3CXCY

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cxcY00
1Q812 1M1K1 3CCR1 1YIJ1 3CMAZ 1VQ8Z 1YHQ1 1KQSZ 1VQL1 1VQ61 1VQ91 1YJN1 2OTL1 3CC4Z 3G711 1K731 1Q811 1VQOZ 1VQ4Z 2QEXZ 3G6E1 3CCEZ 1KD12 2QA41 1YJ9Z 1M902 3CCUZ 3OW2Y 1N8R2 3CCQZ 1VQK1 1KD11 3CCSZ 1VQMZ 1Q822 1KC82 1M901 1VQNZ 3CME1 1VQPZ 1K9M2 3CCVZ 1S72Z 1YI21 1YITZ 3I55Z 3CD61 3I561 3CCL1 3CCRZ 3G4SZ 1YIJZ 1Q821 1KC81 1VQ51 3CMA1 1K9M1 1VQLZ 1VQ6Z 1VQ9Z 3G71Z 1VQ71 1Q862 2OTJ1 1QVGY 1VQO1 3CC7Z 3G6EZ 1K8A2 1W2BY 1JJ2Y 3CCE1 2QA4Z 1QVFY 3OW2Z 3CCU1 3CPWY 3CC21 3CCMZ 1QVGZ 3CCJZ 1N8R1 3CXCY 3CCQ1 1YJW1 1K8A1 1NJI2 1VQKZ 1Q7Y2 3CMEZ 3CPWZ 1YHQZ 1VQ81 3CCV1 1KQSY 2OTLZ 1YJNZ 3CXCZ 3CC41 3CD6Z 3I56Z 3CCLZ 1NJI1 3G4S1 1VQ41 2QEX1 1Q7Y1 1VQ5Z 1YJ91 1VQ7Z 2OTJZ 1Q861 3CC71 1JJ2Z 1W2BZ 1M1K2 3CCS1 1VQM1 1QVFZ 1VQN1 1VQP1 3CC2Z 1YI2Z 1S721 3CCM1 1YIT1 3CCJ1 3I551 1YJWZ 1K732
chains in the Genus database with same CATH superfamily
5C3EI 1WCMI 1YHQ1 1RO0A 1YJN1 3KIFA 2IZ4A 2RHBA 3MZLB 3CCEZ 2QA41 4NFRA 3QWUA 2JA5I 1N2FA 3F3FC 3D2LA 4NBAA 1Y1VI 3GTPI 2YADA 3CCSZ 3U50C 2E2HI 3NFZA 5C4XI 1TWGI 1M901 3J80b 2NVTI 2O4HA 1S72Z 4MONA 3VTNA 2V8KA 2LIYA 3G4SZ 1KC81 1KRLA 2J6AA 4RV9A 3NH8A 2JR6A 1VQ71 2Y0SA 2NAPA 4EWCA 2K3RA 3MONA 4E31A 2QA4Z 4DQYB 4RVGA 2M6NA 5IP9I 3KIHA 3CPWY 2V45A 1N8R1 2H85A 3CCQ1 3IX0A 1K8A1 2G2KA 2GU2A 1YUKA 3HOWI 2HF1A 3Q87A 3CXCZ 2V8JA 2Q4ZA 1Q16A 1NJI1 4Y52I 1WW9A 4A3MI 5D1PA 1PFTA 5FLMI 4CL1A 3JAMb 1VQ7Z 1Y1VS 1NP6A 2VUGA 3CC71 1W2BZ 1FDIA 3S2HI 2JA8I 1QVFZ 1QF8A 3TDHB 3HKZA 1VQP1 5T6BA 1YI2Z 3CCJ1 3I551 3PO3I 4E2ZA 2DE6A 2QKDA 3P5JB 3S1NI 1R9TI 4MRIA 1Z02A 3PO2I 2KPIA 3CMAZ 5C4JI 1KQSZ 1VQ61 2R6MA 1VQ91 3S16I 2QRDB 4QTUA 1Y8CA 5FLXf 3NH5A 3NDIA 2R93I 1VQOZ 3VB9A 3NH4A 5C44I 4NBFA 1L1OC 1KD12 4NBBA 5AN9F 4NOZA 2V3VA 3TE5B 2GTIA 2W04A 1VQK1 4NB8A 2KI7B 4QTTA 1VQPZ 1K9M2 2JNYA 2JIOA 3CCVZ 3I55Z 3I07A 3GTMS 3CD61 3I561 1ZB8A 2VUMI 4A3BI 4A3DI 1VQ6Z 1VQ9Z 3FQQA 1QVGY 5IT9f 2IV2X 1Z03A 4A3FI 1W2BY 1X0TA 4NH1C 5T67A 1RQFA 1QVFY 1TWCI 3CCU1 3BG1B 5T64A 3S14I 5A2Qf 3CC21 3PO3S 4XX2A 1VQKZ 3D6WA 1Q7Y2 3GTQI 4A3EI 4E33A 4Y7NI 5D1OA 1YHQZ 1KQSY 1YJNZ 4NBCA 1WJ2A 3S1RI 3D9XA 4MD9A 3CD6Z 4BY1I 3I56Z 3HOXI 4BXXI 3GKQA 4AYBA 1VQ41 2QEX1 4A3KI 1RO2A 2PM9A 2DE7A 4BBRI 2JIQA 2NVQI 4BBSI 4MXUA 2OOXB 5FLXb 1Q861 3I4MI 3HOUI 1RNIA 1Z01A 2E7ZA 1M1K2 1TFIA 2ZAEB 4A3GI 1VQN1 1X3WA 3CC2Z 3S15I 3CCM1 1YUAA 1K732 3GTMI 1RLYA 1Q812 4HH4A 4S1TA 3CCR1 3HOVI 4E30A 4E2XA 1VQL1 4DGLA 2OTL1 2RIQA 3BG0B 3F3PC 4RVFA 2NVXI 1VQ4Z 2QEXZ 3G6E1 3J7A4 1ZH1A 2DE5A 2JS4A 3I4NI 2QR1B 2V8IA 2QREB 3NDJA 2P3YA 2LFUA 1Y1WI 1P9NA 3RZOI 1N8R2 5IT9b 3GCFA 3CCQZ 3GTJI 1DL6A 4E2WA 1KD11 4E2YA 1Q822 2M48A 3J81f 1VQNZ 3GTLI 3CME1 5A2Qb 3RZDI 2E2JI 2PMZA 2VPXA 4A3JI 2P28A 2VPYA 3CCRZ 2YU9I 2OZKA 2JUBA 1K9M1 1VQLZ 3CQZI 1S7MA 3MZKB 3M3YI 4A3II 3M4OI 2BJOA 2OTJ1 3CC7Z 4NBHA 3G6EZ 2AKLA 3CCE1 2JA6I 1I6HI 4DK1A 3EERA 2K5RA 2E2II 3OW2Z 2JIRA 3VMGA 1ZB9A 3H0GI 3CCJZ 2QLVB 3CXCY 2RT9A 4NBDA 3T4NB 1TWFI 2EGTA 3CMEZ 3CPWZ 1VQ81 1FDOA 4RS4A 4RVDA 1I3QI 1QYPA 3CC41 2RPRA 2F4MA 3G4S1 2O53A 3VMHA 1Q7Y1 4HGZA 2JMOA 4NB9A 1QXFA 1RO4A 1YJ91 3JAMf 2AYDA 2JA7I 1USPB 3S2DI 2OTJZ 1JJ2Z 3LUSA 1VQM1 1X3ZA 2VPZA 2E9HA 2QRCB 2R7ZI 2OOYB 3FKII 3EEDA 1YIT1 4X6AI 1SIWA 2F4OA 4A93I 1M1K1 4NBGA 3GTGI 1YIJ1 3S1QI 3J81b 1TWHI 1VQ8Z 4A3LI 2VPWA 3CC4Z 3GTKI 3G711 1K731 2I3CA 1NUIA 2RBLA 1Q811 3FQMA 2JIPA 1SFOI 1YJ9Z 1M902 3CCUZ 3OW2Y 2VF1A 3K7AI 4NBEA 1VLAA 3S17I 3ESWA 1VQMZ 1KC82 3S1MI 1I50I 1YI21 1YITZ 1LQLA 4MH4A 3CCL1 4E32A 1YIJZ 1Q821 1VQ51 3CMA1 5CM2M 4RVHA 2B63I 3G71Z 5IP7I 1USPA 1Q862 1VQO1 1WIIA 1K8A2 1JJ2Y 4MD8A 4A3CI 2WB1A 2HU9A 3J80f 4MD7A 3CCMZ 1QVGZ 2JIMA 3IF8A 1YJW1 1NJI2 1JWHC 1K83I 2WAQA 3CCV1 2OTLZ 4BY7I 3IR7A 2R92I 3HOZI 1TWAI 3CCLZ 2IZ3A 1WZNA 3HOYI 3IFUA 1ML8A 1AA6A 2LEXA 2W03A 5D1OB 1VQ5Z 4HGYA 3GTOI 2Q51A 4TNUA 3H3VJ 3CCS1 2PK7A 3VMIA 5LL6f 1S721 2NVYI 1YJWZ 2GTHA
chains in the Genus database with same CATH topology
5C3EI 1WCMI 1YHQ1 1RO0A 1YJN1 3KIFA 2IZ4A 2RHBA 3MZLB 3CCEZ 2QA41 4NFRA 3QWUA 2JA5I 1N2FA 3F3FC 4NBAA 1Y1VI 3GTPI 2YADA 3CCSZ 3U50C 2E2HI 3NFZA 5C4XI 1TWGI 1M901 3J80b 2NVTI 2O4HA 1S72Z 4MONA 3VTNA 2V8KA 2LIYA 3G4SZ 1KC81 1KRLA 2J6AA 4RV9A 3NH8A 2JR6A 1VQ71 2Y0SA 4EWCA 2K3RA 3MONA 4E31A 2QA4Z 4DQYB 4RVGA 2M6NA 5IP9I 3KIHA 3CPWY 1N8R1 2H85A 3CCQ1 3IX0A 1K8A1 2G2KA 2GU2A 1YUKA 3HOWI 2HF1A 3Q87A 3CXCZ 2V8JA 2Q4ZA 4Y52I 1NJI1 1WW9A 4A3MI 5D1PA 1PFTA 5FLMI 4CL1A 3JAMb 1VQ7Z 1Y1VS 1NP6A 2VUGA 3CC71 1W2BZ 3S2HI 2JA8I 1QVFZ 1QF8A 3TDHB 3HKZA 1VQP1 5T6BA 1YI2Z 3CCJ1 3I551 3PO3I 4E2ZA 2DE6A 2QKDA 3P5JB 3S1NI 1R9TI 4MRIA 1Z02A 3PO2I 2KPIA 3CMAZ 5C4JI 1KQSZ 1VQ61 2R6MA 1VQ91 3S16I 2QRDB 4QTUA 5FLXf 3NH5A 3NDIA 2R93I 1VQOZ 3VB9A 3NH4A 5C44I 4NBFA 1L1OC 1KD12 4NBBA 5AN9F 4NOZA 3TE5B 2GTIA 2W04A 1VQK1 4NB8A 2KI7B 4QTTA 1VQPZ 1K9M2 2JNYA 3CCVZ 3I55Z 3I07A 3GTMS 3CD61 3I561 1ZB8A 2VUMI 4A3BI 4A3DI 1VQ6Z 1VQ9Z 3FQQA 1QVGY 5IT9f 1Z03A 4A3FI 1W2BY 1X0TA 4NH1C 5T67A 1RQFA 1QVFY 1TWCI 3CCU1 3BG1B 5T64A 3S14I 5A2Qf 3CC21 3PO3S 4XX2A 1VQKZ 3D6WA 1Q7Y2 3GTQI 4A3EI 4E33A 4Y7NI 5D1OA 1YHQZ 1KQSY 1YJNZ 4NBCA 3S1RI 3D9XA 4MD9A 3CD6Z 4BY1I 3I56Z 3HOXI 4BXXI 3GKQA 4AYBA 1VQ41 2QEX1 4A3KI 1RO2A 2PM9A 2DE7A 4BBRI 2NVQI 4BBSI 4MXUA 2OOXB 5FLXb 1Q861 3I4MI 3HOUI 1RNIA 1Z01A 1M1K2 1TFIA 2ZAEB 4A3GI 1VQN1 1X3WA 3CC2Z 3S15I 3CCM1 1YUAA 1K732 3GTMI 1RLYA 1Q812 4HH4A 4S1TA 3CCR1 3HOVI 4E30A 4E2XA 1VQL1 4DGLA 2OTL1 2RIQA 3BG0B 3F3PC 4RVFA 2NVXI 1VQ4Z 2QEXZ 3G6E1 3J7A4 1ZH1A 2DE5A 2JS4A 3I4NI 2QR1B 2V8IA 2QREB 3NDJA 2P3YA 2LFUA 1Y1WI 1P9NA 3RZOI 1N8R2 5IT9b 3GCFA 3CCQZ 3GTJI 1DL6A 4E2WA 1KD11 4E2YA 1Q822 2M48A 3J81f 1VQNZ 3GTLI 3CME1 5A2Qb 3RZDI 2E2JI 2PMZA 4A3JI 2P28A 3CCRZ 2YU9I 2OZKA 2JUBA 1K9M1 1VQLZ 3CQZI 1S7MA 3MZKB 3M3YI 4A3II 3M4OI 2BJOA 2OTJ1 3CC7Z 4NBHA 3G6EZ 2AKLA 3CCE1 2JA6I 1I6HI 4DK1A 3EERA 2K5RA 2E2II 3OW2Z 3VMGA 1ZB9A 3H0GI 3CCJZ 2QLVB 3CXCY 2RT9A 4NBDA 3T4NB 1TWFI 2EGTA 3CMEZ 3CPWZ 1VQ81 4RS4A 4RVDA 1I3QI 1QYPA 3CC41 2RPRA 2F4MA 3G4S1 2O53A 3VMHA 1Q7Y1 4HGZA 2JMOA 4NB9A 1RO4A 1YJ91 3JAMf 2JA7I 1USPB 3S2DI 2OTJZ 1JJ2Z 3LUSA 1VQM1 1X3ZA 2E9HA 2QRCB 2R7ZI 2OOYB 3FKII 3EEDA 1YIT1 4X6AI 2F4OA 4A93I 1M1K1 4NBGA 3GTGI 1YIJ1 3S1QI 3J81b 1TWHI 1VQ8Z 4A3LI 3CC4Z 3GTKI 3G711 1K731 2I3CA 1NUIA 2RBLA 1Q811 3FQMA 1SFOI 1YJ9Z 1M902 3CCUZ 3OW2Y 2VF1A 3K7AI 4NBEA 1VLAA 3S17I 3ESWA 1VQMZ 1KC82 3S1MI 1I50I 1YI21 1YITZ 1LQLA 4MH4A 3CCL1 4E32A 1YIJZ 1Q821 1VQ51 3CMA1 5CM2M 4RVHA 2B63I 3G71Z 5IP7I 1USPA 1Q862 1VQO1 1WIIA 1K8A2 1JJ2Y 4MD8A 4A3CI 2WB1A 2HU9A 3J80f 4MD7A 3CCMZ 1QVGZ 3IF8A 1YJW1 1NJI2 1JWHC 1K83I 2WAQA 3CCV1 2OTLZ 4BY7I 2R92I 3HOZI 1TWAI 2IZ3A 3CCLZ 3HOYI 3IFUA 1ML8A 2W03A 5D1OB 1VQ5Z 4HGYA 3GTOI 2Q51A 4TNUA 3H3VJ 3CCS1 2PK7A 3VMIA 5LL6f 1S721 2NVYI 1YJWZ 2GTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 2;  1M1K 1;  3CCR 1;  1YIJ 1;  3CMA Z;  1VQ8 Z;  1YHQ 1;  1KQS Z;  1VQL 1;  1VQ6 1;  1VQ9 1;  1YJN 1;  2OTL 1;  3CC4 Z;  3G71 1;  1K73 1;  1Q81 1;  1VQO Z;  1VQ4 Z;  2QEX Z;  3G6E 1;  3CCE Z;  1KD1 2;  2QA4 1;  1YJ9 Z;  1M90 2;  3CCU Z;  3OW2 Y;  1N8R 2;  3CCQ Z;  1VQK 1;  1KD1 1;  3CCS Z;  1VQM Z;  1Q82 2;  1KC8 2;  1M90 1;  1VQN Z;  3CME 1;  1VQP Z;  1K9M 2;  3CCV Z;  1S72 Z;  1YI2 1;  1YIT Z;  3I55 Z;  3CD6 1;  3I56 1;  3CCL 1;  3CCR Z;  3G4S Z;  1YIJ Z;  1Q82 1;  1KC8 1;  1VQ5 1;  3CMA 1;  1K9M 1;  1VQL Z;  1VQ6 Z;  1VQ9 Z;  3G71 Z;  1VQ7 1;  1Q86 2;  2OTJ 1;  1QVG Y;  1VQO 1;  3CC7 Z;  3G6E Z;  1K8A 2;  1W2B Y;  1JJ2 Y;  3CCE 1;  2QA4 Z;  1QVF Y;  3OW2 Z;  3CCU 1;  3CPW Y;  3CC2 1;  3CCM Z;  1QVG Z;  3CCJ Z;  1N8R 1;  3CXC Y;  3CCQ 1;  1YJW 1;  1K8A 1;  1NJI 2;  1VQK Z;  1Q7Y 2;  3CME Z;  3CPW Z;  1YHQ Z;  1VQ8 1;  3CCV 1;  1KQS Y;  2OTL Z;  1YJN Z;  3CXC Z;  3CC4 1;  3CD6 Z;  3I56 Z;  3CCL Z;  1NJI 1;  3G4S 1;  1VQ4 1;  2QEX 1;  1Q7Y 1;  1VQ5 Z;  1YJ9 1;  1VQ7 Z;  2OTJ Z;  1Q86 1;  3CC7 1;  1JJ2 Z;  1W2B Z;  1M1K 2;  3CCS 1;  1VQM 1;  1QVF Z;  1VQN 1;  1VQP 1;  3CC2 Z;  1YI2 Z;  1S72 1;  3CCM 1;  1YIT 1;  3CCJ 1;  3I55 1;  1YJW Z;  1K73 2; 
#chains in the Genus database with same CATH topology
 5C3E I;  1WCM I;  1YHQ 1;  1RO0 A;  1YJN 1;  3KIF A;  2IZ4 A;  2RHB A;  3MZL B;  3CCE Z;  2QA4 1;  4NFR A;  3QWU A;  2JA5 I;  1N2F A;  3F3F C;  3D2L A;  4NBA A;  1Y1V I;  3GTP I;  2YAD A;  3CCS Z;  3U50 C;  2E2H I;  3NFZ A;  5C4X I;  1TWG I;  1M90 1;  3J80 b;  2NVT I;  2O4H A;  1S72 Z;  4MON A;  3VTN A;  2V8K A;  2LIY A;  3G4S Z;  1KC8 1;  1KRL A;  2J6A A;  4RV9 A;  3NH8 A;  2JR6 A;  1VQ7 1;  2Y0S A;  2NAP A;  4EWC A;  2K3R A;  3MON A;  4E31 A;  2QA4 Z;  4DQY B;  4RVG A;  2M6N A;  5IP9 I;  3KIH A;  3CPW Y;  2V45 A;  1N8R 1;  2H85 A;  3CCQ 1;  3IX0 A;  1K8A 1;  2G2K A;  2GU2 A;  1YUK A;  3HOW I;  2HF1 A;  3Q87 A;  3CXC Z;  2V8J A;  2Q4Z A;  1Q16 A;  1NJI 1;  4Y52 I;  1WW9 A;  4A3M I;  5D1P A;  1PFT A;  5FLM I;  4CL1 A;  3JAM b;  1VQ7 Z;  1Y1V S;  1NP6 A;  2VUG A;  3CC7 1;  1W2B Z;  1FDI A;  3S2H I;  2JA8 I;  1QVF Z;  1QF8 A;  3TDH B;  3HKZ A;  1VQP 1;  5T6B A;  1YI2 Z;  3CCJ 1;  3I55 1;  3PO3 I;  4E2Z A;  2DE6 A;  2QKD A;  3P5J B;  3S1N I;  1R9T I;  4MRI A;  1Z02 A;  3PO2 I;  2KPI A;  3CMA Z;  5C4J I;  1KQS Z;  1VQ6 1;  2R6M A;  1VQ9 1;  3S16 I;  2QRD B;  4QTU A;  1Y8C A;  5FLX f;  3NH5 A;  3NDI A;  2R93 I;  1VQO Z;  3VB9 A;  3NH4 A;  5C44 I;  4NBF A;  1L1O C;  1KD1 2;  4NBB A;  5AN9 F;  4NOZ A;  2V3V A;  3TE5 B;  2GTI A;  2W04 A;  1VQK 1;  4NB8 A;  2KI7 B;  4QTT A;  1VQP Z;  1K9M 2;  2JNY A;  2JIO A;  3CCV Z;  3I55 Z;  3I07 A;  3GTM S;  3CD6 1;  3I56 1;  1ZB8 A;  2VUM I;  4A3B I;  4A3D I;  1VQ6 Z;  1VQ9 Z;  3FQQ A;  1QVG Y;  5IT9 f;  2IV2 X;  1Z03 A;  4A3F I;  1W2B Y;  1X0T A;  4NH1 C;  5T67 A;  1RQF A;  1QVF Y;  1TWC I;  3CCU 1;  3BG1 B;  5T64 A;  3S14 I;  5A2Q f;  3CC2 1;  3PO3 S;  4XX2 A;  1VQK Z;  3D6W A;  1Q7Y 2;  3GTQ I;  4A3E I;  4E33 A;  4Y7N I;  5D1O A;  1YHQ Z;  1KQS Y;  1YJN Z;  4NBC A;  1WJ2 A;  3S1R I;  3D9X A;  4MD9 A;  3CD6 Z;  4BY1 I;  3I56 Z;  3HOX I;  4BXX I;  3GKQ A;  4AYB A;  1VQ4 1;  2QEX 1;  4A3K I;  1RO2 A;  2PM9 A;  2DE7 A;  4BBR I;  2JIQ A;  2NVQ I;  4BBS I;  4MXU A;  2OOX B;  5FLX b;  1Q86 1;  3I4M I;  3HOU I;  1RNI A;  1Z01 A;  2E7Z A;  1M1K 2;  1TFI A;  2ZAE B;  4A3G I;  1VQN 1;  1X3W A;  3CC2 Z;  3S15 I;  3CCM 1;  1YUA A;  1K73 2;  3GTM I;  1RLY A;  1Q81 2;  4HH4 A;  4S1T A;  3CCR 1;  3HOV I;  4E30 A;  4E2X A;  1VQL 1;  4DGL A;  2OTL 1;  2RIQ A;  3BG0 B;  3F3P C;  4RVF A;  2NVX I;  1VQ4 Z;  2QEX Z;  3G6E 1;  3J7A 4;  1ZH1 A;  2DE5 A;  2JS4 A;  3I4N I;  2QR1 B;  2V8I A;  2QRE B;  3NDJ A;  2P3Y A;  2LFU A;  1Y1W I;  1P9N A;  3RZO I;  1N8R 2;  5IT9 b;  3GCF A;  3CCQ Z;  3GTJ I;  1DL6 A;  4E2W A;  1KD1 1;  4E2Y A;  1Q82 2;  2M48 A;  3J81 f;  1VQN Z;  3GTL I;  3CME 1;  5A2Q b;  3RZD I;  2E2J I;  2PMZ A;  2VPX A;  4A3J I;  2P28 A;  2VPY A;  3CCR Z;  2YU9 I;  2OZK A;  2JUB A;  1K9M 1;  1VQL Z;  3CQZ I;  1S7M A;  3MZK B;  3M3Y I;  4A3I I;  3M4O I;  2BJO A;  2OTJ 1;  3CC7 Z;  4NBH A;  3G6E Z;  2AKL A;  3CCE 1;  2JA6 I;  1I6H I;  4DK1 A;  3EER A;  2K5R A;  2E2I I;  3OW2 Z;  2JIR A;  3VMG A;  1ZB9 A;  3H0G I;  3CCJ Z;  2QLV B;  3CXC Y;  2RT9 A;  4NBD A;  3T4N B;  1TWF I;  2EGT A;  3CME Z;  3CPW Z;  1VQ8 1;  1FDO A;  4RS4 A;  4RVD A;  1I3Q I;  1QYP A;  3CC4 1;  2RPR A;  2F4M A;  3G4S 1;  2O53 A;  3VMH A;  1Q7Y 1;  4HGZ A;  2JMO A;  4NB9 A;  1QXF A;  1RO4 A;  1YJ9 1;  3JAM f;  2AYD A;  2JA7 I;  1USP B;  3S2D I;  2OTJ Z;  1JJ2 Z;  3LUS A;  1VQM 1;  1X3Z A;  2VPZ A;  2E9H A;  2QRC B;  2R7Z I;  2OOY B;  3FKI I;  3EED A;  1YIT 1;  4X6A I;  1SIW A;  2F4O A;  4A93 I;  1M1K 1;  4NBG A;  3GTG I;  1YIJ 1;  3S1Q I;  3J81 b;  1TWH I;  1VQ8 Z;  4A3L I;  2VPW A;  3CC4 Z;  3GTK I;  3G71 1;  1K73 1;  2I3C A;  1NUI A;  2RBL A;  1Q81 1;  3FQM A;  2JIP A;  1SFO I;  1YJ9 Z;  1M90 2;  3CCU Z;  3OW2 Y;  2VF1 A;  3K7A I;  4NBE A;  1VLA A;  3S17 I;  3ESW A;  1VQM Z;  1KC8 2;  3S1M I;  1I50 I;  1YI2 1;  1YIT Z;  1LQL A;  4MH4 A;  3CCL 1;  4E32 A;  1YIJ Z;  1Q82 1;  1VQ5 1;  3CMA 1;  5CM2 M;  4RVH A;  2B63 I;  3G71 Z;  5IP7 I;  1USP A;  1Q86 2;  1VQO 1;  1WII A;  1K8A 2;  1JJ2 Y;  4MD8 A;  4A3C I;  2WB1 A;  2HU9 A;  3J80 f;  4MD7 A;  3CCM Z;  1QVG Z;  2JIM A;  3IF8 A;  1YJW 1;  1NJI 2;  1JWH C;  1K83 I;  2WAQ A;  3CCV 1;  2OTL Z;  4BY7 I;  3IR7 A;  2R92 I;  3HOZ I;  1TWA I;  3CCL Z;  2IZ3 A;  1WZN A;  3HOY I;  3IFU A;  1ML8 A;  1AA6 A;  2LEX A;  2W03 A;  5D1O B;  1VQ5 Z;  4HGY A;  3GTO I;  2Q51 A;  4TNU A;  3H3V J;  3CCS 1;  2PK7 A;  3VMI A;  5LL6 f;  1S72 1;  2NVY I;  1YJW Z;  2GTH A; 
#chains in the Genus database with same CATH homology
 5C3E I;  1WCM I;  1YHQ 1;  1RO0 A;  1YJN 1;  3KIF A;  2IZ4 A;  2RHB A;  3MZL B;  3CCE Z;  2QA4 1;  4NFR A;  3QWU A;  2JA5 I;  1N2F A;  3F3F C;  4NBA A;  1Y1V I;  3GTP I;  2YAD A;  3CCS Z;  3U50 C;  2E2H I;  3NFZ A;  5C4X I;  1TWG I;  1M90 1;  3J80 b;  2NVT I;  2O4H A;  1S72 Z;  4MON A;  3VTN A;  2V8K A;  2LIY A;  3G4S Z;  1KC8 1;  1KRL A;  2J6A A;  4RV9 A;  3NH8 A;  2JR6 A;  1VQ7 1;  2Y0S A;  4EWC A;  2K3R A;  3MON A;  4E31 A;  2QA4 Z;  4DQY B;  4RVG A;  2M6N A;  5IP9 I;  3KIH A;  3CPW Y;  1N8R 1;  2H85 A;  3CCQ 1;  3IX0 A;  1K8A 1;  2G2K A;  2GU2 A;  1YUK A;  3HOW I;  2HF1 A;  3Q87 A;  3CXC Z;  2V8J A;  2Q4Z A;  4Y52 I;  1NJI 1;  1WW9 A;  4A3M I;  5D1P A;  1PFT A;  5FLM I;  4CL1 A;  3JAM b;  1VQ7 Z;  1Y1V S;  1NP6 A;  2VUG A;  3CC7 1;  1W2B Z;  3S2H I;  2JA8 I;  1QVF Z;  1QF8 A;  3TDH B;  3HKZ A;  1VQP 1;  5T6B A;  1YI2 Z;  3CCJ 1;  3I55 1;  3PO3 I;  4E2Z A;  2DE6 A;  2QKD A;  3P5J B;  3S1N I;  1R9T I;  4MRI A;  1Z02 A;  3PO2 I;  2KPI A;  3CMA Z;  5C4J I;  1KQS Z;  1VQ6 1;  2R6M A;  1VQ9 1;  3S16 I;  2QRD B;  4QTU A;  5FLX f;  3NH5 A;  3NDI A;  2R93 I;  1VQO Z;  3VB9 A;  3NH4 A;  5C44 I;  4NBF A;  1L1O C;  1KD1 2;  4NBB A;  5AN9 F;  4NOZ A;  3TE5 B;  2GTI A;  2W04 A;  1VQK 1;  4NB8 A;  2KI7 B;  4QTT A;  1VQP Z;  1K9M 2;  2JNY A;  3CCV Z;  3I55 Z;  3I07 A;  3GTM S;  3CD6 1;  3I56 1;  1ZB8 A;  2VUM I;  4A3B I;  4A3D I;  1VQ6 Z;  1VQ9 Z;  3FQQ A;  1QVG Y;  5IT9 f;  1Z03 A;  4A3F I;  1W2B Y;  1X0T A;  4NH1 C;  5T67 A;  1RQF A;  1QVF Y;  1TWC I;  3CCU 1;  3BG1 B;  5T64 A;  3S14 I;  5A2Q f;  3CC2 1;  3PO3 S;  4XX2 A;  1VQK Z;  3D6W A;  1Q7Y 2;  3GTQ I;  4A3E I;  4E33 A;  4Y7N I;  5D1O A;  1YHQ Z;  1KQS Y;  1YJN Z;  4NBC A;  3S1R I;  3D9X A;  4MD9 A;  3CD6 Z;  4BY1 I;  3I56 Z;  3HOX I;  4BXX I;  3GKQ A;  4AYB A;  1VQ4 1;  2QEX 1;  4A3K I;  1RO2 A;  2PM9 A;  2DE7 A;  4BBR I;  2NVQ I;  4BBS I;  4MXU A;  2OOX B;  5FLX b;  1Q86 1;  3I4M I;  3HOU I;  1RNI A;  1Z01 A;  1M1K 2;  1TFI A;  2ZAE B;  4A3G I;  1VQN 1;  1X3W A;  3CC2 Z;  3S15 I;  3CCM 1;  1YUA A;  1K73 2;  3GTM I;  1RLY A;  1Q81 2;  4HH4 A;  4S1T A;  3CCR 1;  3HOV I;  4E30 A;  4E2X A;  1VQL 1;  4DGL A;  2OTL 1;  2RIQ A;  3BG0 B;  3F3P C;  4RVF A;  2NVX I;  1VQ4 Z;  2QEX Z;  3G6E 1;  3J7A 4;  1ZH1 A;  2DE5 A;  2JS4 A;  3I4N I;  2QR1 B;  2V8I A;  2QRE B;  3NDJ A;  2P3Y A;  2LFU A;  1Y1W I;  1P9N A;  3RZO I;  1N8R 2;  5IT9 b;  3GCF A;  3CCQ Z;  3GTJ I;  1DL6 A;  4E2W A;  1KD1 1;  4E2Y A;  1Q82 2;  2M48 A;  3J81 f;  1VQN Z;  3GTL I;  3CME 1;  5A2Q b;  3RZD I;  2E2J I;  2PMZ A;  4A3J I;  2P28 A;  3CCR Z;  2YU9 I;  2OZK A;  2JUB A;  1K9M 1;  1VQL Z;  3CQZ I;  1S7M A;  3MZK B;  3M3Y I;  4A3I I;  3M4O I;  2BJO A;  2OTJ 1;  3CC7 Z;  4NBH A;  3G6E Z;  2AKL A;  3CCE 1;  2JA6 I;  1I6H I;  4DK1 A;  3EER A;  2K5R A;  2E2I I;  3OW2 Z;  3VMG A;  1ZB9 A;  3H0G I;  3CCJ Z;  2QLV B;  3CXC Y;  2RT9 A;  4NBD A;  3T4N B;  1TWF I;  2EGT A;  3CME Z;  3CPW Z;  1VQ8 1;  4RS4 A;  4RVD A;  1I3Q I;  1QYP A;  3CC4 1;  2RPR A;  2F4M A;  3G4S 1;  2O53 A;  3VMH A;  1Q7Y 1;  4HGZ A;  2JMO A;  4NB9 A;  1RO4 A;  1YJ9 1;  3JAM f;  2JA7 I;  1USP B;  3S2D I;  2OTJ Z;  1JJ2 Z;  3LUS A;  1VQM 1;  1X3Z A;  2E9H A;  2QRC B;  2R7Z I;  2OOY B;  3FKI I;  3EED A;  1YIT 1;  4X6A I;  2F4O A;  4A93 I;  1M1K 1;  4NBG A;  3GTG I;  1YIJ 1;  3S1Q I;  3J81 b;  1TWH I;  1VQ8 Z;  4A3L I;  3CC4 Z;  3GTK I;  3G71 1;  1K73 1;  2I3C A;  1NUI A;  2RBL A;  1Q81 1;  3FQM A;  1SFO I;  1YJ9 Z;  1M90 2;  3CCU Z;  3OW2 Y;  2VF1 A;  3K7A I;  4NBE A;  1VLA A;  3S17 I;  3ESW A;  1VQM Z;  1KC8 2;  3S1M I;  1I50 I;  1YI2 1;  1YIT Z;  1LQL A;  4MH4 A;  3CCL 1;  4E32 A;  1YIJ Z;  1Q82 1;  1VQ5 1;  3CMA 1;  5CM2 M;  4RVH A;  2B63 I;  3G71 Z;  5IP7 I;  1USP A;  1Q86 2;  1VQO 1;  1WII A;  1K8A 2;  1JJ2 Y;  4MD8 A;  4A3C I;  2WB1 A;  2HU9 A;  3J80 f;  4MD7 A;  3CCM Z;  1QVG Z;  3IF8 A;  1YJW 1;  1NJI 2;  1JWH C;  1K83 I;  2WAQ A;  3CCV 1;  2OTL Z;  4BY7 I;  2R92 I;  3HOZ I;  1TWA I;  2IZ3 A;  3CCL Z;  3HOY I;  3IFU A;  1ML8 A;  2W03 A;  5D1O B;  1VQ5 Z;  4HGY A;  3GTO I;  2Q51 A;  4TNU A;  3H3V J;  3CCS 1;  2PK7 A;  3VMI A;  5LL6 f;  1S72 1;  2NVY I;  1YJW Z;  2GTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...