3CXCY

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cxcY00
3CMEZ 1YIJ1 1W2BY 1VQP1 1K9M2 3CCJZ 1YJNZ 3CXCY 1QVGZ 1VQL1 1YJW1 1VQK1 1YITZ 3CCQ1 2QA4Z 1VQPZ 1N8R1 3CC2Z 1QVFZ 3CCJ1 1YJN1 2OTL1 3CCRZ 1VQMZ 1S72Z 3CCM1 1VQKZ 1YIT1 1Q862 3CCQZ 3I55Z 1KQSZ 3CC4Z 1Q822 2QEXZ 3CC7Z 3CCU1 1NJI2 3G6E1 1QVGY 2OTLZ 2OTJZ 3CXCZ 3CCR1 3I551 1W2BZ 1K732 1M1K1 1JJ2Y 1KC82 1VQ4Z 1VQN1 1YJWZ 3CCV1 3CCEZ 3CCS1 1YHQZ 1M902 1Q812 1JJ2Z 1VQ51 1Q7Y1 1VQ41 1VQNZ 1YI2Z 3CCMZ 1YJ91 1VQ81 1VQ7Z 1M901 3CCE1 3CCSZ 1YHQ1 3G6EZ 1VQOZ 2OTJ1 1YI21 1K9M1 3G4S1 1YJ9Z 3CMA1 1VQ8Z 3G711 3OW2Z 1QVFY 1N8R2 1Q861 3CCVZ 1K8A2 3G4SZ 3CD61 3G71Z 1NJI1 3OW2Y 3CCL1 1VQ5Z 1K8A1 1VQ9Z 1Q821 1M1K2 3I56Z 1VQ71 3CPWZ 1KC81 2QA41 1KQSY 3CCLZ 1KD11 1VQO1 3CC21 1VQ91 1K731 1VQ6Z 3CMAZ 3I561 1VQM1 1S721 3CME1 1YIJZ 1KD12 3CC41 2QEX1 3CCUZ 3CC71 1VQ61 3CD6Z 1Q811 1VQLZ 3CPWY 1Q7Y2
chains in the Genus database with same CATH superfamily
3IFUA 3P5JB 2NVYI 3CCJZ 3HOUI 1VQL1 1YJW1 4A3LI 2B63I 5T64A 3CCQ1 2QA4Z 1N8R1 3QWUA 3CCJ1 3JAMb 1S72Z 2JA6I 3CCQZ 3I55Z 1KQSZ 3GTJI 2QRCB 1Q822 2OTLZ 3J81b 4NH1C 3HOZI 2QRDB 2VPXA 3HOYI 1VQ4Z 2R93I 2KI7B 5C4JI 5T67A 2RHBA 3GTKI 3I4NI 1L1OC 2AKLA 1FDIA 3CCS1 1USPA 1PFTA 1JJ2Z 2JS4A 2JUBA 2PM9A 3FQMA 1VQ51 1Q7Y1 3BG0B 5IT9b 3VMGA 2JA8I 2Q4ZA 2QLVB 2IV2X 3CCE1 3RZDI 2ZAEB 3NDJA 5LL6f 2GTIA 1YI21 3IF8A 1K9M1 1Z03A 1VQ8Z 3G711 1VLAA 4A3II 4S1TA 4NFRA 1ML8A 2Q51A 3GTGI 2R92I 3J81f 2IZ4A 1K8A2 3TDHB 3G4SZ 3CD61 3I4MI 2QREB 3GTQI 3OW2Y 3D9XA 2K5RA 3KIHA 3HKZA 1K8A1 3JAMf 3HOWI 4NBFA 3I56Z 1VQ71 3S14I 1TWAI 3CCLZ 3CC21 1VQ91 2E9HA 1Y8CA 1VQ6Z 3CMAZ 1VQM1 4MD8A 1WIIA 1WZNA 2VF1A 3CME1 3CC41 2DE5A 3CCUZ 3RZOI 1VQLZ 4A3JI 4NBAA 3NFZA 4RVDA 3CMEZ 3K7AI 4MH4A 5D1OA 1WW9A 1FDOA 3J7A4 2OOYB 4MRIA 1YITZ 1S7MA 2O4HA 1VQPZ 3CC2Z 3ESWA 2JA7I 2E2HI 1QVFZ 2RBLA 3S1NI 5FLXf 4BXXI 3NH5A 3CCRZ 3S1RI 3CCM1 1YIT1 3GTLI 2LFUA 3GCFA 1AA6A 5A2Qb 2LEXA 2OTJZ 3D2LA 1YUKA 2O53A 3H0GI 1K732 1M1K1 3J80b 4HGYA 1VQN1 4MONA 3CCV1 1Y1VS 2DE6A 1TWHI 3M4OI 1WJ2A 1Z01A 2NVQI 1RO2A 1Q812 2E2JI 3PO3S 5C4XI 1VQ41 1VQNZ 2VPWA 3NH8A 4RS4A 1YJ91 3IR7A 1YHQ1 2VPZA 1VQOZ 2AYDA 2GU2A 2E2II 2KPIA 3OW2Z 2J6AA 4QTUA 4Y7NI 2W04A 1WCMI 1Q861 3S15I 2V8JA 2F4OA 1NP6A 4TNUA 2I3CA 1USPB 1NJI1 4A3GI 1VQ5Z 4AYBA 2GTHA 2JIMA 1VQ9Z 4A93I 2W03A 1Q16A 4QTTA 4RVFA 4HGZA 3CPWZ 2HF1A 5A2Qf 4E33A 1ZH1A 3M3YI 2F4MA 3GTOI 4E32A 4E30A 4MXUA 4A3EI 4BBRI 4X6AI 3CC71 4E31A 3CD6Z 1ZB9A 4NB8A 5IP7I 1Q7Y2 2R7ZI 3VMIA 1RO0A 1VQP1 1K9M2 4E2YA 4XX2A 2Y0SA 5FLXb 1YJNZ 1JWHC 4E2ZA 1I3QI 2PK7A 1R9TI 1YJN1 4HH4A 4DGLA 4RVHA 2OTL1 3HOVI 1VQMZ 2BJOA 2WAQA 1N2FA 2RIQA 3CC4Z 3MZLB 4A3KI 2K3RA 2QEXZ 3CC7Z 2RT9A 1Y1WI 2YU9I 1NJI2 2M48A 3G6E1 1QVGY 3CCR1 4BY1I 1W2BZ 4EWCA 1X0TA 2YADA 2OOXB 3PO2I 1SFOI 1KC82 4A3BI 2P3YA 2QKDA 5D1PA 3CCEZ 1YHQZ 2JMOA 1YI2Z 1QF8A 3CCMZ 2R6MA 4BBSI 1VQ81 3NDIA 1RO4A 1TWGI 2OTJ1 4A3FI 3FQQA 3NH4A 3CMA1 5CM2M 3S17I 5FLMI 3Q87A 1N8R2 3CCVZ 2EGTA 3D6WA 1KRLA 1YUAA 4NB9A 4A3MI 3CCL1 2JIOA 4RV9A 2JR6A 1K83I 3MONA 1RQFA 1M1K2 2VPYA 1TWCI 1KD11 4E2WA 4A3CI 1RLYA 2PMZA 3CQZI 3LUSA 1S721 1YIJZ 3S1MI 2V45A 4CL1A 1VQ61 2P28A 3CPWY 2NVXI 3S2HI 2IZ3A 1YIJ1 1W2BY 3T4NB 3GTMS 3CXCY 2JA5I 3MZKB 1QVGZ 1QXFA 2QR1B 1VQK1 1NUIA 4NBEA 2DE7A 5C3EI 1VQKZ 1Q862 4MD7A 4DK1A 3CCU1 4NBBA 3GTPI 1QYPA 3CXCZ 1P9NA 3GKQA 4NBCA 3I551 4A3DI 3F3PC 3HOXI 1JJ2Y 2NAPA 5IT9f 2JNYA 3VMHA 1YJWZ 2NVTI 5IP9I 5AN9F 3FKII 1M902 2V3VA 1I50I 1TWFI 1RNIA 3S16I 2V8KA 4Y52I 3PO3I 2JIQA 2JIRA 2G2KA 4NOZA 1VQ7Z 1M901 1Y1VI 3CCSZ 4E2XA 4NBDA 3G6EZ 3BG1B 1SIWA 3G4S1 1YJ9Z 1I6HI 3H3VJ 3TE5B 3J80f 1X3WA 4DQYB 4NBHA 4RVGA 2VUMI 4NBGA 1QVFY 2LIYA 5C44I 2RPRA 1LQLA 3VB9A 3G71Z 3KIFA 2WB1A 1TFIA 5D1OB 3IX0A 2V8IA 1Q821 1Z02A 5T6BA 3EEDA 3U50C 2JIPA 1KC81 3S2DI 1X3ZA 2QA41 1KQSY 1VQO1 3S1QI 3EERA 3VTNA 1K731 3F3FC 4BY7I 2VUGA 3GTMI 3I561 1ZB8A 2E7ZA 1KD12 2HU9A 1DL6A 2OZKA 2QEX1 2M6NA 3I07A 1Q811 4MD9A 2H85A
chains in the Genus database with same CATH topology
3IFUA 3P5JB 2NVYI 3CCJZ 3HOUI 1VQL1 1YJW1 4A3LI 2B63I 5T64A 3CCQ1 2QA4Z 1N8R1 3QWUA 3CCJ1 3JAMb 1S72Z 2JA6I 3CCQZ 3I55Z 1KQSZ 3GTJI 2QRCB 1Q822 2OTLZ 3J81b 4NH1C 3HOZI 2QRDB 3HOYI 1VQ4Z 2R93I 2KI7B 5C4JI 5T67A 2RHBA 3GTKI 3I4NI 1L1OC 2AKLA 3CCS1 1USPA 1PFTA 1JJ2Z 2JS4A 2JUBA 2PM9A 3FQMA 1VQ51 1Q7Y1 3BG0B 5IT9b 3VMGA 2JA8I 2Q4ZA 2QLVB 3CCE1 3RZDI 2ZAEB 3NDJA 5LL6f 2GTIA 1YI21 3IF8A 1K9M1 1Z03A 1VQ8Z 3G711 1VLAA 4A3II 4S1TA 4NFRA 1ML8A 2Q51A 3GTGI 2R92I 3J81f 2IZ4A 1K8A2 3TDHB 3G4SZ 3CD61 3I4MI 2QREB 3GTQI 3OW2Y 3D9XA 2K5RA 3KIHA 3HKZA 1K8A1 3JAMf 3HOWI 4NBFA 3I56Z 1VQ71 3S14I 1TWAI 3CCLZ 3CC21 1VQ91 2E9HA 1VQ6Z 3CMAZ 1VQM1 4MD8A 1WIIA 2VF1A 3CME1 3CC41 2DE5A 3CCUZ 3RZOI 1VQLZ 4A3JI 4NBAA 3NFZA 4RVDA 3CMEZ 3K7AI 4MH4A 5D1OA 1WW9A 3J7A4 2OOYB 4MRIA 1YITZ 1S7MA 2O4HA 1VQPZ 3CC2Z 3ESWA 2JA7I 2E2HI 1QVFZ 2RBLA 3S1NI 5FLXf 4BXXI 3NH5A 3CCRZ 3S1RI 3CCM1 1YIT1 3GTLI 2LFUA 3GCFA 5A2Qb 2OTJZ 1YUKA 2O53A 3H0GI 1K732 1M1K1 3J80b 4HGYA 1VQN1 4MONA 3CCV1 1Y1VS 2DE6A 1TWHI 3M4OI 1Z01A 2NVQI 1RO2A 1Q812 2E2JI 3PO3S 5C4XI 1VQ41 1VQNZ 3NH8A 4RS4A 1YJ91 1YHQ1 1VQOZ 2GU2A 2E2II 2KPIA 3OW2Z 2J6AA 4QTUA 4Y7NI 2W04A 1WCMI 1Q861 3S15I 2V8JA 2F4OA 1NP6A 4TNUA 2I3CA 1USPB 1NJI1 4A3GI 1VQ5Z 4AYBA 2GTHA 1VQ9Z 4A93I 2W03A 4QTTA 4RVFA 4HGZA 3CPWZ 2HF1A 5A2Qf 4E33A 1ZH1A 3M3YI 2F4MA 3GTOI 4E32A 4E30A 4MXUA 4A3EI 4BBRI 4X6AI 3CC71 4E31A 3CD6Z 1ZB9A 4NB8A 5IP7I 1Q7Y2 2R7ZI 3VMIA 1RO0A 1VQP1 1K9M2 4E2YA 4XX2A 2Y0SA 5FLXb 1YJNZ 1JWHC 4E2ZA 1I3QI 2PK7A 1R9TI 1YJN1 4HH4A 4DGLA 4RVHA 2OTL1 3HOVI 1VQMZ 2BJOA 2WAQA 1N2FA 2RIQA 3CC4Z 3MZLB 4A3KI 2K3RA 2QEXZ 3CC7Z 2RT9A 1Y1WI 2YU9I 1NJI2 2M48A 3G6E1 1QVGY 3CCR1 4BY1I 1W2BZ 4EWCA 1X0TA 2YADA 2OOXB 3PO2I 1SFOI 1KC82 4A3BI 2P3YA 2QKDA 5D1PA 3CCEZ 1YHQZ 2JMOA 1YI2Z 1QF8A 3CCMZ 2R6MA 4BBSI 1VQ81 3NDIA 1RO4A 1TWGI 2OTJ1 4A3FI 3FQQA 3NH4A 3CMA1 5CM2M 3S17I 5FLMI 3Q87A 1N8R2 3CCVZ 2EGTA 3D6WA 1KRLA 1YUAA 4NB9A 4A3MI 3CCL1 4RV9A 2JR6A 1K83I 3MONA 1RQFA 1M1K2 1TWCI 1KD11 4E2WA 4A3CI 1RLYA 2PMZA 3CQZI 3LUSA 1S721 1YIJZ 3S1MI 4CL1A 1VQ61 2P28A 3CPWY 2NVXI 3S2HI 2IZ3A 1YIJ1 1W2BY 3T4NB 3GTMS 3CXCY 2JA5I 3MZKB 1QVGZ 2QR1B 1VQK1 1NUIA 4NBEA 2DE7A 5C3EI 1VQKZ 1Q862 4MD7A 4DK1A 3CCU1 4NBBA 3GTPI 1QYPA 3CXCZ 1P9NA 3GKQA 4NBCA 3I551 4A3DI 3F3PC 3HOXI 1JJ2Y 5IT9f 2JNYA 3VMHA 1YJWZ 2NVTI 5IP9I 5AN9F 3FKII 1M902 1I50I 1TWFI 1RNIA 3S16I 2V8KA 4Y52I 3PO3I 2G2KA 4NOZA 1VQ7Z 1M901 1Y1VI 3CCSZ 4E2XA 4NBDA 3G6EZ 3BG1B 3G4S1 1YJ9Z 1I6HI 3H3VJ 3TE5B 3J80f 1X3WA 4DQYB 4NBHA 4RVGA 2VUMI 4NBGA 1QVFY 2LIYA 5C44I 2RPRA 1LQLA 3VB9A 3G71Z 3KIFA 2WB1A 1TFIA 5D1OB 3IX0A 2V8IA 1Q821 1Z02A 5T6BA 3EEDA 3U50C 3S2DI 1KC81 1X3ZA 2QA41 1KQSY 1VQO1 3S1QI 3EERA 3VTNA 1K731 3F3FC 4BY7I 2VUGA 3GTMI 3I561 1ZB8A 1KD12 2HU9A 1DL6A 2OZKA 2QEX1 2M6NA 3I07A 1Q811 4MD9A 2H85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME Z;  1YIJ 1;  1W2B Y;  1VQP 1;  1K9M 2;  3CCJ Z;  1YJN Z;  3CXC Y;  1QVG Z;  1VQL 1;  1YJW 1;  1VQK 1;  1YIT Z;  3CCQ 1;  2QA4 Z;  1VQP Z;  1N8R 1;  3CC2 Z;  1QVF Z;  3CCJ 1;  1YJN 1;  2OTL 1;  3CCR Z;  1VQM Z;  1S72 Z;  3CCM 1;  1VQK Z;  1YIT 1;  1Q86 2;  3CCQ Z;  3I55 Z;  1KQS Z;  3CC4 Z;  1Q82 2;  2QEX Z;  3CC7 Z;  3CCU 1;  1NJI 2;  3G6E 1;  1QVG Y;  2OTL Z;  2OTJ Z;  3CXC Z;  3CCR 1;  3I55 1;  1W2B Z;  1K73 2;  1M1K 1;  1JJ2 Y;  1KC8 2;  1VQ4 Z;  1VQN 1;  1YJW Z;  3CCV 1;  3CCE Z;  3CCS 1;  1YHQ Z;  1M90 2;  1Q81 2;  1JJ2 Z;  1VQ5 1;  1Q7Y 1;  1VQ4 1;  1VQN Z;  1YI2 Z;  3CCM Z;  1YJ9 1;  1VQ8 1;  1VQ7 Z;  1M90 1;  3CCE 1;  3CCS Z;  1YHQ 1;  3G6E Z;  1VQO Z;  2OTJ 1;  1YI2 1;  1K9M 1;  3G4S 1;  1YJ9 Z;  3CMA 1;  1VQ8 Z;  3G71 1;  3OW2 Z;  1QVF Y;  1N8R 2;  1Q86 1;  3CCV Z;  1K8A 2;  3G4S Z;  3CD6 1;  3G71 Z;  1NJI 1;  3OW2 Y;  3CCL 1;  1VQ5 Z;  1K8A 1;  1VQ9 Z;  1Q82 1;  1M1K 2;  3I56 Z;  1VQ7 1;  3CPW Z;  1KC8 1;  2QA4 1;  1KQS Y;  3CCL Z;  1KD1 1;  1VQO 1;  3CC2 1;  1VQ9 1;  1K73 1;  1VQ6 Z;  3CMA Z;  3I56 1;  1VQM 1;  1S72 1;  3CME 1;  1YIJ Z;  1KD1 2;  3CC4 1;  2QEX 1;  3CCU Z;  3CC7 1;  1VQ6 1;  3CD6 Z;  1Q81 1;  1VQL Z;  3CPW Y;  1Q7Y 2; 
#chains in the Genus database with same CATH topology
 3IFU A;  3P5J B;  2NVY I;  3CCJ Z;  3HOU I;  1VQL 1;  1YJW 1;  4A3L I;  2B63 I;  5T64 A;  3CCQ 1;  2QA4 Z;  1N8R 1;  3QWU A;  3CCJ 1;  3JAM b;  1S72 Z;  2JA6 I;  3CCQ Z;  3I55 Z;  1KQS Z;  3GTJ I;  2QRC B;  1Q82 2;  2OTL Z;  3J81 b;  4NH1 C;  3HOZ I;  2QRD B;  2VPX A;  3HOY I;  1VQ4 Z;  2R93 I;  2KI7 B;  5C4J I;  5T67 A;  2RHB A;  3GTK I;  3I4N I;  1L1O C;  2AKL A;  1FDI A;  3CCS 1;  1USP A;  1PFT A;  1JJ2 Z;  2JS4 A;  2JUB A;  2PM9 A;  3FQM A;  1VQ5 1;  1Q7Y 1;  3BG0 B;  5IT9 b;  3VMG A;  2JA8 I;  2Q4Z A;  2QLV B;  2IV2 X;  3CCE 1;  3RZD I;  2ZAE B;  3NDJ A;  5LL6 f;  2GTI A;  1YI2 1;  3IF8 A;  1K9M 1;  1Z03 A;  1VQ8 Z;  3G71 1;  1VLA A;  4A3I I;  4S1T A;  4NFR A;  1ML8 A;  2Q51 A;  3GTG I;  2R92 I;  3J81 f;  2IZ4 A;  1K8A 2;  3TDH B;  3G4S Z;  3CD6 1;  3I4M I;  2QRE B;  3GTQ I;  3OW2 Y;  3D9X A;  2K5R A;  3KIH A;  3HKZ A;  1K8A 1;  3JAM f;  3HOW I;  4NBF A;  3I56 Z;  1VQ7 1;  3S14 I;  1TWA I;  3CCL Z;  3CC2 1;  1VQ9 1;  2E9H A;  1Y8C A;  1VQ6 Z;  3CMA Z;  1VQM 1;  4MD8 A;  1WII A;  1WZN A;  2VF1 A;  3CME 1;  3CC4 1;  2DE5 A;  3CCU Z;  3RZO I;  1VQL Z;  4A3J I;  4NBA A;  3NFZ A;  4RVD A;  3CME Z;  3K7A I;  4MH4 A;  5D1O A;  1WW9 A;  1FDO A;  3J7A 4;  2OOY B;  4MRI A;  1YIT Z;  1S7M A;  2O4H A;  1VQP Z;  3CC2 Z;  3ESW A;  2JA7 I;  2E2H I;  1QVF Z;  2RBL A;  3S1N I;  5FLX f;  4BXX I;  3NH5 A;  3CCR Z;  3S1R I;  3CCM 1;  1YIT 1;  3GTL I;  2LFU A;  3GCF A;  1AA6 A;  5A2Q b;  2LEX A;  2OTJ Z;  3D2L A;  1YUK A;  2O53 A;  3H0G I;  1K73 2;  1M1K 1;  3J80 b;  4HGY A;  1VQN 1;  4MON A;  3CCV 1;  1Y1V S;  2DE6 A;  1TWH I;  3M4O I;  1WJ2 A;  1Z01 A;  2NVQ I;  1RO2 A;  1Q81 2;  2E2J I;  3PO3 S;  5C4X I;  1VQ4 1;  1VQN Z;  2VPW A;  3NH8 A;  4RS4 A;  1YJ9 1;  3IR7 A;  1YHQ 1;  2VPZ A;  1VQO Z;  2AYD A;  2GU2 A;  2E2I I;  2KPI A;  3OW2 Z;  2J6A A;  4QTU A;  4Y7N I;  2W04 A;  1WCM I;  1Q86 1;  3S15 I;  2V8J A;  2F4O A;  1NP6 A;  4TNU A;  2I3C A;  1USP B;  1NJI 1;  4A3G I;  1VQ5 Z;  4AYB A;  2GTH A;  2JIM A;  1VQ9 Z;  4A93 I;  2W03 A;  1Q16 A;  4QTT A;  4RVF A;  4HGZ A;  3CPW Z;  2HF1 A;  5A2Q f;  4E33 A;  1ZH1 A;  3M3Y I;  2F4M A;  3GTO I;  4E32 A;  4E30 A;  4MXU A;  4A3E I;  4BBR I;  4X6A I;  3CC7 1;  4E31 A;  3CD6 Z;  1ZB9 A;  4NB8 A;  5IP7 I;  1Q7Y 2;  2R7Z I;  3VMI A;  1RO0 A;  1VQP 1;  1K9M 2;  4E2Y A;  4XX2 A;  2Y0S A;  5FLX b;  1YJN Z;  1JWH C;  4E2Z A;  1I3Q I;  2PK7 A;  1R9T I;  1YJN 1;  4HH4 A;  4DGL A;  4RVH A;  2OTL 1;  3HOV I;  1VQM Z;  2BJO A;  2WAQ A;  1N2F A;  2RIQ A;  3CC4 Z;  3MZL B;  4A3K I;  2K3R A;  2QEX Z;  3CC7 Z;  2RT9 A;  1Y1W I;  2YU9 I;  1NJI 2;  2M48 A;  3G6E 1;  1QVG Y;  3CCR 1;  4BY1 I;  1W2B Z;  4EWC A;  1X0T A;  2YAD A;  2OOX B;  3PO2 I;  1SFO I;  1KC8 2;  4A3B I;  2P3Y A;  2QKD A;  5D1P A;  3CCE Z;  1YHQ Z;  2JMO A;  1YI2 Z;  1QF8 A;  3CCM Z;  2R6M A;  4BBS I;  1VQ8 1;  3NDI A;  1RO4 A;  1TWG I;  2OTJ 1;  4A3F I;  3FQQ A;  3NH4 A;  3CMA 1;  5CM2 M;  3S17 I;  5FLM I;  3Q87 A;  1N8R 2;  3CCV Z;  2EGT A;  3D6W A;  1KRL A;  1YUA A;  4NB9 A;  4A3M I;  3CCL 1;  2JIO A;  4RV9 A;  2JR6 A;  1K83 I;  3MON A;  1RQF A;  1M1K 2;  2VPY A;  1TWC I;  1KD1 1;  4E2W A;  4A3C I;  1RLY A;  2PMZ A;  3CQZ I;  3LUS A;  1S72 1;  1YIJ Z;  3S1M I;  2V45 A;  4CL1 A;  1VQ6 1;  2P28 A;  3CPW Y;  2NVX I;  3S2H I;  2IZ3 A;  1YIJ 1;  1W2B Y;  3T4N B;  3GTM S;  3CXC Y;  2JA5 I;  3MZK B;  1QVG Z;  1QXF A;  2QR1 B;  1VQK 1;  1NUI A;  4NBE A;  2DE7 A;  5C3E I;  1VQK Z;  1Q86 2;  4MD7 A;  4DK1 A;  3CCU 1;  4NBB A;  3GTP I;  1QYP A;  3CXC Z;  1P9N A;  3GKQ A;  4NBC A;  3I55 1;  4A3D I;  3F3P C;  3HOX I;  1JJ2 Y;  2NAP A;  5IT9 f;  2JNY A;  3VMH A;  1YJW Z;  2NVT I;  5IP9 I;  5AN9 F;  3FKI I;  1M90 2;  2V3V A;  1I50 I;  1TWF I;  1RNI A;  3S16 I;  2V8K A;  4Y52 I;  3PO3 I;  2JIQ A;  2JIR A;  2G2K A;  4NOZ A;  1VQ7 Z;  1M90 1;  1Y1V I;  3CCS Z;  4E2X A;  4NBD A;  3G6E Z;  3BG1 B;  1SIW A;  3G4S 1;  1YJ9 Z;  1I6H I;  3H3V J;  3TE5 B;  3J80 f;  1X3W A;  4DQY B;  4NBH A;  4RVG A;  2VUM I;  4NBG A;  1QVF Y;  2LIY A;  5C44 I;  2RPR A;  1LQL A;  3VB9 A;  3G71 Z;  3KIF A;  2WB1 A;  1TFI A;  5D1O B;  3IX0 A;  2V8I A;  1Q82 1;  1Z02 A;  5T6B A;  3EED A;  3U50 C;  2JIP A;  1KC8 1;  3S2D I;  1X3Z A;  2QA4 1;  1KQS Y;  1VQO 1;  3S1Q I;  3EER A;  3VTN A;  1K73 1;  3F3F C;  4BY7 I;  2VUG A;  3GTM I;  3I56 1;  1ZB8 A;  2E7Z A;  1KD1 2;  2HU9 A;  1DL6 A;  2OZK A;  2QEX 1;  2M6N A;  3I07 A;  1Q81 1;  4MD9 A;  2H85 A; 
#chains in the Genus database with same CATH homology
 3IFU A;  3P5J B;  2NVY I;  3CCJ Z;  3HOU I;  1VQL 1;  1YJW 1;  4A3L I;  2B63 I;  5T64 A;  3CCQ 1;  2QA4 Z;  1N8R 1;  3QWU A;  3CCJ 1;  3JAM b;  1S72 Z;  2JA6 I;  3CCQ Z;  3I55 Z;  1KQS Z;  3GTJ I;  2QRC B;  1Q82 2;  2OTL Z;  3J81 b;  4NH1 C;  3HOZ I;  2QRD B;  3HOY I;  1VQ4 Z;  2R93 I;  2KI7 B;  5C4J I;  5T67 A;  2RHB A;  3GTK I;  3I4N I;  1L1O C;  2AKL A;  3CCS 1;  1USP A;  1PFT A;  1JJ2 Z;  2JS4 A;  2JUB A;  2PM9 A;  3FQM A;  1VQ5 1;  1Q7Y 1;  3BG0 B;  5IT9 b;  3VMG A;  2JA8 I;  2Q4Z A;  2QLV B;  3CCE 1;  3RZD I;  2ZAE B;  3NDJ A;  5LL6 f;  2GTI A;  1YI2 1;  3IF8 A;  1K9M 1;  1Z03 A;  1VQ8 Z;  3G71 1;  1VLA A;  4A3I I;  4S1T A;  4NFR A;  1ML8 A;  2Q51 A;  3GTG I;  2R92 I;  3J81 f;  2IZ4 A;  1K8A 2;  3TDH B;  3G4S Z;  3CD6 1;  3I4M I;  2QRE B;  3GTQ I;  3OW2 Y;  3D9X A;  2K5R A;  3KIH A;  3HKZ A;  1K8A 1;  3JAM f;  3HOW I;  4NBF A;  3I56 Z;  1VQ7 1;  3S14 I;  1TWA I;  3CCL Z;  3CC2 1;  1VQ9 1;  2E9H A;  1VQ6 Z;  3CMA Z;  1VQM 1;  4MD8 A;  1WII A;  2VF1 A;  3CME 1;  3CC4 1;  2DE5 A;  3CCU Z;  3RZO I;  1VQL Z;  4A3J I;  4NBA A;  3NFZ A;  4RVD A;  3CME Z;  3K7A I;  4MH4 A;  5D1O A;  1WW9 A;  3J7A 4;  2OOY B;  4MRI A;  1YIT Z;  1S7M A;  2O4H A;  1VQP Z;  3CC2 Z;  3ESW A;  2JA7 I;  2E2H I;  1QVF Z;  2RBL A;  3S1N I;  5FLX f;  4BXX I;  3NH5 A;  3CCR Z;  3S1R I;  3CCM 1;  1YIT 1;  3GTL I;  2LFU A;  3GCF A;  5A2Q b;  2OTJ Z;  1YUK A;  2O53 A;  3H0G I;  1K73 2;  1M1K 1;  3J80 b;  4HGY A;  1VQN 1;  4MON A;  3CCV 1;  1Y1V S;  2DE6 A;  1TWH I;  3M4O I;  1Z01 A;  2NVQ I;  1RO2 A;  1Q81 2;  2E2J I;  3PO3 S;  5C4X I;  1VQ4 1;  1VQN Z;  3NH8 A;  4RS4 A;  1YJ9 1;  1YHQ 1;  1VQO Z;  2GU2 A;  2E2I I;  2KPI A;  3OW2 Z;  2J6A A;  4QTU A;  4Y7N I;  2W04 A;  1WCM I;  1Q86 1;  3S15 I;  2V8J A;  2F4O A;  1NP6 A;  4TNU A;  2I3C A;  1USP B;  1NJI 1;  4A3G I;  1VQ5 Z;  4AYB A;  2GTH A;  1VQ9 Z;  4A93 I;  2W03 A;  4QTT A;  4RVF A;  4HGZ A;  3CPW Z;  2HF1 A;  5A2Q f;  4E33 A;  1ZH1 A;  3M3Y I;  2F4M A;  3GTO I;  4E32 A;  4E30 A;  4MXU A;  4A3E I;  4BBR I;  4X6A I;  3CC7 1;  4E31 A;  3CD6 Z;  1ZB9 A;  4NB8 A;  5IP7 I;  1Q7Y 2;  2R7Z I;  3VMI A;  1RO0 A;  1VQP 1;  1K9M 2;  4E2Y A;  4XX2 A;  2Y0S A;  5FLX b;  1YJN Z;  1JWH C;  4E2Z A;  1I3Q I;  2PK7 A;  1R9T I;  1YJN 1;  4HH4 A;  4DGL A;  4RVH A;  2OTL 1;  3HOV I;  1VQM Z;  2BJO A;  2WAQ A;  1N2F A;  2RIQ A;  3CC4 Z;  3MZL B;  4A3K I;  2K3R A;  2QEX Z;  3CC7 Z;  2RT9 A;  1Y1W I;  2YU9 I;  1NJI 2;  2M48 A;  3G6E 1;  1QVG Y;  3CCR 1;  4BY1 I;  1W2B Z;  4EWC A;  1X0T A;  2YAD A;  2OOX B;  3PO2 I;  1SFO I;  1KC8 2;  4A3B I;  2P3Y A;  2QKD A;  5D1P A;  3CCE Z;  1YHQ Z;  2JMO A;  1YI2 Z;  1QF8 A;  3CCM Z;  2R6M A;  4BBS I;  1VQ8 1;  3NDI A;  1RO4 A;  1TWG I;  2OTJ 1;  4A3F I;  3FQQ A;  3NH4 A;  3CMA 1;  5CM2 M;  3S17 I;  5FLM I;  3Q87 A;  1N8R 2;  3CCV Z;  2EGT A;  3D6W A;  1KRL A;  1YUA A;  4NB9 A;  4A3M I;  3CCL 1;  4RV9 A;  2JR6 A;  1K83 I;  3MON A;  1RQF A;  1M1K 2;  1TWC I;  1KD1 1;  4E2W A;  4A3C I;  1RLY A;  2PMZ A;  3CQZ I;  3LUS A;  1S72 1;  1YIJ Z;  3S1M I;  4CL1 A;  1VQ6 1;  2P28 A;  3CPW Y;  2NVX I;  3S2H I;  2IZ3 A;  1YIJ 1;  1W2B Y;  3T4N B;  3GTM S;  3CXC Y;  2JA5 I;  3MZK B;  1QVG Z;  2QR1 B;  1VQK 1;  1NUI A;  4NBE A;  2DE7 A;  5C3E I;  1VQK Z;  1Q86 2;  4MD7 A;  4DK1 A;  3CCU 1;  4NBB A;  3GTP I;  1QYP A;  3CXC Z;  1P9N A;  3GKQ A;  4NBC A;  3I55 1;  4A3D I;  3F3P C;  3HOX I;  1JJ2 Y;  5IT9 f;  2JNY A;  3VMH A;  1YJW Z;  2NVT I;  5IP9 I;  5AN9 F;  3FKI I;  1M90 2;  1I50 I;  1TWF I;  1RNI A;  3S16 I;  2V8K A;  4Y52 I;  3PO3 I;  2G2K A;  4NOZ A;  1VQ7 Z;  1M90 1;  1Y1V I;  3CCS Z;  4E2X A;  4NBD A;  3G6E Z;  3BG1 B;  3G4S 1;  1YJ9 Z;  1I6H I;  3H3V J;  3TE5 B;  3J80 f;  1X3W A;  4DQY B;  4NBH A;  4RVG A;  2VUM I;  4NBG A;  1QVF Y;  2LIY A;  5C44 I;  2RPR A;  1LQL A;  3VB9 A;  3G71 Z;  3KIF A;  2WB1 A;  1TFI A;  5D1O B;  3IX0 A;  2V8I A;  1Q82 1;  1Z02 A;  5T6B A;  3EED A;  3U50 C;  3S2D I;  1KC8 1;  1X3Z A;  2QA4 1;  1KQS Y;  1VQO 1;  3S1Q I;  3EER A;  3VTN A;  1K73 1;  3F3F C;  4BY7 I;  2VUG A;  3GTM I;  3I56 1;  1ZB8 A;  1KD1 2;  2HU9 A;  1DL6 A;  2OZK A;  2QEX 1;  2M6N A;  3I07 A;  1Q81 1;  4MD9 A;  2H85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...