2OTLZ

Girodazole bound to the large subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otlZ00
1YJ9Z 3G71Z 3OW2Y 3OW2Z 3I551 2OTL1 1VQN1 3G4S1 1YIJZ 1K8A2 1M902 1YJNZ 1Q7Y1 1Q822 1YIT1 3CCJ1 1VQ81 3I561 3CC71 3G6EZ 1VQ6Z 3CCUZ 3CCE1 3CCV1 1S721 1Q811 1NJI1 1VQ91 3CMEZ 1K9M2 2QEX1 1VQPZ 1YHQZ 1KQSY 3CPWY 1KQSZ 1VQOZ 2OTJZ 3CCS1 1W2BY 1VQKZ 1K731 1KD12 1VQL1 1JJ2Y 1JJ2Z 3CMA1 3CD6Z 2QA4Z 1M1K1 3CCQ1 3CCR1 1VQMZ 1YI21 3CXCY 1VQ41 1Q861 3CXCZ 1YJ91 3G711 2OTJ1 1KC81 3CC4Z 1YJWZ 3CCMZ 1VQ7Z 3CCLZ 1QVFY 1Q7Y2 1QVFZ 3CPWZ 1VQ5Z 1YIJ1 1N8R1 1YJN1 1W2BZ 1Q812 3G6E1 1NJI2 3CC2Z 3I55Z 1VQ61 2OTLZ 3CCU1 1VQNZ 3CME1 3G4SZ 1VQP1 1YHQ1 1QVGY 1QVGZ 1K732 1VQO1 1YITZ 3CCJZ 1VQ8Z 3I56Z 3CC7Z 1K8A1 1VQK1 1M901 1Q821 1M1K2 3CC21 3CCEZ 3CCVZ 1S72Z 1Q862 1VQ9Z 3CD61 2QA41 2QEXZ 1VQM1 1VQ4Z 1KC82 1K9M1 3CCSZ 3CC41 1YJW1 1VQLZ 3CCM1 1VQ71 3CCL1 3CMAZ 1N8R2 1KD11 3CCQZ 3CCRZ 1YI2Z 1VQ51
chains in the Genus database with same CATH superfamily
3NH5A 4A3JI 1TWFI 1VLAA 3I551 1VQN1 4E31A 4MRIA 1Y8CA 2F4MA 2IZ4A 2QLVB 1TFIA 1YIT1 3CCJ1 3BG1B 3I561 3IX0A 3CC71 3IR7A 1VQ6Z 1S721 2B63I 2KI7B 2YADA 3CMEZ 1K9M2 5FLMI 1NP6A 3MONA 4QTTA 4BY7I 1VQKZ 2BJOA 3S2DI 1JJ2Y 3NFZA 3J80f 1QF8A 4NBHA 3CCQ1 2EGTA 3G711 2M6NA 2P3YA 1FDIA 4DK1A 2JA8I 3M3YI 2E2II 1QVFY 5C4JI 1N8R1 2W04A 1WZNA 1YJN1 4A3DI 4E2WA 1W2BZ 2F4OA 3GTQI 3G6E1 1NJI2 1USPB 2OTLZ 2VPZA 1VQP1 1YHQ1 1K732 2VPXA 3JAMb 3EERA 1K8A1 3D2LA 2YU9I 3F3PC 3S1MI 1M1K2 3CC21 3CCVZ 4A3FI 4HGYA 1Q862 1VQ9Z 1S7MA 2OOYB 4A3GI 1SIWA 1KC82 3TE5B 4A93I 2E9HA 1TWAI 1Z02A 5CM2M 2E2JI 3CC41 1YJW1 4RS4A 3FKII 3TDHB 4NFRA 1LQLA 1K83I 2I3CA 5D1OB 3CCL1 2VUMI 1KD11 4A3LI 1VQ4Z 3HOYI 1YJ9Z 2V45A 5C3EI 2GTHA 3M4OI 1X0TA 1X3WA 3OW2Y 3Q87A 2ZAEB 2HF1A 3I4NI 3D6WA 4Y52I 3GCFA 1AA6A 5A2Qb 1YIJZ 2R92I 5T64A 1M902 1Q7Y1 3VTNA 3BG0B 1VQ81 4BBRI 5FLXf 1Q811 4NBBA 1KQSZ 2K5RA 2OTJZ 1DL6A 3HOXI 1RO0A 1W2BY 1SFOI 3S16I 3VMHA 2RIQA 1JWHC 4DQYB 3IF8A 3CD6Z 2QA4Z 2JA7I 2IV2X 4CL1A 1YI21 1VQMZ 4E33A 3CXCY 3RZOI 1Y1VI 3S14I 3FQMA 3S17I 4NBEA 2JA5I 1VQ7Z 4NBDA 2Q4ZA 1NUIA 3VMGA 3CPWZ 2PMZA 1VQ5Z 2O53A 4MH4A 4Y7NI 2WB1A 4BBSI 3GTMI 1QYPA 4S1TA 4A3II 3J81f 3I55Z 5IP7I 3CCU1 1VQNZ 1YUAA 5T67A 3U50C 4NBGA 1RQFA 1QVGY 2V8JA 4NB9A 2R93I 1VQO1 2NVYI 2LEXA 1YITZ 3CCJZ 3S1NI 3I56Z 3CC7Z 1TWHI 1Q821 4NH1C 3NDJA 1S72Z 2G2KA 3GTOI 2GU2A 1RO4A 4NBFA 1TWCI 1TWGI 4RV9A 3J80b 3CCM1 2O4HA 1KRLA 3K7AI 1N8R2 1P9NA 3I07A 1QXFA 3CCQZ 2RPRA 3G71Z 3GTKI 4RVDA 1WIIA 4XX2A 2QRDB 3NH8A 3GTMS 3G4S1 2JIOA 5IT9f 1Z03A 2VF1A 3D9XA 1K8A2 2LFUA 5D1PA 1YJNZ 3T4NB 2AKLA 3G6EZ 2JIPA 3GKQA 4HGZA 5D1OA 2HU9A 1I6HI 3NDIA 3CCE1 4A3BI 4NBAA 2QEX1 4NOZA 1Z01A 4E2YA 1YHQZ 1VQPZ 3CPWY 1PFTA 3CCS1 3F3FC 3P5JB 4AYBA 4RVFA 5A2Qf 1KD12 1VQL1 3HOVI 2Q51A 2QREB 1JJ2Z 4BY1I 3CMA1 3HOZI 3CCR1 3HOWI 4RVHA 2OZKA 2W03A 2OTJ1 5T6BA 3CC4Z 3ESWA 1YJWZ 2K3RA 5C44I 3CCLZ 3PO2I 4MD9A 1Q7Y2 1QVFZ 1ZB8A 4A3KI 3MZKB 2JMOA 1Q812 1WCMI 1VQ61 2J6AA 3S15I 2JS4A 3CME1 4E2ZA 3KIFA 4MD7A 4RVGA 2QR1B 1N2FA 2IZ3A 2JIMA 3H3VJ 2Y0SA 1RLYA 4E2XA 5FLXb 1VQ8Z 1VQK1 2M48A 3QWUA 3GTGI 1R9TI 2AYDA 1K9M1 3NH4A 2V3VA 3CQZI 2NAPA 2PM9A 4BXXI 2QKDA 2RBLA 1YI2Z 3FQQA 5IP9I 3I4MI 2JNYA 5AN9F 3OW2Z 4E32A 2P28A 4MD8A 2OTL1 4E30A 2VUGA 1ZH1A 2GTIA 4X6AI 2NVXI 2KPIA 1Q822 1USPA 1Y1VS 3J81b 1YUKA 4MONA 1WW9A 3EEDA 3JAMf 3CCUZ 3CCV1 1NJI1 1I3QI 1FDOA 1VQ91 2DE5A 1KQSY 1ZB9A 4NBCA 1I50I 1VQOZ 2VPYA 1K731 2QRCB 1X3ZA 2H85A 1Q16A 2LIYA 1M1K1 2JA6I 4A3MI 1VQ41 1Q861 3CXCZ 2WAQA 1YJ91 3GTLI 3J7A4 4NB8A 1KC81 4EWCA 2JIRA 3IFUA 3PO3I 3CCMZ 2V8IA 2RHBA 3H0GI 3LUSA 3GTPI 2R7ZI 4A3CI 4A3EI 2PK7A 3HKZA 4QTUA 1YIJ1 2VPWA 2OOXB 3S1QI 3KIHA 3MZLB 1ML8A 5LL6f 2V8KA 3RZDI 3CC2Z 4TNUA 5C4XI 5IT9b 2DE6A 3G4SZ 2RT9A 2JIQA 1L1OC 2JR6A 2JUBA 2R6MA 2NVQI 1QVGZ 1RNIA 4MXUA 3VMIA 4DGLA 1M901 3CCEZ 2E2HI 1Y1WI 1WJ2A 3CD61 2QA41 2QEXZ 2E7ZA 2NVTI 1VQM1 1RO2A 3VB9A 3CCSZ 3S1RI 3HOUI 2DE7A 1VQLZ 1VQ71 3S2HI 3PO3S 3CMAZ 3GTJI 3CCRZ 4HH4A 1VQ51
chains in the Genus database with same CATH topology
3NH5A 4A3JI 1TWFI 1VLAA 3I551 1VQN1 4E31A 4MRIA 2F4MA 2IZ4A 2QLVB 1TFIA 1YIT1 3CCJ1 3BG1B 3I561 3IX0A 3CC71 1VQ6Z 1S721 2B63I 2KI7B 2YADA 3CMEZ 1K9M2 5FLMI 1NP6A 3MONA 4QTTA 4BY7I 1VQKZ 2BJOA 3S2DI 1JJ2Y 3NFZA 3J80f 1QF8A 4NBHA 3CCQ1 2EGTA 3G711 2M6NA 2P3YA 4DK1A 2JA8I 3M3YI 2E2II 1QVFY 5C4JI 1N8R1 2W04A 1YJN1 4A3DI 4E2WA 1W2BZ 2F4OA 3GTQI 3G6E1 1NJI2 1USPB 2OTLZ 1VQP1 1YHQ1 1K732 3JAMb 3EERA 1K8A1 2YU9I 3F3PC 3S1MI 1M1K2 3CC21 3CCVZ 4A3FI 4HGYA 1Q862 1VQ9Z 1S7MA 2OOYB 4A3GI 1KC82 3TE5B 4A93I 2E9HA 1TWAI 1Z02A 5CM2M 2E2JI 3CC41 1YJW1 4RS4A 3FKII 3TDHB 4NFRA 1LQLA 1K83I 2I3CA 5D1OB 3CCL1 2VUMI 1KD11 4A3LI 1VQ4Z 3HOYI 1YJ9Z 5C3EI 2GTHA 3M4OI 1X0TA 1X3WA 3OW2Y 3Q87A 2ZAEB 2HF1A 3I4NI 3D6WA 4Y52I 3GCFA 5A2Qb 1YIJZ 2R92I 5T64A 1M902 1Q7Y1 3VTNA 3BG0B 1VQ81 4BBRI 5FLXf 1Q811 4NBBA 1KQSZ 2K5RA 2OTJZ 1DL6A 3HOXI 1RO0A 1W2BY 1SFOI 3S16I 3VMHA 2RIQA 1JWHC 4DQYB 3IF8A 3CD6Z 2QA4Z 2JA7I 4CL1A 1YI21 1VQMZ 4E33A 3CXCY 3RZOI 1Y1VI 3S14I 3FQMA 3S17I 4NBEA 2JA5I 1VQ7Z 4NBDA 2Q4ZA 1NUIA 3VMGA 3CPWZ 2PMZA 1VQ5Z 2O53A 4MH4A 4Y7NI 2WB1A 4BBSI 3GTMI 1QYPA 4S1TA 4A3II 3J81f 3I55Z 5IP7I 3CCU1 1VQNZ 1YUAA 5T67A 3U50C 4NBGA 1RQFA 1QVGY 2V8JA 4NB9A 2R93I 1VQO1 2NVYI 1YITZ 3CCJZ 3S1NI 3I56Z 3CC7Z 1TWHI 1Q821 4NH1C 3NDJA 1S72Z 2G2KA 3GTOI 2GU2A 1RO4A 4NBFA 1TWCI 1TWGI 4RV9A 3J80b 3CCM1 2O4HA 1KRLA 3K7AI 1N8R2 1P9NA 3I07A 3CCQZ 2RPRA 3G71Z 3GTKI 4RVDA 1WIIA 4XX2A 2QRDB 3NH8A 3GTMS 3G4S1 5IT9f 1Z03A 2VF1A 3D9XA 1K8A2 2LFUA 5D1PA 1YJNZ 3T4NB 2AKLA 3G6EZ 3GKQA 4HGZA 5D1OA 2HU9A 1I6HI 3NDIA 3CCE1 4A3BI 4NBAA 2QEX1 4NOZA 1Z01A 4E2YA 1YHQZ 1VQPZ 3CPWY 1PFTA 3CCS1 3F3FC 3P5JB 4AYBA 4RVFA 5A2Qf 1KD12 1VQL1 3HOVI 2Q51A 2QREB 1JJ2Z 4BY1I 3CMA1 3HOZI 3CCR1 3HOWI 4RVHA 2OZKA 2W03A 2OTJ1 5T6BA 3CC4Z 3ESWA 1YJWZ 2K3RA 5C44I 3CCLZ 3PO2I 4MD9A 1Q7Y2 1QVFZ 1ZB8A 4A3KI 3MZKB 2JMOA 1Q812 1WCMI 1VQ61 2J6AA 3S15I 2JS4A 3CME1 3KIFA 4MD7A 4E2ZA 4RVGA 2QR1B 1N2FA 2IZ3A 3H3VJ 2Y0SA 1RLYA 4E2XA 5FLXb 1VQ8Z 1VQK1 2M48A 3QWUA 3GTGI 1R9TI 1K9M1 3NH4A 3CQZI 2PM9A 4BXXI 2QKDA 2RBLA 1YI2Z 3FQQA 5IP9I 3I4MI 2JNYA 5AN9F 3OW2Z 4E32A 2P28A 4MD8A 2OTL1 4E30A 2VUGA 1ZH1A 2GTIA 4X6AI 2NVXI 2KPIA 1Q822 1USPA 1Y1VS 3J81b 1YUKA 4MONA 1WW9A 3EEDA 3JAMf 3CCUZ 3CCV1 1NJI1 1I3QI 1VQ91 2DE5A 1KQSY 1ZB9A 4NBCA 1I50I 1VQOZ 1K731 2QRCB 1X3ZA 2H85A 2LIYA 1M1K1 2JA6I 4A3MI 1VQ41 1Q861 3CXCZ 2WAQA 1YJ91 3GTLI 3J7A4 4NB8A 1KC81 4EWCA 3IFUA 3PO3I 3CCMZ 2V8IA 2RHBA 3H0GI 3LUSA 3GTPI 2R7ZI 4A3CI 4A3EI 2PK7A 3HKZA 4QTUA 1YIJ1 2OOXB 3S1QI 3KIHA 3MZLB 1ML8A 5LL6f 2V8KA 3RZDI 3CC2Z 4TNUA 5C4XI 5IT9b 2DE6A 3G4SZ 2RT9A 1L1OC 2JR6A 2JUBA 2R6MA 2NVQI 1QVGZ 1RNIA 4MXUA 3VMIA 4DGLA 1M901 3CCEZ 2E2HI 1Y1WI 3CD61 2QA41 2QEXZ 2NVTI 1VQM1 1RO2A 3VB9A 3CCSZ 3S1RI 3HOUI 2DE7A 1VQLZ 1VQ71 3S2HI 3PO3S 3CMAZ 3GTJI 3CCRZ 4HH4A 1VQ51
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 Z;  3G71 Z;  3OW2 Y;  3OW2 Z;  3I55 1;  2OTL 1;  1VQN 1;  3G4S 1;  1YIJ Z;  1K8A 2;  1M90 2;  1YJN Z;  1Q7Y 1;  1Q82 2;  1YIT 1;  3CCJ 1;  1VQ8 1;  3I56 1;  3CC7 1;  3G6E Z;  1VQ6 Z;  3CCU Z;  3CCE 1;  3CCV 1;  1S72 1;  1Q81 1;  1NJI 1;  1VQ9 1;  3CME Z;  1K9M 2;  2QEX 1;  1VQP Z;  1YHQ Z;  1KQS Y;  3CPW Y;  1KQS Z;  1VQO Z;  2OTJ Z;  3CCS 1;  1W2B Y;  1VQK Z;  1K73 1;  1KD1 2;  1VQL 1;  1JJ2 Y;  1JJ2 Z;  3CMA 1;  3CD6 Z;  2QA4 Z;  1M1K 1;  3CCQ 1;  3CCR 1;  1VQM Z;  1YI2 1;  3CXC Y;  1VQ4 1;  1Q86 1;  3CXC Z;  1YJ9 1;  3G71 1;  2OTJ 1;  1KC8 1;  3CC4 Z;  1YJW Z;  3CCM Z;  1VQ7 Z;  3CCL Z;  1QVF Y;  1Q7Y 2;  1QVF Z;  3CPW Z;  1VQ5 Z;  1YIJ 1;  1N8R 1;  1YJN 1;  1W2B Z;  1Q81 2;  3G6E 1;  1NJI 2;  3CC2 Z;  3I55 Z;  1VQ6 1;  2OTL Z;  3CCU 1;  1VQN Z;  3CME 1;  3G4S Z;  1VQP 1;  1YHQ 1;  1QVG Y;  1QVG Z;  1K73 2;  1VQO 1;  1YIT Z;  3CCJ Z;  1VQ8 Z;  3I56 Z;  3CC7 Z;  1K8A 1;  1VQK 1;  1M90 1;  1Q82 1;  1M1K 2;  3CC2 1;  3CCE Z;  3CCV Z;  1S72 Z;  1Q86 2;  1VQ9 Z;  3CD6 1;  2QA4 1;  2QEX Z;  1VQM 1;  1VQ4 Z;  1KC8 2;  1K9M 1;  3CCS Z;  3CC4 1;  1YJW 1;  1VQL Z;  3CCM 1;  1VQ7 1;  3CCL 1;  3CMA Z;  1N8R 2;  1KD1 1;  3CCQ Z;  3CCR Z;  1YI2 Z;  1VQ5 1; 
#chains in the Genus database with same CATH topology
 3NH5 A;  4A3J I;  1TWF I;  1VLA A;  3I55 1;  1VQN 1;  4E31 A;  4MRI A;  1Y8C A;  2F4M A;  2IZ4 A;  2QLV B;  1TFI A;  1YIT 1;  3CCJ 1;  3BG1 B;  3I56 1;  3IX0 A;  3CC7 1;  3IR7 A;  1VQ6 Z;  1S72 1;  2B63 I;  2KI7 B;  2YAD A;  3CME Z;  1K9M 2;  5FLM I;  1NP6 A;  3MON A;  4QTT A;  4BY7 I;  1VQK Z;  2BJO A;  3S2D I;  1JJ2 Y;  3NFZ A;  3J80 f;  1QF8 A;  4NBH A;  3CCQ 1;  2EGT A;  3G71 1;  2M6N A;  2P3Y A;  1FDI A;  4DK1 A;  2JA8 I;  3M3Y I;  2E2I I;  1QVF Y;  5C4J I;  1N8R 1;  2W04 A;  1WZN A;  1YJN 1;  4A3D I;  4E2W A;  1W2B Z;  2F4O A;  3GTQ I;  3G6E 1;  1NJI 2;  1USP B;  2OTL Z;  2VPZ A;  1VQP 1;  1YHQ 1;  1K73 2;  2VPX A;  3JAM b;  3EER A;  1K8A 1;  3D2L A;  2YU9 I;  3F3P C;  3S1M I;  1M1K 2;  3CC2 1;  3CCV Z;  4A3F I;  4HGY A;  1Q86 2;  1VQ9 Z;  1S7M A;  2OOY B;  4A3G I;  1SIW A;  1KC8 2;  3TE5 B;  4A93 I;  2E9H A;  1TWA I;  1Z02 A;  5CM2 M;  2E2J I;  3CC4 1;  1YJW 1;  4RS4 A;  3FKI I;  3TDH B;  4NFR A;  1LQL A;  1K83 I;  2I3C A;  5D1O B;  3CCL 1;  2VUM I;  1KD1 1;  4A3L I;  1VQ4 Z;  3HOY I;  1YJ9 Z;  2V45 A;  5C3E I;  2GTH A;  3M4O I;  1X0T A;  1X3W A;  3OW2 Y;  3Q87 A;  2ZAE B;  2HF1 A;  3I4N I;  3D6W A;  4Y52 I;  3GCF A;  1AA6 A;  5A2Q b;  1YIJ Z;  2R92 I;  5T64 A;  1M90 2;  1Q7Y 1;  3VTN A;  3BG0 B;  1VQ8 1;  4BBR I;  5FLX f;  1Q81 1;  4NBB A;  1KQS Z;  2K5R A;  2OTJ Z;  1DL6 A;  3HOX I;  1RO0 A;  1W2B Y;  1SFO I;  3S16 I;  3VMH A;  2RIQ A;  1JWH C;  4DQY B;  3IF8 A;  3CD6 Z;  2QA4 Z;  2JA7 I;  2IV2 X;  4CL1 A;  1YI2 1;  1VQM Z;  4E33 A;  3CXC Y;  3RZO I;  1Y1V I;  3S14 I;  3FQM A;  3S17 I;  4NBE A;  2JA5 I;  1VQ7 Z;  4NBD A;  2Q4Z A;  1NUI A;  3VMG A;  3CPW Z;  2PMZ A;  1VQ5 Z;  2O53 A;  4MH4 A;  4Y7N I;  2WB1 A;  4BBS I;  3GTM I;  1QYP A;  4S1T A;  4A3I I;  3J81 f;  3I55 Z;  5IP7 I;  3CCU 1;  1VQN Z;  1YUA A;  5T67 A;  3U50 C;  4NBG A;  1RQF A;  1QVG Y;  2V8J A;  4NB9 A;  2R93 I;  1VQO 1;  2NVY I;  2LEX A;  1YIT Z;  3CCJ Z;  3S1N I;  3I56 Z;  3CC7 Z;  1TWH I;  1Q82 1;  4NH1 C;  3NDJ A;  1S72 Z;  2G2K A;  3GTO I;  2GU2 A;  1RO4 A;  4NBF A;  1TWC I;  1TWG I;  4RV9 A;  3J80 b;  3CCM 1;  2O4H A;  1KRL A;  3K7A I;  1N8R 2;  1P9N A;  3I07 A;  1QXF A;  3CCQ Z;  2RPR A;  3G71 Z;  3GTK I;  4RVD A;  1WII A;  4XX2 A;  2QRD B;  3NH8 A;  3GTM S;  3G4S 1;  2JIO A;  5IT9 f;  1Z03 A;  2VF1 A;  3D9X A;  1K8A 2;  2LFU A;  5D1P A;  1YJN Z;  3T4N B;  2AKL A;  3G6E Z;  2JIP A;  3GKQ A;  4HGZ A;  5D1O A;  2HU9 A;  1I6H I;  3NDI A;  3CCE 1;  4A3B I;  4NBA A;  2QEX 1;  4NOZ A;  1Z01 A;  4E2Y A;  1YHQ Z;  1VQP Z;  3CPW Y;  1PFT A;  3CCS 1;  3F3F C;  3P5J B;  4AYB A;  4RVF A;  5A2Q f;  1KD1 2;  1VQL 1;  3HOV I;  2Q51 A;  2QRE B;  1JJ2 Z;  4BY1 I;  3CMA 1;  3HOZ I;  3CCR 1;  3HOW I;  4RVH A;  2OZK A;  2W03 A;  2OTJ 1;  5T6B A;  3CC4 Z;  3ESW A;  1YJW Z;  2K3R A;  5C44 I;  3CCL Z;  3PO2 I;  4MD9 A;  1Q7Y 2;  1QVF Z;  1ZB8 A;  4A3K I;  3MZK B;  2JMO A;  1Q81 2;  1WCM I;  1VQ6 1;  2J6A A;  3S15 I;  2JS4 A;  3CME 1;  4E2Z A;  3KIF A;  4MD7 A;  4RVG A;  2QR1 B;  1N2F A;  2IZ3 A;  2JIM A;  3H3V J;  2Y0S A;  1RLY A;  4E2X A;  5FLX b;  1VQ8 Z;  1VQK 1;  2M48 A;  3QWU A;  3GTG I;  1R9T I;  2AYD A;  1K9M 1;  3NH4 A;  2V3V A;  3CQZ I;  2NAP A;  2PM9 A;  4BXX I;  2QKD A;  2RBL A;  1YI2 Z;  3FQQ A;  5IP9 I;  3I4M I;  2JNY A;  5AN9 F;  3OW2 Z;  4E32 A;  2P28 A;  4MD8 A;  2OTL 1;  4E30 A;  2VUG A;  1ZH1 A;  2GTI A;  4X6A I;  2NVX I;  2KPI A;  1Q82 2;  1USP A;  1Y1V S;  3J81 b;  1YUK A;  4MON A;  1WW9 A;  3EED A;  3JAM f;  3CCU Z;  3CCV 1;  1NJI 1;  1I3Q I;  1FDO A;  1VQ9 1;  2DE5 A;  1KQS Y;  1ZB9 A;  4NBC A;  1I50 I;  1VQO Z;  2VPY A;  1K73 1;  2QRC B;  1X3Z A;  2H85 A;  1Q16 A;  2LIY A;  1M1K 1;  2JA6 I;  4A3M I;  1VQ4 1;  1Q86 1;  3CXC Z;  2WAQ A;  1YJ9 1;  3GTL I;  3J7A 4;  4NB8 A;  1KC8 1;  4EWC A;  2JIR A;  3IFU A;  3PO3 I;  3CCM Z;  2V8I A;  2RHB A;  3H0G I;  3LUS A;  3GTP I;  2R7Z I;  4A3C I;  4A3E I;  2PK7 A;  3HKZ A;  4QTU A;  1YIJ 1;  2VPW A;  2OOX B;  3S1Q I;  3KIH A;  3MZL B;  1ML8 A;  5LL6 f;  2V8K A;  3RZD I;  3CC2 Z;  4TNU A;  5C4X I;  5IT9 b;  2DE6 A;  3G4S Z;  2RT9 A;  2JIQ A;  1L1O C;  2JR6 A;  2JUB A;  2R6M A;  2NVQ I;  1QVG Z;  1RNI A;  4MXU A;  3VMI A;  4DGL A;  1M90 1;  3CCE Z;  2E2H I;  1Y1W I;  1WJ2 A;  3CD6 1;  2QA4 1;  2QEX Z;  2E7Z A;  2NVT I;  1VQM 1;  1RO2 A;  3VB9 A;  3CCS Z;  3S1R I;  3HOU I;  2DE7 A;  1VQL Z;  1VQ7 1;  3S2H I;  3PO3 S;  3CMA Z;  3GTJ I;  3CCR Z;  4HH4 A;  1VQ5 1; 
#chains in the Genus database with same CATH homology
 3NH5 A;  4A3J I;  1TWF I;  1VLA A;  3I55 1;  1VQN 1;  4E31 A;  4MRI A;  2F4M A;  2IZ4 A;  2QLV B;  1TFI A;  1YIT 1;  3CCJ 1;  3BG1 B;  3I56 1;  3IX0 A;  3CC7 1;  1VQ6 Z;  1S72 1;  2B63 I;  2KI7 B;  2YAD A;  3CME Z;  1K9M 2;  5FLM I;  1NP6 A;  3MON A;  4QTT A;  4BY7 I;  1VQK Z;  2BJO A;  3S2D I;  1JJ2 Y;  3NFZ A;  3J80 f;  1QF8 A;  4NBH A;  3CCQ 1;  2EGT A;  3G71 1;  2M6N A;  2P3Y A;  4DK1 A;  2JA8 I;  3M3Y I;  2E2I I;  1QVF Y;  5C4J I;  1N8R 1;  2W04 A;  1YJN 1;  4A3D I;  4E2W A;  1W2B Z;  2F4O A;  3GTQ I;  3G6E 1;  1NJI 2;  1USP B;  2OTL Z;  1VQP 1;  1YHQ 1;  1K73 2;  3JAM b;  3EER A;  1K8A 1;  2YU9 I;  3F3P C;  3S1M I;  1M1K 2;  3CC2 1;  3CCV Z;  4A3F I;  4HGY A;  1Q86 2;  1VQ9 Z;  1S7M A;  2OOY B;  4A3G I;  1KC8 2;  3TE5 B;  4A93 I;  2E9H A;  1TWA I;  1Z02 A;  5CM2 M;  2E2J I;  3CC4 1;  1YJW 1;  4RS4 A;  3FKI I;  3TDH B;  4NFR A;  1LQL A;  1K83 I;  2I3C A;  5D1O B;  3CCL 1;  2VUM I;  1KD1 1;  4A3L I;  1VQ4 Z;  3HOY I;  1YJ9 Z;  5C3E I;  2GTH A;  3M4O I;  1X0T A;  1X3W A;  3OW2 Y;  3Q87 A;  2ZAE B;  2HF1 A;  3I4N I;  3D6W A;  4Y52 I;  3GCF A;  5A2Q b;  1YIJ Z;  2R92 I;  5T64 A;  1M90 2;  1Q7Y 1;  3VTN A;  3BG0 B;  1VQ8 1;  4BBR I;  5FLX f;  1Q81 1;  4NBB A;  1KQS Z;  2K5R A;  2OTJ Z;  1DL6 A;  3HOX I;  1RO0 A;  1W2B Y;  1SFO I;  3S16 I;  3VMH A;  2RIQ A;  1JWH C;  4DQY B;  3IF8 A;  3CD6 Z;  2QA4 Z;  2JA7 I;  4CL1 A;  1YI2 1;  1VQM Z;  4E33 A;  3CXC Y;  3RZO I;  1Y1V I;  3S14 I;  3FQM A;  3S17 I;  4NBE A;  2JA5 I;  1VQ7 Z;  4NBD A;  2Q4Z A;  1NUI A;  3VMG A;  3CPW Z;  2PMZ A;  1VQ5 Z;  2O53 A;  4MH4 A;  4Y7N I;  2WB1 A;  4BBS I;  3GTM I;  1QYP A;  4S1T A;  4A3I I;  3J81 f;  3I55 Z;  5IP7 I;  3CCU 1;  1VQN Z;  1YUA A;  5T67 A;  3U50 C;  4NBG A;  1RQF A;  1QVG Y;  2V8J A;  4NB9 A;  2R93 I;  1VQO 1;  2NVY I;  1YIT Z;  3CCJ Z;  3S1N I;  3I56 Z;  3CC7 Z;  1TWH I;  1Q82 1;  4NH1 C;  3NDJ A;  1S72 Z;  2G2K A;  3GTO I;  2GU2 A;  1RO4 A;  4NBF A;  1TWC I;  1TWG I;  4RV9 A;  3J80 b;  3CCM 1;  2O4H A;  1KRL A;  3K7A I;  1N8R 2;  1P9N A;  3I07 A;  3CCQ Z;  2RPR A;  3G71 Z;  3GTK I;  4RVD A;  1WII A;  4XX2 A;  2QRD B;  3NH8 A;  3GTM S;  3G4S 1;  5IT9 f;  1Z03 A;  2VF1 A;  3D9X A;  1K8A 2;  2LFU A;  5D1P A;  1YJN Z;  3T4N B;  2AKL A;  3G6E Z;  3GKQ A;  4HGZ A;  5D1O A;  2HU9 A;  1I6H I;  3NDI A;  3CCE 1;  4A3B I;  4NBA A;  2QEX 1;  4NOZ A;  1Z01 A;  4E2Y A;  1YHQ Z;  1VQP Z;  3CPW Y;  1PFT A;  3CCS 1;  3F3F C;  3P5J B;  4AYB A;  4RVF A;  5A2Q f;  1KD1 2;  1VQL 1;  3HOV I;  2Q51 A;  2QRE B;  1JJ2 Z;  4BY1 I;  3CMA 1;  3HOZ I;  3CCR 1;  3HOW I;  4RVH A;  2OZK A;  2W03 A;  2OTJ 1;  5T6B A;  3CC4 Z;  3ESW A;  1YJW Z;  2K3R A;  5C44 I;  3CCL Z;  3PO2 I;  4MD9 A;  1Q7Y 2;  1QVF Z;  1ZB8 A;  4A3K I;  3MZK B;  2JMO A;  1Q81 2;  1WCM I;  1VQ6 1;  2J6A A;  3S15 I;  2JS4 A;  3CME 1;  3KIF A;  4MD7 A;  4E2Z A;  4RVG A;  2QR1 B;  1N2F A;  2IZ3 A;  3H3V J;  2Y0S A;  1RLY A;  4E2X A;  5FLX b;  1VQ8 Z;  1VQK 1;  2M48 A;  3QWU A;  3GTG I;  1R9T I;  1K9M 1;  3NH4 A;  3CQZ I;  2PM9 A;  4BXX I;  2QKD A;  2RBL A;  1YI2 Z;  3FQQ A;  5IP9 I;  3I4M I;  2JNY A;  5AN9 F;  3OW2 Z;  4E32 A;  2P28 A;  4MD8 A;  2OTL 1;  4E30 A;  2VUG A;  1ZH1 A;  2GTI A;  4X6A I;  2NVX I;  2KPI A;  1Q82 2;  1USP A;  1Y1V S;  3J81 b;  1YUK A;  4MON A;  1WW9 A;  3EED A;  3JAM f;  3CCU Z;  3CCV 1;  1NJI 1;  1I3Q I;  1VQ9 1;  2DE5 A;  1KQS Y;  1ZB9 A;  4NBC A;  1I50 I;  1VQO Z;  1K73 1;  2QRC B;  1X3Z A;  2H85 A;  2LIY A;  1M1K 1;  2JA6 I;  4A3M I;  1VQ4 1;  1Q86 1;  3CXC Z;  2WAQ A;  1YJ9 1;  3GTL I;  3J7A 4;  4NB8 A;  1KC8 1;  4EWC A;  3IFU A;  3PO3 I;  3CCM Z;  2V8I A;  2RHB A;  3H0G I;  3LUS A;  3GTP I;  2R7Z I;  4A3C I;  4A3E I;  2PK7 A;  3HKZ A;  4QTU A;  1YIJ 1;  2OOX B;  3S1Q I;  3KIH A;  3MZL B;  1ML8 A;  5LL6 f;  2V8K A;  3RZD I;  3CC2 Z;  4TNU A;  5C4X I;  5IT9 b;  2DE6 A;  3G4S Z;  2RT9 A;  1L1O C;  2JR6 A;  2JUB A;  2R6M A;  2NVQ I;  1QVG Z;  1RNI A;  4MXU A;  3VMI A;  4DGL A;  1M90 1;  3CCE Z;  2E2H I;  1Y1W I;  3CD6 1;  2QA4 1;  2QEX Z;  2NVT I;  1VQM 1;  1RO2 A;  3VB9 A;  3CCS Z;  3S1R I;  3HOU I;  2DE7 A;  1VQL Z;  1VQ7 1;  3S2H I;  3PO3 S;  3CMA Z;  3GTJ I;  3CCR Z;  4HH4 A;  1VQ5 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...