  2VUM I;  3PO2 I;  2EGT A;  1TFI A;  2OOY B;  1N8R 2;  1VLA A;  4A3M I;  2ZAE B;  4RVH A;  2JUB A;  1VQ9 Z;  4S1T A;  1VQM 1;  1VQ7 1;  2QA4 1;  3CMA 1;  2F4M A;  2R92 I;  1QVF Y;  2JMO A;  1ZH1 A;  5C4X I;  4Y52 I;  2R93 I;  3M3Y I;  2QA4 Z;  3J80 f;  3CCM Z;  1TWA I;  2JA5 I;  3KIF A;  3GTM I;  2NVQ I;  2WAQ A;  3S2D I;  4E33 A;  1Q7Y 1;  1M1K 2;  3CC7 Z;  3HOZ I;  2JNY A;  4BBR I;  3TE5 B;  2Q4Z A;  2NVX I;  1VQP 1;  3M4O I;  1NP6 A;  4XX2 A;  3CC4 Z;  4A3K I;  3F3P C;  1S7M A;  5A2Q b;  1YJN 1;  1K73 1;  2QRE B;  1KC8 2;  3CME Z;  1JJ2 Z;  1ZB8 A;  5C3E I;  4NBC A;  3CXC Y;  3GTM S;  2RIQ A;  1NUI A;  2VUG A;  2DE5 A;  3EER A;  4NBE A;  3CC2 Z;  4BY1 I;  3CCR Z;  1RO0 A;  3GTQ I;  2DE6 A;  3CC7 1;  5LL6 f;  2B63 I;  1VQP Z;  2HU9 A;  4DGL A;  3GTJ I;  3U50 C;  3HOU I;  1Q82 1;  5FLX f;  3NDJ A;  3D6W A;  3VB9 A;  2G2K A;  3FQQ A;  3S1N I;  2Y0S A;  3S14 I;  3VMG A;  1NJI 1;  2IZ3 A;  1USP B;  1K83 I;  1X3W A;  4NBH A;  4RV9 A;  3CCU Z;  2V8K A;  1VQO Z;  1WW9 A;  3NH5 A;  3FKI I;  4BY7 I;  3CCR 1;  3S1R I;  1VQ9 1;  1Q7Y 2;  4RVF A;  4A3L I;  3CCV Z;  2IZ4 A;  2RPR A;  1VQO 1;  4NBB A;  3VTN A;  3PO3 I;  2PMZ A;  2QKD A;  3LUS A;  4NBA A;  1Q81 1;  3OW2 Y;  1Z03 A;  5FLM I;  3EED A;  1KC8 1;  1Q86 2;  1RO2 A;  4NOZ A;  1VQ4 1;  1VQL 1;  1QF8 A;  3IF8 A;  3CCU 1;  3G6E 1;  1Q81 2;  3IX0 A;  1VQ8 Z;  1JJ2 Y;  3GTP I;  1TWF I;  4NB8 A;  1VQL Z;  2OTJ 1;  1I3Q I;  3G71 1;  1VQN Z;  2E2J I;  1VQK Z;  4A3B I;  5IP9 I;  3I56 1;  4E30 A;  3NH8 A;  3S15 I;  2V8I A;  5T64 A;  3CCJ 1;  3CD6 1;  3HOW I;  3G4S Z;  4BBS I;  1VQ6 1;  4NFR A;  4NBG A;  2P28 A;  4EWC A;  4RVD A;  2QRC B;  2V8J A;  2VF1 A;  3JAM f;  3CCQ 1;  1Y1W I;  4X6A I;  3VMH A;  5IT9 f;  2R6M A;  1VQ5 Z;  4QTT A;  4E2W A;  1S72 Z;  1YIJ 1;  3H3V J;  4E2Y A;  4NB9 A;  3CCQ Z;  4RVG A;  2PK7 A;  2QR1 B;  3PO3 S;  3F3F C;  2RT9 A;  2K5R A;  1K8A 2;  2PM9 A;  3S1Q I;  4HGY A;  3MON A;  1JWH C;  3CPW Z;  3KIH A;  1YHQ Z;  1ML8 A;  5CM2 M;  1Z01 A;  5IP7 I;  1K8A 1;  1RQF A;  3OW2 Z;  2JS4 A;  1Y1V S;  3BG1 B;  2QRD B;  2R7Z I;  4MH4 A;  2OTL 1;  1K9M 2;  1TWH I;  1VQ7 Z;  1KD1 1;  3NFZ A;  3I56 Z;  4A3D I;  3CME 1;  3RZO I;  5IT9 b;  2LFU A;  5D1O B;  1YIT Z;  4AYB A;  2K3R A;  2YU9 I;  1KD1 2;  4NH1 C;  1YI2 Z;  1NJI 2;  4MD7 A;  3HOY I;  4A3F I;  1VQN 1;  2JR6 A;  3ESW A;  3CPW Y;  3G71 Z;  3GCF A;  3I55 Z;  1S72 1;  3S2H I;  1N8R 1;  3HKZ A;  3I07 A;  3S1M I;  4Y7N I;  3MZL B;  3IFU A;  3CCV 1;  4HGZ A;  3NDI A;  3G4S 1;  1P9N A;  1YJ9 Z;  5FLX b;  2M48 A;  1N2F A;  1KQS Y;  4QTU A;  4TNU A;  4MD9 A;  3NH4 A;  2JA8 I;  1X3Z A;  1LQL A;  1VQM Z;  2W03 A;  3CC2 1;  4E2X A;  3JAM b;  2HF1 A;  4DK1 A;  1YIT 1;  1M90 1;  1TWG I;  1VQ4 Z;  4A3G I;  4RS4 A;  3CCL 1;  3CCS Z;  2W04 A;  1Y1V I;  1DL6 A;  2O4H A;  3I55 1;  2H85 A;  3VMI A;  2DE7 A;  1USP A;  4NBD A;  1QYP A;  4E31 A;  1KRL A;  1VQ8 1;  1QVG Y;  2NVT I;  1YHQ 1;  1W2B Z;  3G6E Z;  2F4O A;  3GKQ A;  5A2Q f;  3S16 I;  1VQ5 1;  2RHB A;  2QEX Z;  3CCE Z;  1Z02 A;  1K73 2;  4A3C I;  2E2I I;  1Q86 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...