3CXCY

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cxcY00
2QEXZ 1JJ2Y 1YJNZ 1KQSY 1N8R2 1K732 1Q7Y1 1VQ8Z 1QVGY 3G6EZ 1M902 3CC71 3CCQZ 1VQMZ 3G4S1 3CCM1 1KC81 3CD61 1S721 1VQ91 1Q861 3CMEZ 1VQ51 3G711 1VQ4Z 3CPWY 1Q811 3CXCZ 1VQP1 3CC21 3CC41 1YI21 1VQ6Z 1QVFY 1YIJ1 1Q821 2QEX1 1VQKZ 1YJN1 1KD12 3OW2Z 1K8A2 1VQ81 1VQNZ 1M901 3G6E1 3CCEZ 3CCQ1 1W2BY 3CMAZ 1VQOZ 1YJ9Z 3CCVZ 3CCLZ 1NJI2 1K9M2 1JJ2Z 3CME1 1KQSZ 1K9M1 1VQ41 2OTJ1 1M1K2 1VQ61 1YITZ 3CCJZ 2QA4Z 3CCU1 1QVGZ 1N8R1 3I56Z 1K731 3CCSZ 1VQK1 2OTLZ 1K8A1 1VQN1 1YHQZ 3CCRZ 1Q862 1VQ5Z 3I55Z 1VQM1 3CC2Z 3CPWZ 1VQLZ 1Q812 1YJWZ 1VQ7Z 3CMA1 1VQO1 1QVFZ 1YJ91 3CCV1 1NJI1 3CCL1 3CXCY 1Q822 1Q7Y2 1M1K1 1YIT1 3CC7Z 3CCJ1 2QA41 1KD11 3I561 3G4SZ 3CCS1 3CCMZ 3CD6Z 3OW2Y 1W2BZ 2OTL1 1KC82 1S72Z 1VQ9Z 3G71Z 1YHQ1 1VQPZ 3CCR1 3CCE1 3CC4Z 3I551 2OTJZ 1YI2Z 1VQL1 1YJW1 1VQ71 1YIJZ 3CCUZ
chains in the Genus database with same CATH superfamily
1JJ2Y 1ZB9A 1KQSY 1VLAA 4Y7NI 5T6BA 1PFTA 1AA6A 1TWHI 4A3GI 1QVGY 3G6EZ 3FQMA 5C3EI 1VQMZ 2B63I 1KC81 1SIWA 3PO2I 1WCMI 1RO4A 1QF8A 1WZNA 5CM2M 2PM9A 1VQ91 2QKDA 3CMEZ 2KPIA 4A3DI 1YUKA 3JAMf 3G711 5T67A 3VB9A 2JA6I 3BG0B 1FDIA 2JIRA 3NH4A 2RIQA 5D1OA 2JMOA 2E9HA 3ESWA 1VQKZ 4NOZA 4NBCA 2KI7B 2NVTI 1VQ81 1TFIA 2W03A 3J81f 5LL6f 4E2ZA 3CCEZ 3I4NI 3CCQ1 3PO3S 1N2FA 4S1TA 4XX2A 4BBSI 1K9M2 4BY7I 2Q51A 5C44I 1Y8CA 3MZLB 2OTJ1 1VQ61 1YITZ 1WIIA 3I56Z 1K731 5IP7I 1K8A1 3I4MI 2GTIA 2DE7A 1VQ5Z 1VQM1 3CC2Z 3VMGA 4MD9A 4MRIA 4RVDA 1Y1VI 4NBGA 1QVFZ 1YJ91 4NBHA 3JAMb 1TWCI 2WAQA 2H85A 4Y52I 3CCJ1 3S1NI 3MONA 3TDHB 2GTHA 3CCS1 2JA8I 3F3FC 4BY1I 3NH8A 1VQ9Z 3J81b 4NH1C 1USPB 3VMHA 2QREB 3G71Z 3CCE1 2AKLA 4A3II 4X6AI 4E2XA 1YJW1 1VQ71 1Z03A 4E2YA 2JR6A 4BBRI 3CQZI 1ZH1A 1K732 1ML8A 3GTPI 4A3CI 1NUIA 4CL1A 1VQ8Z 2V8IA 2NVYI 2PK7A 3GTMI 2GU2A 3HOYI 3CCQZ 3G4S1 3CCM1 3CD61 3HOZI 2LFUA 5FLXf 2V8JA 1TWAI 1P9NA 1KRLA 2G2KA 1VQ51 3CC21 3CC41 2OOXB 1VQ6Z 3KIFA 1QVFY 2DE5A 2QEX1 3EEDA 3HOXI 2O53A 1X3ZA 2IV2X 1M901 2R7ZI 4A3KI 2E2II 2QRDB 1YJ9Z 3HOVI 1VQ41 3M4OI 4NBDA 3CCJZ 3NDJA 5C4XI 4MD8A 3CCSZ 3NFZA 2LIYA 3RZDI 2RBLA 2VPYA 2QR1B 1QXFA 4HGYA 2M48A 3GTOI 4QTTA 3CPWZ 1YJWZ 1VQ7Z 1VQO1 3HOWI 4BXXI 5FLXb 4DK1A 3CCV1 1NJI1 1WW9A 3CCL1 3GTLI 5D1PA 3IX0A 1M1K1 4RS4A 4MH4A 3PO3I 1Y1WI 1K83I 2HF1A 2JA7I 1I6HI 2JUBA 3G4SZ 3CCMZ 3CD6Z 3S1RI 1KC82 3J80f 2AYDA 3S15I 2Q4ZA 3CC4Z 4RV9A 4NBAA 1FDOA 1SFOI 3D2LA 1VQL1 2RPRA 2NVXI 1RLYA 3H3VJ 1NP6A 2QEXZ 1Y1VS 1Q7Y1 2HU9A 4A3EI 2VPXA 4HGZA 3CC71 3I07A 1ZB8A 1I3QI 2RHBA 1VQ4Z 3CPWY 2WB1A 2OOYB 4NB9A 3D9XA 2P28A 1YI21 3F3PC 2Y0SA 1X0TA 3HKZA 1YIJ1 2JIMA 2VPZA 2NAPA 1YJN1 1R9TI 3D6WA 3T4NB 4EWCA 3OW2Z 1K8A2 3S2HI 1RO0A 3VTNA 3HOUI 2JS4A 4E31A 1X3WA 3GTQI 3J80b 1S7MA 2F4MA 5IT9f 1VQOZ 3GTGI 3CCVZ 1WJ2A 2IZ3A 3CCLZ 2OZKA 4RVFA 3GTKI 2NVQI 1TWGI 4HH4A 3Q87A 1N8R1 3S14I 1JWHC 3IF8A 3EERA 5AN9F 1USPA 4NB8A 1VQN1 2JA5I 2YU9I 3VMIA 2E2JI 4A3MI 3S16I 4AYBA 4E2WA 5A2Qf 1VQLZ 2V3VA 3CMA1 2R93I 3GTJI 2ZAEB 4A3LI 3KIHA 2E7ZA 4NBFA 3S1MI 1Z02A 3GCFA 3CC7Z 2QA41 1KD11 3H0GI 2IZ4A 1LQLA 2LEXA 3OW2Y 1W2BZ 1YUAA 2OTL1 2K3RA 3NH5A 2E2HI 2O4HA 4A93I 1YHQ1 4E33A 3CCR1 3P5JB 3I551 1YI2Z 3M3YI 5IT9b 2VPWA 1DL6A 1YIJZ 2VUGA 2V45A 3CCUZ 2V8KA 2JIQA 1YJNZ 1N8R2 1QYPA 4E32A 4QTUA 1I50I 1M902 5C4JI 2BJOA 3S1QI 1RQFA 4E30A 1TWFI 1S721 2R92I 1Q861 2EGTA 1Q811 3CXCZ 1VQP1 5A2Qb 2K5RA 3RZOI 2QRCB 2DE6A 1RO2A 4NBEA 1Q821 3LUSA 2I3CA 3FQQA 1KD12 3IFUA 5IP9I 4A3FI 1VQNZ 2W04A 3G6E1 3NDIA 3MZKB 2VUMI 1W2BY 3CMAZ 1L1OC 2JNYA 3BG1B 1NJI2 1JJ2Z 3CME1 1KQSZ 1Z01A 3GKQA 1M1K2 2RT9A 2JIPA 4TNUA 2QA4Z 2M6NA 3CCU1 1QVGZ 3IR7A 4MD7A 5FLMI 1VQK1 3U50C 2OTLZ 2YADA 4RVGA 3FKII 3TE5B 3K7AI 2J6AA 1YHQZ 3CCRZ 4A3JI 2VF1A 1Q862 3I55Z 4DQYB 1Q812 4NBBA 2JIOA 3GTMS 4DGLA 4MONA 1Q16A 2P3YA 5T64A 2PMZA 3CXCY 1Q822 1Q7Y2 3S2DI 4NFRA 1YIT1 5D1OB 3QWUA 2R6MA 3I561 4A3BI 4RVHA 1S72Z 1RNIA 4MXUA 1VQPZ 2QLVB 3S17I 2OTJZ 3J7A4 2F4OA 1K9M1
chains in the Genus database with same CATH topology
1JJ2Y 1ZB9A 1KQSY 1VLAA 4Y7NI 5T6BA 1PFTA 1TWHI 4A3GI 1QVGY 3G6EZ 3FQMA 5C3EI 1VQMZ 2B63I 1KC81 3PO2I 1WCMI 1RO4A 1QF8A 5CM2M 2PM9A 1VQ91 2QKDA 3CMEZ 2KPIA 4A3DI 1YUKA 3JAMf 3G711 5T67A 3VB9A 2JA6I 3BG0B 3NH4A 2RIQA 5D1OA 2JMOA 2E9HA 3ESWA 1VQKZ 4NOZA 4NBCA 2KI7B 2NVTI 1VQ81 1TFIA 2W03A 3J81f 5LL6f 4E2ZA 3CCEZ 3I4NI 3CCQ1 3PO3S 1N2FA 4S1TA 4XX2A 4BBSI 1K9M2 4BY7I 2Q51A 5C44I 3MZLB 2OTJ1 1VQ61 1YITZ 1WIIA 3I56Z 1K731 5IP7I 1K8A1 3I4MI 2GTIA 2DE7A 1VQ5Z 1VQM1 3CC2Z 3VMGA 4MD9A 4MRIA 4RVDA 1Y1VI 4NBGA 1QVFZ 1YJ91 4NBHA 3JAMb 1TWCI 2WAQA 2H85A 4Y52I 3CCJ1 3S1NI 3MONA 3TDHB 2GTHA 3CCS1 2JA8I 3F3FC 4BY1I 3NH8A 1VQ9Z 3J81b 4NH1C 1USPB 3VMHA 2QREB 3G71Z 3CCE1 2AKLA 4A3II 4X6AI 4E2XA 1YJW1 1VQ71 1Z03A 4E2YA 2JR6A 4BBRI 3CQZI 1ZH1A 1K732 1ML8A 3GTPI 4A3CI 1NUIA 4CL1A 1VQ8Z 2V8IA 2NVYI 2PK7A 3GTMI 2GU2A 3HOYI 3CCQZ 3G4S1 3CCM1 3CD61 3HOZI 2LFUA 5FLXf 2V8JA 1TWAI 1P9NA 1KRLA 2G2KA 1VQ51 3CC21 3CC41 2OOXB 1VQ6Z 3KIFA 1QVFY 2DE5A 2QEX1 3EEDA 3HOXI 2O53A 1X3ZA 1M901 2R7ZI 4A3KI 2E2II 2QRDB 1YJ9Z 3HOVI 1VQ41 3M4OI 4NBDA 3CCJZ 3NDJA 5C4XI 4MD8A 3CCSZ 3NFZA 2LIYA 3RZDI 2RBLA 2QR1B 4HGYA 2M48A 3GTOI 4QTTA 3CPWZ 1YJWZ 1VQ7Z 1VQO1 3HOWI 4BXXI 5FLXb 4DK1A 3CCV1 1NJI1 1WW9A 3CCL1 3GTLI 5D1PA 3IX0A 1M1K1 4RS4A 4MH4A 3PO3I 1Y1WI 1K83I 2HF1A 2JA7I 1I6HI 2JUBA 3G4SZ 3CCMZ 3CD6Z 3S1RI 1KC82 3J80f 3S15I 2Q4ZA 3CC4Z 4RV9A 4NBAA 1SFOI 1VQL1 2RPRA 2NVXI 1RLYA 3H3VJ 1NP6A 2QEXZ 1Y1VS 1Q7Y1 2HU9A 4A3EI 4HGZA 3CC71 3I07A 1ZB8A 1I3QI 2RHBA 1VQ4Z 3CPWY 2WB1A 2OOYB 4NB9A 3D9XA 2P28A 1YI21 3F3PC 2Y0SA 1X0TA 3HKZA 1YIJ1 1YJN1 1R9TI 3D6WA 3T4NB 4EWCA 3OW2Z 1K8A2 3S2HI 1RO0A 3VTNA 3HOUI 2JS4A 4E31A 1X3WA 3GTQI 3J80b 1S7MA 2F4MA 5IT9f 1VQOZ 3GTGI 3CCVZ 2IZ3A 3CCLZ 2OZKA 4RVFA 3GTKI 2NVQI 1TWGI 4HH4A 3Q87A 1N8R1 3S14I 1JWHC 3IF8A 3EERA 5AN9F 1USPA 4NB8A 1VQN1 2JA5I 2YU9I 3VMIA 2E2JI 4A3MI 3S16I 4AYBA 4E2WA 5A2Qf 1VQLZ 3CMA1 2R93I 3GTJI 2ZAEB 4A3LI 3KIHA 4NBFA 3S1MI 1Z02A 3GCFA 3CC7Z 2QA41 1KD11 3H0GI 2IZ4A 1LQLA 3OW2Y 1W2BZ 1YUAA 2OTL1 2K3RA 3NH5A 2E2HI 2O4HA 4A93I 1YHQ1 4E33A 3CCR1 3P5JB 3I551 1YI2Z 3M3YI 5IT9b 1DL6A 1YIJZ 2VUGA 3CCUZ 2V8KA 1YJNZ 1N8R2 1QYPA 4E32A 4QTUA 1I50I 1M902 5C4JI 2BJOA 3S1QI 1RQFA 4E30A 1TWFI 1S721 2R92I 1Q861 2EGTA 1Q811 3CXCZ 1VQP1 5A2Qb 2K5RA 3RZOI 2QRCB 2DE6A 1RO2A 4NBEA 1Q821 3LUSA 2I3CA 3FQQA 1KD12 3IFUA 5IP9I 4A3FI 1VQNZ 2W04A 3G6E1 3NDIA 3MZKB 2VUMI 1W2BY 3CMAZ 1L1OC 2JNYA 3BG1B 1NJI2 1JJ2Z 3CME1 1KQSZ 1Z01A 3GKQA 1M1K2 2RT9A 4TNUA 2QA4Z 2M6NA 3CCU1 1QVGZ 4MD7A 5FLMI 1VQK1 3U50C 2OTLZ 2YADA 4RVGA 3FKII 3TE5B 3K7AI 2J6AA 1YHQZ 3CCRZ 4A3JI 2VF1A 1Q862 3I55Z 4DQYB 1Q812 4NBBA 3GTMS 4DGLA 4MONA 2P3YA 5T64A 2PMZA 3CXCY 1Q822 1Q7Y2 3S2DI 4NFRA 1YIT1 5D1OB 3QWUA 2R6MA 3I561 4A3BI 4RVHA 1S72Z 1RNIA 4MXUA 1VQPZ 2QLVB 3S17I 2OTJZ 3J7A4 2F4OA 1K9M1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Z;  1JJ2 Y;  1YJN Z;  1KQS Y;  1N8R 2;  1K73 2;  1Q7Y 1;  1VQ8 Z;  1QVG Y;  3G6E Z;  1M90 2;  3CC7 1;  3CCQ Z;  1VQM Z;  3G4S 1;  3CCM 1;  1KC8 1;  3CD6 1;  1S72 1;  1VQ9 1;  1Q86 1;  3CME Z;  1VQ5 1;  3G71 1;  1VQ4 Z;  3CPW Y;  1Q81 1;  3CXC Z;  1VQP 1;  3CC2 1;  3CC4 1;  1YI2 1;  1VQ6 Z;  1QVF Y;  1YIJ 1;  1Q82 1;  2QEX 1;  1VQK Z;  1YJN 1;  1KD1 2;  3OW2 Z;  1K8A 2;  1VQ8 1;  1VQN Z;  1M90 1;  3G6E 1;  3CCE Z;  3CCQ 1;  1W2B Y;  3CMA Z;  1VQO Z;  1YJ9 Z;  3CCV Z;  3CCL Z;  1NJI 2;  1K9M 2;  1JJ2 Z;  3CME 1;  1KQS Z;  1K9M 1;  1VQ4 1;  2OTJ 1;  1M1K 2;  1VQ6 1;  1YIT Z;  3CCJ Z;  2QA4 Z;  3CCU 1;  1QVG Z;  1N8R 1;  3I56 Z;  1K73 1;  3CCS Z;  1VQK 1;  2OTL Z;  1K8A 1;  1VQN 1;  1YHQ Z;  3CCR Z;  1Q86 2;  1VQ5 Z;  3I55 Z;  1VQM 1;  3CC2 Z;  3CPW Z;  1VQL Z;  1Q81 2;  1YJW Z;  1VQ7 Z;  3CMA 1;  1VQO 1;  1QVF Z;  1YJ9 1;  3CCV 1;  1NJI 1;  3CCL 1;  3CXC Y;  1Q82 2;  1Q7Y 2;  1M1K 1;  1YIT 1;  3CC7 Z;  3CCJ 1;  2QA4 1;  1KD1 1;  3I56 1;  3G4S Z;  3CCS 1;  3CCM Z;  3CD6 Z;  3OW2 Y;  1W2B Z;  2OTL 1;  1KC8 2;  1S72 Z;  1VQ9 Z;  3G71 Z;  1YHQ 1;  1VQP Z;  3CCR 1;  3CCE 1;  3CC4 Z;  3I55 1;  2OTJ Z;  1YI2 Z;  1VQL 1;  1YJW 1;  1VQ7 1;  1YIJ Z;  3CCU Z; 
#chains in the Genus database with same CATH topology
 1JJ2 Y;  1ZB9 A;  1KQS Y;  1VLA A;  4Y7N I;  5T6B A;  1PFT A;  1AA6 A;  1TWH I;  4A3G I;  1QVG Y;  3G6E Z;  3FQM A;  5C3E I;  1VQM Z;  2B63 I;  1KC8 1;  1SIW A;  3PO2 I;  1WCM I;  1RO4 A;  1QF8 A;  1WZN A;  5CM2 M;  2PM9 A;  1VQ9 1;  2QKD A;  3CME Z;  2KPI A;  4A3D I;  1YUK A;  3JAM f;  3G71 1;  5T67 A;  3VB9 A;  2JA6 I;  3BG0 B;  1FDI A;  2JIR A;  3NH4 A;  2RIQ A;  5D1O A;  2JMO A;  2E9H A;  3ESW A;  1VQK Z;  4NOZ A;  4NBC A;  2KI7 B;  2NVT I;  1VQ8 1;  1TFI A;  2W03 A;  3J81 f;  5LL6 f;  4E2Z A;  3CCE Z;  3I4N I;  3CCQ 1;  3PO3 S;  1N2F A;  4S1T A;  4XX2 A;  4BBS I;  1K9M 2;  4BY7 I;  2Q51 A;  5C44 I;  1Y8C A;  3MZL B;  2OTJ 1;  1VQ6 1;  1YIT Z;  1WII A;  3I56 Z;  1K73 1;  5IP7 I;  1K8A 1;  3I4M I;  2GTI A;  2DE7 A;  1VQ5 Z;  1VQM 1;  3CC2 Z;  3VMG A;  4MD9 A;  4MRI A;  4RVD A;  1Y1V I;  4NBG A;  1QVF Z;  1YJ9 1;  4NBH A;  3JAM b;  1TWC I;  2WAQ A;  2H85 A;  4Y52 I;  3CCJ 1;  3S1N I;  3MON A;  3TDH B;  2GTH A;  3CCS 1;  2JA8 I;  3F3F C;  4BY1 I;  3NH8 A;  1VQ9 Z;  3J81 b;  4NH1 C;  1USP B;  3VMH A;  2QRE B;  3G71 Z;  3CCE 1;  2AKL A;  4A3I I;  4X6A I;  4E2X A;  1YJW 1;  1VQ7 1;  1Z03 A;  4E2Y A;  2JR6 A;  4BBR I;  3CQZ I;  1ZH1 A;  1K73 2;  1ML8 A;  3GTP I;  4A3C I;  1NUI A;  4CL1 A;  1VQ8 Z;  2V8I A;  2NVY I;  2PK7 A;  3GTM I;  2GU2 A;  3HOY I;  3CCQ Z;  3G4S 1;  3CCM 1;  3CD6 1;  3HOZ I;  2LFU A;  5FLX f;  2V8J A;  1TWA I;  1P9N A;  1KRL A;  2G2K A;  1VQ5 1;  3CC2 1;  3CC4 1;  2OOX B;  1VQ6 Z;  3KIF A;  1QVF Y;  2DE5 A;  2QEX 1;  3EED A;  3HOX I;  2O53 A;  1X3Z A;  2IV2 X;  1M90 1;  2R7Z I;  4A3K I;  2E2I I;  2QRD B;  1YJ9 Z;  3HOV I;  1VQ4 1;  3M4O I;  4NBD A;  3CCJ Z;  3NDJ A;  5C4X I;  4MD8 A;  3CCS Z;  3NFZ A;  2LIY A;  3RZD I;  2RBL A;  2VPY A;  2QR1 B;  1QXF A;  4HGY A;  2M48 A;  3GTO I;  4QTT A;  3CPW Z;  1YJW Z;  1VQ7 Z;  1VQO 1;  3HOW I;  4BXX I;  5FLX b;  4DK1 A;  3CCV 1;  1NJI 1;  1WW9 A;  3CCL 1;  3GTL I;  5D1P A;  3IX0 A;  1M1K 1;  4RS4 A;  4MH4 A;  3PO3 I;  1Y1W I;  1K83 I;  2HF1 A;  2JA7 I;  1I6H I;  2JUB A;  3G4S Z;  3CCM Z;  3CD6 Z;  3S1R I;  1KC8 2;  3J80 f;  2AYD A;  3S15 I;  2Q4Z A;  3CC4 Z;  4RV9 A;  4NBA A;  1FDO A;  1SFO I;  3D2L A;  1VQL 1;  2RPR A;  2NVX I;  1RLY A;  3H3V J;  1NP6 A;  2QEX Z;  1Y1V S;  1Q7Y 1;  2HU9 A;  4A3E I;  2VPX A;  4HGZ A;  3CC7 1;  3I07 A;  1ZB8 A;  1I3Q I;  2RHB A;  1VQ4 Z;  3CPW Y;  2WB1 A;  2OOY B;  4NB9 A;  3D9X A;  2P28 A;  1YI2 1;  3F3P C;  2Y0S A;  1X0T A;  3HKZ A;  1YIJ 1;  2JIM A;  2VPZ A;  2NAP A;  1YJN 1;  1R9T I;  3D6W A;  3T4N B;  4EWC A;  3OW2 Z;  1K8A 2;  3S2H I;  1RO0 A;  3VTN A;  3HOU I;  2JS4 A;  4E31 A;  1X3W A;  3GTQ I;  3J80 b;  1S7M A;  2F4M A;  5IT9 f;  1VQO Z;  3GTG I;  3CCV Z;  1WJ2 A;  2IZ3 A;  3CCL Z;  2OZK A;  4RVF A;  3GTK I;  2NVQ I;  1TWG I;  4HH4 A;  3Q87 A;  1N8R 1;  3S14 I;  1JWH C;  3IF8 A;  3EER A;  5AN9 F;  1USP A;  4NB8 A;  1VQN 1;  2JA5 I;  2YU9 I;  3VMI A;  2E2J I;  4A3M I;  3S16 I;  4AYB A;  4E2W A;  5A2Q f;  1VQL Z;  2V3V A;  3CMA 1;  2R93 I;  3GTJ I;  2ZAE B;  4A3L I;  3KIH A;  2E7Z A;  4NBF A;  3S1M I;  1Z02 A;  3GCF A;  3CC7 Z;  2QA4 1;  1KD1 1;  3H0G I;  2IZ4 A;  1LQL A;  2LEX A;  3OW2 Y;  1W2B Z;  1YUA A;  2OTL 1;  2K3R A;  3NH5 A;  2E2H I;  2O4H A;  4A93 I;  1YHQ 1;  4E33 A;  3CCR 1;  3P5J B;  3I55 1;  1YI2 Z;  3M3Y I;  5IT9 b;  2VPW A;  1DL6 A;  1YIJ Z;  2VUG A;  2V45 A;  3CCU Z;  2V8K A;  2JIQ A;  1YJN Z;  1N8R 2;  1QYP A;  4E32 A;  4QTU A;  1I50 I;  1M90 2;  5C4J I;  2BJO A;  3S1Q I;  1RQF A;  4E30 A;  1TWF I;  1S72 1;  2R92 I;  1Q86 1;  2EGT A;  1Q81 1;  3CXC Z;  1VQP 1;  5A2Q b;  2K5R A;  3RZO I;  2QRC B;  2DE6 A;  1RO2 A;  4NBE A;  1Q82 1;  3LUS A;  2I3C A;  3FQQ A;  1KD1 2;  3IFU A;  5IP9 I;  4A3F I;  1VQN Z;  2W04 A;  3G6E 1;  3NDI A;  3MZK B;  2VUM I;  1W2B Y;  3CMA Z;  1L1O C;  2JNY A;  3BG1 B;  1NJI 2;  1JJ2 Z;  3CME 1;  1KQS Z;  1Z01 A;  3GKQ A;  1M1K 2;  2RT9 A;  2JIP A;  4TNU A;  2QA4 Z;  2M6N A;  3CCU 1;  1QVG Z;  3IR7 A;  4MD7 A;  5FLM I;  1VQK 1;  3U50 C;  2OTL Z;  2YAD A;  4RVG A;  3FKI I;  3TE5 B;  3K7A I;  2J6A A;  1YHQ Z;  3CCR Z;  4A3J I;  2VF1 A;  1Q86 2;  3I55 Z;  4DQY B;  1Q81 2;  4NBB A;  2JIO A;  3GTM S;  4DGL A;  4MON A;  1Q16 A;  2P3Y A;  5T64 A;  2PMZ A;  3CXC Y;  1Q82 2;  1Q7Y 2;  3S2D I;  4NFR A;  1YIT 1;  5D1O B;  3QWU A;  2R6M A;  3I56 1;  4A3B I;  4RVH A;  1S72 Z;  1RNI A;  4MXU A;  1VQP Z;  2QLV B;  3S17 I;  2OTJ Z;  3J7A 4;  2F4O A;  1K9M 1; 
#chains in the Genus database with same CATH homology
 1JJ2 Y;  1ZB9 A;  1KQS Y;  1VLA A;  4Y7N I;  5T6B A;  1PFT A;  1TWH I;  4A3G I;  1QVG Y;  3G6E Z;  3FQM A;  5C3E I;  1VQM Z;  2B63 I;  1KC8 1;  3PO2 I;  1WCM I;  1RO4 A;  1QF8 A;  5CM2 M;  2PM9 A;  1VQ9 1;  2QKD A;  3CME Z;  2KPI A;  4A3D I;  1YUK A;  3JAM f;  3G71 1;  5T67 A;  3VB9 A;  2JA6 I;  3BG0 B;  3NH4 A;  2RIQ A;  5D1O A;  2JMO A;  2E9H A;  3ESW A;  1VQK Z;  4NOZ A;  4NBC A;  2KI7 B;  2NVT I;  1VQ8 1;  1TFI A;  2W03 A;  3J81 f;  5LL6 f;  4E2Z A;  3CCE Z;  3I4N I;  3CCQ 1;  3PO3 S;  1N2F A;  4S1T A;  4XX2 A;  4BBS I;  1K9M 2;  4BY7 I;  2Q51 A;  5C44 I;  3MZL B;  2OTJ 1;  1VQ6 1;  1YIT Z;  1WII A;  3I56 Z;  1K73 1;  5IP7 I;  1K8A 1;  3I4M I;  2GTI A;  2DE7 A;  1VQ5 Z;  1VQM 1;  3CC2 Z;  3VMG A;  4MD9 A;  4MRI A;  4RVD A;  1Y1V I;  4NBG A;  1QVF Z;  1YJ9 1;  4NBH A;  3JAM b;  1TWC I;  2WAQ A;  2H85 A;  4Y52 I;  3CCJ 1;  3S1N I;  3MON A;  3TDH B;  2GTH A;  3CCS 1;  2JA8 I;  3F3F C;  4BY1 I;  3NH8 A;  1VQ9 Z;  3J81 b;  4NH1 C;  1USP B;  3VMH A;  2QRE B;  3G71 Z;  3CCE 1;  2AKL A;  4A3I I;  4X6A I;  4E2X A;  1YJW 1;  1VQ7 1;  1Z03 A;  4E2Y A;  2JR6 A;  4BBR I;  3CQZ I;  1ZH1 A;  1K73 2;  1ML8 A;  3GTP I;  4A3C I;  1NUI A;  4CL1 A;  1VQ8 Z;  2V8I A;  2NVY I;  2PK7 A;  3GTM I;  2GU2 A;  3HOY I;  3CCQ Z;  3G4S 1;  3CCM 1;  3CD6 1;  3HOZ I;  2LFU A;  5FLX f;  2V8J A;  1TWA I;  1P9N A;  1KRL A;  2G2K A;  1VQ5 1;  3CC2 1;  3CC4 1;  2OOX B;  1VQ6 Z;  3KIF A;  1QVF Y;  2DE5 A;  2QEX 1;  3EED A;  3HOX I;  2O53 A;  1X3Z A;  1M90 1;  2R7Z I;  4A3K I;  2E2I I;  2QRD B;  1YJ9 Z;  3HOV I;  1VQ4 1;  3M4O I;  4NBD A;  3CCJ Z;  3NDJ A;  5C4X I;  4MD8 A;  3CCS Z;  3NFZ A;  2LIY A;  3RZD I;  2RBL A;  2QR1 B;  4HGY A;  2M48 A;  3GTO I;  4QTT A;  3CPW Z;  1YJW Z;  1VQ7 Z;  1VQO 1;  3HOW I;  4BXX I;  5FLX b;  4DK1 A;  3CCV 1;  1NJI 1;  1WW9 A;  3CCL 1;  3GTL I;  5D1P A;  3IX0 A;  1M1K 1;  4RS4 A;  4MH4 A;  3PO3 I;  1Y1W I;  1K83 I;  2HF1 A;  2JA7 I;  1I6H I;  2JUB A;  3G4S Z;  3CCM Z;  3CD6 Z;  3S1R I;  1KC8 2;  3J80 f;  3S15 I;  2Q4Z A;  3CC4 Z;  4RV9 A;  4NBA A;  1SFO I;  1VQL 1;  2RPR A;  2NVX I;  1RLY A;  3H3V J;  1NP6 A;  2QEX Z;  1Y1V S;  1Q7Y 1;  2HU9 A;  4A3E I;  4HGZ A;  3CC7 1;  3I07 A;  1ZB8 A;  1I3Q I;  2RHB A;  1VQ4 Z;  3CPW Y;  2WB1 A;  2OOY B;  4NB9 A;  3D9X A;  2P28 A;  1YI2 1;  3F3P C;  2Y0S A;  1X0T A;  3HKZ A;  1YIJ 1;  1YJN 1;  1R9T I;  3D6W A;  3T4N B;  4EWC A;  3OW2 Z;  1K8A 2;  3S2H I;  1RO0 A;  3VTN A;  3HOU I;  2JS4 A;  4E31 A;  1X3W A;  3GTQ I;  3J80 b;  1S7M A;  2F4M A;  5IT9 f;  1VQO Z;  3GTG I;  3CCV Z;  2IZ3 A;  3CCL Z;  2OZK A;  4RVF A;  3GTK I;  2NVQ I;  1TWG I;  4HH4 A;  3Q87 A;  1N8R 1;  3S14 I;  1JWH C;  3IF8 A;  3EER A;  5AN9 F;  1USP A;  4NB8 A;  1VQN 1;  2JA5 I;  2YU9 I;  3VMI A;  2E2J I;  4A3M I;  3S16 I;  4AYB A;  4E2W A;  5A2Q f;  1VQL Z;  3CMA 1;  2R93 I;  3GTJ I;  2ZAE B;  4A3L I;  3KIH A;  4NBF A;  3S1M I;  1Z02 A;  3GCF A;  3CC7 Z;  2QA4 1;  1KD1 1;  3H0G I;  2IZ4 A;  1LQL A;  3OW2 Y;  1W2B Z;  1YUA A;  2OTL 1;  2K3R A;  3NH5 A;  2E2H I;  2O4H A;  4A93 I;  1YHQ 1;  4E33 A;  3CCR 1;  3P5J B;  3I55 1;  1YI2 Z;  3M3Y I;  5IT9 b;  1DL6 A;  1YIJ Z;  2VUG A;  3CCU Z;  2V8K A;  1YJN Z;  1N8R 2;  1QYP A;  4E32 A;  4QTU A;  1I50 I;  1M90 2;  5C4J I;  2BJO A;  3S1Q I;  1RQF A;  4E30 A;  1TWF I;  1S72 1;  2R92 I;  1Q86 1;  2EGT A;  1Q81 1;  3CXC Z;  1VQP 1;  5A2Q b;  2K5R A;  3RZO I;  2QRC B;  2DE6 A;  1RO2 A;  4NBE A;  1Q82 1;  3LUS A;  2I3C A;  3FQQ A;  1KD1 2;  3IFU A;  5IP9 I;  4A3F I;  1VQN Z;  2W04 A;  3G6E 1;  3NDI A;  3MZK B;  2VUM I;  1W2B Y;  3CMA Z;  1L1O C;  2JNY A;  3BG1 B;  1NJI 2;  1JJ2 Z;  3CME 1;  1KQS Z;  1Z01 A;  3GKQ A;  1M1K 2;  2RT9 A;  4TNU A;  2QA4 Z;  2M6N A;  3CCU 1;  1QVG Z;  4MD7 A;  5FLM I;  1VQK 1;  3U50 C;  2OTL Z;  2YAD A;  4RVG A;  3FKI I;  3TE5 B;  3K7A I;  2J6A A;  1YHQ Z;  3CCR Z;  4A3J I;  2VF1 A;  1Q86 2;  3I55 Z;  4DQY B;  1Q81 2;  4NBB A;  3GTM S;  4DGL A;  4MON A;  2P3Y A;  5T64 A;  2PMZ A;  3CXC Y;  1Q82 2;  1Q7Y 2;  3S2D I;  4NFR A;  1YIT 1;  5D1O B;  3QWU A;  2R6M A;  3I56 1;  4A3B I;  4RVH A;  1S72 Z;  1RNI A;  4MXU A;  1VQP Z;  2QLV B;  3S17 I;  2OTJ Z;  3J7A 4;  2F4O A;  1K9M 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...