1YUKA

The crystal structure of the psi/hybrid domain/ i-egf1 segment from the human integrin beta2 at 1.8 resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
94
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEQKQLSPQKVTLYLRPGQAAAFNVTFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-2 A chain
publication title The Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin {beta}2 Subunit at 1.8-A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 17
structure length 94
sequence length 99
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.150 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yukA02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1yukA01
3AL9A 3ZDYB 4WJKB 3NVQA 2VDMB 4WK4B 4O3UB 4FWWA 4WK2B 5E6UB 3OL2B 5E6SB 2VC2B 3AFCA 2VDKB 5E6RB 3ZE0B 1TYEB 3T3MB 2VDOB 2VDLB 2UZYB 3OKWA 4UM9D 2VDNB 4Z7NB 4O3TB 2P28A 2VDQB 3VI4B 1YUKA 4UM8B 3NIFB 3FCUB 3OKYB 4Z7OB 3AL8A 3ZDXB 4WK0B 3ZDZB 3ZE2B 3NIDB 1OLZA 2VDRB 5HDBB 2P26A 3NIGB 1SSLA 1SHYB 3AL8B 4GZ8A 4K3JB 3VI3B 1U8CB 3T3PB 3ZE1B 4Z7QB 4UM9B 2VDPB 3OL2A
chains in the Genus database with same CATH superfamily
1KD12 1Q812 1QVFZ 1VQPZ 2E9HA 1Z02A 1I6HI 3VMGA 2JIOA 2P3YA 4MD8A 3RZOI 3CC41 3S1MI 3OKWA 3CCEZ 5IP9I 3OKYB 5FLXb 2G2KA 2DE6A 4NBEA 2EGTA 3QWUA 3T3PB 3JAMf 2RIQA 4A3FI 4A3II 1RQFA 2QRDB 2JA7I 3CD6Z 2V8JA 5CM2M 2JIMA 2RBLA 3EERA 3CCJZ 3U50C 3CCSZ 1AA6A 3J81b 1X3ZA 1QF8A 4NOZA 3CCQZ 2R6MA 4HH4A 4QTUA 3T4NB 1WJ2A 2GTHA 4NBHA 2JWHA 4Z7QB 3FQQA 3CCVZ 1Q7Y1 4NFRA 4MRIA 3FQMA 2JUBA 3MONA 5T6BA 2VDMB 2BJOA 1VQ5Z 5E6SB 1KRLA 1ZH1A 5D1OB 3KIHA 3CD61 3JAMb 2NVYI 2OTJZ 3S1QI 1Y1VS 3NIDB 2AYDA 1Q822 1VQ7Z 2DE7A 2W04A 1QXFA 3D2LA 1USPB 3CCQ1 4DGLA 3PO3I 4NB8A 4A3JI 3ZDYB 4WJKB 3NVQA 1QYPA 3HOYI 2OTLZ 3KIFA 3H3VJ 4AYBA 3CMA1 2OOXB 3CCV1 1K8A2 2WB1A 1WCMI 1WIIA 3MZKB 2E2HI 3HOXI 3P5JB 3PO3S 1VQ4Z 3NFZA 4O3TB 3VI4B 1VQ51 1TWGI 4DK1A 3CPWY 4WK0B 1VQOZ 1WW9A 1TWAI 2PMZA 2VDPB 2DE5A 1YJNZ 1K731 2GU2A 5T67A 2E7ZA 3EEDA 3MZLB 4MH4A 3ESWA 1S72Z 4A3CI 1Q16A 2OTJ1 1NUIA 3CC4Z 2YU9I 4WK2B 5E6UB 3S16I 3LUSA 2VC2B 1YHQZ 4E2WA 2J6AA 4A3GI 4RVHA 1JJ2Y 4A93I 2OTL1 2JWGA 2H85A 2I3CA 1YJWZ 1TFIA 2IZ4A 1FDIA 1NJI1 1VQNZ 3AL8A 4A3BI 1YITZ 1VQ41 2P26A 4E33A 4MXUA 1VQO1 2VPXA 4O3UB 3CPWZ 1ML8A 1VQKZ 4E2YA 4BY7I 1YJN1 1K8A1 1S721 4RVDA 2KI7B 2VPZA 3S2HI 3S15I 1YHQ1 1KC82 5HDBB 1VQ6Z 4RVFA 4EWCA 2OOYB 1SSLA 4GZ8A 4K3JB 1RO0A 1JJ2Z 2V8IA 1YJW1 2VUGA 2RPRA 3CXCY 1Q862 1VQN1 4RV9A 3AL9A 2QR1B 2LEXA 1FDOA 1YIT1 4WK4B 2KPIA 2K5RA 4FWWA 2VUMI 2QEX1 1K83I 1Z01A 4BBSI 1VLAA 3I551 3K7AI 2Q51A 3I07A 4HGZA 2IV2X 1VQK1 1VQMZ 3IX0A 5C3EI 1JWHC 2JA5I 2NVQI 3G4S1 2NVTI 2F4OA 2PK7A 1DL6A 3HOZI 3HKZA 2M6NA 3G71Z 4UM9B 3CMAZ 2NAPA 2PM9A 1K732 4NBCA 2E2II 1I50I 3CME1 3F3PC 1VQ61 1M901 4NBDA 4XX2A 5A2Qf 1TYEB 1RNIA 1NP6A 2VDLB 2V3VA 3CXCZ 2V8KA 1NJI2 3H0GI 3ZDZB 1KC81 2QKDA 4QTTA 2W03A 2GTIA 2K3RA 3GCFA 1VQM1 3TDHB 1YI2Z 1ZB9A 1Q861 4MONA 5D1OA 4A3MI 4E2ZA 3GTKI 2JA8I 3TE5B 2O4HA 3G711 1N8R1 5C44I 2R93I 3FKII 1X0TA 1SFOI 2HU9A 2RT9A 3J7A4 3T3MB 4DQYB 2UZYB 4Z7NB 2P28A 3GTPI 1YUAA 1I3QI 3CC2Z 3I56Z 5D1PA 2VDRB 3M3YI 4A3DI 4NB9A 1K9M2 1KQSY 5A2Qb 2V45A 2F4MA 3CC7Z 2JS4A 3GTMI 3NDJA 2O53A 4MD9A 3HOWI 1VQ9Z 4A3EI 3CQZI 2QRCB 1YI21 1YJ9Z 2VPWA 4HGYA 3I4NI 3GTMS 3OW2Y 4A3LI 1WZNA 3GKQA 4NBGA 4X6AI 2YADA 1X3WA 2QEXZ 3NDIA 3F3FC 1VQ81 3CC21 2VPYA 3I55Z 3I561 1P9NA 2ZAEB 3S1RI 1M902 3OL2B 3ZE0B 3VB9A 4NH1C 3CCR1 3G4SZ 1KQSZ 3CC71 2E2JI 5IP7I 2VDNB 1N2FA 4E31A 4NBAA 5T64A 1YIJZ 1VQ91 3S2DI 3M4OI 3CCM1 1YJ91 2JA6I 4BXXI 3ZE2B 3CMEZ 3VMHA 1PFTA 2RHBA 1K9M1 3OW2Z 3S17I 3GTGI 1N8R2 2VDKB 3G6E1 2Y0SA 1R9TI 3IF8A 1TWFI 2JNYA 3CCU1 5C4JI 1VQLZ 1RO4A 5IT9f 2OZKA 3CCLZ 4NBFA 3NH4A 3RZDI 2JMOA 2M48A 2LIYA 4A3KI 3D9XA 5C4XI 1YIJ1 1M1K2 1L1OC 3IFUA 4E32A 1VQP1 1RLYA 2VDOB 3NH5A 1S7MA 3Q87A 3NIFB 2AKLA 3FCUB 4BBRI 3PO2I 1OLZA 3CCE1 1RO2A 4MD7A 1QVGY 1VQL1 3ZE1B 3ZDXB 2JR6A 3CCL1 1KD11 1Q811 2QREB 2VF1A 3GTQI 1TWHI 2QA4Z 5IT9b 3GTJI 1Y1VI 5E6RB 3HOUI 2Q4ZA 4UM8B 3CCJ1 1LQLA 1VQ8Z 3CCS1 1ZB8A 2R92I 1USPA 1SHYB 4Y7NI 3VI3B 2JIRA 3S14I 4BY1I 2R7ZI 3GTLI 1M1K1 3CCRZ 3HOVI 2JIQA 1W2BY 1Z03A 5AN9F 1Y1WI 4NBBA 3D6WA 3J80f 3BG0B 3GTOI 3S1NI 5FLMI 3CCMZ 5LL6f 4E30A 1QVGZ 4RS4A 2QA41 2VDQB 1QVFY 4RVGA 3IR7A 3VTNA 4CL1A 1TWCI 2B63I 3NIGB 3AL8B 2WAQA 2HF1A 5FLXf 3NH8A 1SIWA 4TNUA 2JIPA 3G6EZ 2QLVB 1VQ71 4Y52I 4S1TA 3CCUZ 3AFCA 3VMIA 4E2XA 2LFUA 2NVXI 4UM9D 1YUKA 4Z7OB 3BG1B 1W2BZ 3I4MI 1Q821 1Y8CA 3J81f 2IZ3A 3J80b 1Q7Y2 1U8CB 3OL2A
chains in the Genus database with same CATH topology
1KD12 1Q812 1QVFZ 1VQPZ 2E9HA 1Z02A 1I6HI 3VMGA 4MD8A 2P3YA 3RZOI 3CC41 3S1MI 3OKWA 3CCEZ 5IP9I 3OKYB 5FLXb 2G2KA 2DE6A 4NBEA 2EGTA 3QWUA 3T3PB 3JAMf 2RIQA 4A3FI 4A3II 1RQFA 2QRDB 2JA7I 3CD6Z 2V8JA 5CM2M 2RBLA 3EERA 3CCJZ 3U50C 3CCSZ 3J81b 1X3ZA 1QF8A 4NOZA 3CCQZ 2R6MA 4HH4A 4QTUA 3T4NB 2GTHA 4NBHA 2JWHA 4Z7QB 3FQQA 3CCVZ 1Q7Y1 4NFRA 4MRIA 3FQMA 2JUBA 3MONA 5T6BA 2VDMB 2BJOA 1VQ5Z 5E6SB 1KRLA 1ZH1A 5D1OB 3KIHA 3CD61 3JAMb 2NVYI 2OTJZ 3S1QI 1Y1VS 3NIDB 1Q822 1VQ7Z 2DE7A 2W04A 1USPB 3CCQ1 4DGLA 3PO3I 4NB8A 4A3JI 3ZDYB 4WJKB 3NVQA 1QYPA 3HOYI 2OTLZ 3KIFA 3H3VJ 4AYBA 3CMA1 2OOXB 3CCV1 1K8A2 2WB1A 1WCMI 1WIIA 3MZKB 2E2HI 3HOXI 3P5JB 3PO3S 1VQ4Z 3NFZA 4O3TB 3VI4B 1VQ51 1TWGI 4DK1A 3CPWY 4WK0B 1VQOZ 1WW9A 1TWAI 2PMZA 2VDPB 2DE5A 1YJNZ 1K731 2GU2A 5T67A 3EEDA 3MZLB 4MH4A 3ESWA 1S72Z 4A3CI 2OTJ1 1NUIA 3CC4Z 2YU9I 4WK2B 5E6UB 3S16I 3LUSA 2VC2B 1YHQZ 4E2WA 2J6AA 4A3GI 4RVHA 1JJ2Y 4A93I 2OTL1 2JWGA 2H85A 2I3CA 1YJWZ 1TFIA 2IZ4A 1NJI1 1VQNZ 3AL8A 4A3BI 1YITZ 1VQ41 2P26A 4E33A 4MXUA 1VQO1 4O3UB 3CPWZ 1ML8A 1VQKZ 4E2YA 4BY7I 1YJN1 1K8A1 1S721 4RVDA 2KI7B 3S2HI 3S15I 1YHQ1 1KC82 5HDBB 1VQ6Z 4RVFA 4EWCA 2OOYB 1SSLA 4GZ8A 4K3JB 1RO0A 1JJ2Z 2V8IA 1YJW1 2VUGA 2RPRA 3CXCY 1Q862 1VQN1 4RV9A 3AL9A 2QR1B 1YIT1 4WK4B 2KPIA 2K5RA 4FWWA 2VUMI 2QEX1 1K83I 1Z01A 4BBSI 1VLAA 3I551 3K7AI 2Q51A 3I07A 4HGZA 1VQK1 1VQMZ 3IX0A 5C3EI 1JWHC 2JA5I 2NVQI 3G4S1 2NVTI 2F4OA 2PK7A 1DL6A 3HOZI 3HKZA 2M6NA 3G71Z 4UM9B 3CMAZ 2PM9A 1K732 4NBCA 2E2II 1I50I 3CME1 3F3PC 1VQ61 1M901 4NBDA 4XX2A 5A2Qf 1TYEB 1RNIA 1NP6A 2VDLB 3CXCZ 2V8KA 1NJI2 3H0GI 3ZDZB 1KC81 2QKDA 4QTTA 2W03A 2GTIA 2K3RA 3GCFA 1VQM1 3TDHB 1YI2Z 1ZB9A 1Q861 4MONA 5D1OA 4A3MI 4E2ZA 3GTKI 2JA8I 3TE5B 2O4HA 3G711 1N8R1 5C44I 2R93I 3FKII 1X0TA 1SFOI 2HU9A 2RT9A 3J7A4 3T3MB 4DQYB 2UZYB 4Z7NB 2P28A 3GTPI 1YUAA 1I3QI 3CC2Z 3I56Z 5D1PA 2VDRB 3M3YI 4A3DI 4NB9A 1K9M2 1KQSY 5A2Qb 2F4MA 3CC7Z 2JS4A 3GTMI 3NDJA 2O53A 4MD9A 3HOWI 1VQ9Z 4A3EI 3CQZI 2QRCB 1YI21 1YJ9Z 4HGYA 3I4NI 3GTMS 3OW2Y 4A3LI 3GKQA 4NBGA 4X6AI 2YADA 1X3WA 2QEXZ 3NDIA 3F3FC 1VQ81 3CC21 3I55Z 3I561 1P9NA 2ZAEB 3S1RI 1M902 3OL2B 3ZE0B 3VB9A 4NH1C 3CCR1 3G4SZ 1KQSZ 3CC71 2E2JI 5IP7I 2VDNB 1N2FA 4E31A 4NBAA 5T64A 1YIJZ 1VQ91 3S2DI 3M4OI 3CCM1 1YJ91 2JA6I 4BXXI 3ZE2B 3CMEZ 3VMHA 1PFTA 2RHBA 1K9M1 3OW2Z 3S17I 3GTGI 1N8R2 2VDKB 3G6E1 2Y0SA 1R9TI 3IF8A 1TWFI 2JNYA 3CCU1 5C4JI 1VQLZ 1RO4A 5IT9f 2OZKA 3CCLZ 4NBFA 3NH4A 3RZDI 2JMOA 2M48A 2LIYA 4A3KI 3D9XA 5C4XI 1YIJ1 1M1K2 1L1OC 3IFUA 4E32A 1VQP1 1RLYA 2VDOB 3NH5A 1S7MA 3Q87A 3NIFB 2AKLA 3FCUB 4BBRI 3PO2I 1OLZA 3CCE1 1RO2A 4MD7A 1QVGY 1VQL1 3ZE1B 3ZDXB 2JR6A 3CCL1 1KD11 1Q811 2QREB 2VF1A 3GTQI 1TWHI 2QA4Z 5IT9b 3GTJI 1Y1VI 5E6RB 3HOUI 2Q4ZA 4UM8B 3CCJ1 1LQLA 1VQ8Z 3CCS1 1ZB8A 2R92I 1USPA 1SHYB 4Y7NI 3VI3B 3S14I 4BY1I 2R7ZI 3GTLI 1M1K1 3CCRZ 3HOVI 1W2BY 1Z03A 5AN9F 1Y1WI 4NBBA 3D6WA 3J80f 3BG0B 3GTOI 3S1NI 5FLMI 3CCMZ 5LL6f 4E30A 1QVGZ 4RS4A 2QA41 2VDQB 1QVFY 4RVGA 3VTNA 4CL1A 1TWCI 2B63I 3NIGB 3AL8B 2WAQA 2HF1A 5FLXf 3NH8A 4TNUA 3G6EZ 2QLVB 1VQ71 4Y52I 4S1TA 3CCUZ 3AFCA 3VMIA 4E2XA 2LFUA 2NVXI 4UM9D 1YUKA 4Z7OB 3BG1B 1W2BZ 3I4MI 1Q821 3J81f 2IZ3A 3J80b 1Q7Y2 1U8CB 3OL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL9 A;  3ZDY B;  4WJK B;  3NVQ A;  2VDM B;  4WK4 B;  4O3U B;  4FWW A;  4WK2 B;  5E6U B;  3OL2 B;  5E6S B;  2VC2 B;  3AFC A;  2VDK B;  5E6R B;  3ZE0 B;  1TYE B;  3T3M B;  2VDO B;  2VDL B;  2UZY B;  3OKW A;  4UM9 D;  2VDN B;  4Z7N B;  4O3T B;  2P28 A;  2VDQ B;  3VI4 B;  1YUK A;  4UM8 B;  3NIF B;  3FCU B;  3OKY B;  4Z7O B;  3AL8 A;  3ZDX B;  4WK0 B;  3ZDZ B;  3ZE2 B;  3NID B;  1OLZ A;  2VDR B;  5HDB B;  2P26 A;  3NIG B;  1SSL A;  1SHY B;  3AL8 B;  4GZ8 A;  4K3J B;  3VI3 B;  1U8C B;  3T3P B;  3ZE1 B;  4Z7Q B;  4UM9 B;  2VDP B;  3OL2 A; 
#chains in the Genus database with same CATH topology
 1KD1 2;  1Q81 2;  1QVF Z;  1VQP Z;  2E9H A;  1Z02 A;  1I6H I;  3VMG A;  2JIO A;  2P3Y A;  4MD8 A;  3RZO I;  3CC4 1;  3S1M I;  3OKW A;  3CCE Z;  5IP9 I;  3OKY B;  5FLX b;  2G2K A;  2DE6 A;  4NBE A;  2EGT A;  3QWU A;  3T3P B;  3JAM f;  2RIQ A;  4A3F I;  4A3I I;  1RQF A;  2QRD B;  2JA7 I;  3CD6 Z;  2V8J A;  5CM2 M;  2JIM A;  2RBL A;  3EER A;  3CCJ Z;  3U50 C;  3CCS Z;  1AA6 A;  3J81 b;  1X3Z A;  1QF8 A;  4NOZ A;  3CCQ Z;  2R6M A;  4HH4 A;  4QTU A;  3T4N B;  1WJ2 A;  2GTH A;  4NBH A;  2JWH A;  4Z7Q B;  3FQQ A;  3CCV Z;  1Q7Y 1;  4NFR A;  4MRI A;  3FQM A;  2JUB A;  3MON A;  5T6B A;  2VDM B;  2BJO A;  1VQ5 Z;  5E6S B;  1KRL A;  1ZH1 A;  5D1O B;  3KIH A;  3CD6 1;  3JAM b;  2NVY I;  2OTJ Z;  3S1Q I;  1Y1V S;  3NID B;  2AYD A;  1Q82 2;  1VQ7 Z;  2DE7 A;  2W04 A;  1QXF A;  3D2L A;  1USP B;  3CCQ 1;  4DGL A;  3PO3 I;  4NB8 A;  4A3J I;  3ZDY B;  4WJK B;  3NVQ A;  1QYP A;  3HOY I;  2OTL Z;  3KIF A;  3H3V J;  4AYB A;  3CMA 1;  2OOX B;  3CCV 1;  1K8A 2;  2WB1 A;  1WCM I;  1WII A;  3MZK B;  2E2H I;  3HOX I;  3P5J B;  3PO3 S;  1VQ4 Z;  3NFZ A;  4O3T B;  3VI4 B;  1VQ5 1;  1TWG I;  4DK1 A;  3CPW Y;  4WK0 B;  1VQO Z;  1WW9 A;  1TWA I;  2PMZ A;  2VDP B;  2DE5 A;  1YJN Z;  1K73 1;  2GU2 A;  5T67 A;  2E7Z A;  3EED A;  3MZL B;  4MH4 A;  3ESW A;  1S72 Z;  4A3C I;  1Q16 A;  2OTJ 1;  1NUI A;  3CC4 Z;  2YU9 I;  4WK2 B;  5E6U B;  3S16 I;  3LUS A;  2VC2 B;  1YHQ Z;  4E2W A;  2J6A A;  4A3G I;  4RVH A;  1JJ2 Y;  4A93 I;  2OTL 1;  2JWG A;  2H85 A;  2I3C A;  1YJW Z;  1TFI A;  2IZ4 A;  1FDI A;  1NJI 1;  1VQN Z;  3AL8 A;  4A3B I;  1YIT Z;  1VQ4 1;  2P26 A;  4E33 A;  4MXU A;  1VQO 1;  2VPX A;  4O3U B;  3CPW Z;  1ML8 A;  1VQK Z;  4E2Y A;  4BY7 I;  1YJN 1;  1K8A 1;  1S72 1;  4RVD A;  2KI7 B;  2VPZ A;  3S2H I;  3S15 I;  1YHQ 1;  1KC8 2;  5HDB B;  1VQ6 Z;  4RVF A;  4EWC A;  2OOY B;  1SSL A;  4GZ8 A;  4K3J B;  1RO0 A;  1JJ2 Z;  2V8I A;  1YJW 1;  2VUG A;  2RPR A;  3CXC Y;  1Q86 2;  1VQN 1;  4RV9 A;  3AL9 A;  2QR1 B;  2LEX A;  1FDO A;  1YIT 1;  4WK4 B;  2KPI A;  2K5R A;  4FWW A;  2VUM I;  2QEX 1;  1K83 I;  1Z01 A;  4BBS I;  1VLA A;  3I55 1;  3K7A I;  2Q51 A;  3I07 A;  4HGZ A;  2IV2 X;  1VQK 1;  1VQM Z;  3IX0 A;  5C3E I;  1JWH C;  2JA5 I;  2NVQ I;  3G4S 1;  2NVT I;  2F4O A;  2PK7 A;  1DL6 A;  3HOZ I;  3HKZ A;  2M6N A;  3G71 Z;  4UM9 B;  3CMA Z;  2NAP A;  2PM9 A;  1K73 2;  4NBC A;  2E2I I;  1I50 I;  3CME 1;  3F3P C;  1VQ6 1;  1M90 1;  4NBD A;  4XX2 A;  5A2Q f;  1TYE B;  1RNI A;  1NP6 A;  2VDL B;  2V3V A;  3CXC Z;  2V8K A;  1NJI 2;  3H0G I;  3ZDZ B;  1KC8 1;  2QKD A;  4QTT A;  2W03 A;  2GTI A;  2K3R A;  3GCF A;  1VQM 1;  3TDH B;  1YI2 Z;  1ZB9 A;  1Q86 1;  4MON A;  5D1O A;  4A3M I;  4E2Z A;  3GTK I;  2JA8 I;  3TE5 B;  2O4H A;  3G71 1;  1N8R 1;  5C44 I;  2R93 I;  3FKI I;  1X0T A;  1SFO I;  2HU9 A;  2RT9 A;  3J7A 4;  3T3M B;  4DQY B;  2UZY B;  4Z7N B;  2P28 A;  3GTP I;  1YUA A;  1I3Q I;  3CC2 Z;  3I56 Z;  5D1P A;  2VDR B;  3M3Y I;  4A3D I;  4NB9 A;  1K9M 2;  1KQS Y;  5A2Q b;  2V45 A;  2F4M A;  3CC7 Z;  2JS4 A;  3GTM I;  3NDJ A;  2O53 A;  4MD9 A;  3HOW I;  1VQ9 Z;  4A3E I;  3CQZ I;  2QRC B;  1YI2 1;  1YJ9 Z;  2VPW A;  4HGY A;  3I4N I;  3GTM S;  3OW2 Y;  4A3L I;  1WZN A;  3GKQ A;  4NBG A;  4X6A I;  2YAD A;  1X3W A;  2QEX Z;  3NDI A;  3F3F C;  1VQ8 1;  3CC2 1;  2VPY A;  3I55 Z;  3I56 1;  1P9N A;  2ZAE B;  3S1R I;  1M90 2;  3OL2 B;  3ZE0 B;  3VB9 A;  4NH1 C;  3CCR 1;  3G4S Z;  1KQS Z;  3CC7 1;  2E2J I;  5IP7 I;  2VDN B;  1N2F A;  4E31 A;  4NBA A;  5T64 A;  1YIJ Z;  1VQ9 1;  3S2D I;  3M4O I;  3CCM 1;  1YJ9 1;  2JA6 I;  4BXX I;  3ZE2 B;  3CME Z;  3VMH A;  1PFT A;  2RHB A;  1K9M 1;  3OW2 Z;  3S17 I;  3GTG I;  1N8R 2;  2VDK B;  3G6E 1;  2Y0S A;  1R9T I;  3IF8 A;  1TWF I;  2JNY A;  3CCU 1;  5C4J I;  1VQL Z;  1RO4 A;  5IT9 f;  2OZK A;  3CCL Z;  4NBF A;  3NH4 A;  3RZD I;  2JMO A;  2M48 A;  2LIY A;  4A3K I;  3D9X A;  5C4X I;  1YIJ 1;  1M1K 2;  1L1O C;  3IFU A;  4E32 A;  1VQP 1;  1RLY A;  2VDO B;  3NH5 A;  1S7M A;  3Q87 A;  3NIF B;  2AKL A;  3FCU B;  4BBR I;  3PO2 I;  1OLZ A;  3CCE 1;  1RO2 A;  4MD7 A;  1QVG Y;  1VQL 1;  3ZE1 B;  3ZDX B;  2JR6 A;  3CCL 1;  1KD1 1;  1Q81 1;  2QRE B;  2VF1 A;  3GTQ I;  1TWH I;  2QA4 Z;  5IT9 b;  3GTJ I;  1Y1V I;  5E6R B;  3HOU I;  2Q4Z A;  4UM8 B;  3CCJ 1;  1LQL A;  1VQ8 Z;  3CCS 1;  1ZB8 A;  2R92 I;  1USP A;  1SHY B;  4Y7N I;  3VI3 B;  2JIR A;  3S14 I;  4BY1 I;  2R7Z I;  3GTL I;  1M1K 1;  3CCR Z;  3HOV I;  2JIQ A;  1W2B Y;  1Z03 A;  5AN9 F;  1Y1W I;  4NBB A;  3D6W A;  3J80 f;  3BG0 B;  3GTO I;  3S1N I;  5FLM I;  3CCM Z;  5LL6 f;  4E30 A;  1QVG Z;  4RS4 A;  2QA4 1;  2VDQ B;  1QVF Y;  4RVG A;  3IR7 A;  3VTN A;  4CL1 A;  1TWC I;  2B63 I;  3NIG B;  3AL8 B;  2WAQ A;  2HF1 A;  5FLX f;  3NH8 A;  1SIW A;  4TNU A;  2JIP A;  3G6E Z;  2QLV B;  1VQ7 1;  4Y52 I;  4S1T A;  3CCU Z;  3AFC A;  3VMI A;  4E2X A;  2LFU A;  2NVX I;  4UM9 D;  1YUK A;  4Z7O B;  3BG1 B;  1W2B Z;  3I4M I;  1Q82 1;  1Y8C A;  3J81 f;  2IZ3 A;  3J80 b;  1Q7Y 2;  1U8C B;  3OL2 A; 
#chains in the Genus database with same CATH homology
 1KD1 2;  1Q81 2;  1QVF Z;  1VQP Z;  2E9H A;  1Z02 A;  1I6H I;  3VMG A;  4MD8 A;  2P3Y A;  3RZO I;  3CC4 1;  3S1M I;  3OKW A;  3CCE Z;  5IP9 I;  3OKY B;  5FLX b;  2G2K A;  2DE6 A;  4NBE A;  2EGT A;  3QWU A;  3T3P B;  3JAM f;  2RIQ A;  4A3F I;  4A3I I;  1RQF A;  2QRD B;  2JA7 I;  3CD6 Z;  2V8J A;  5CM2 M;  2RBL A;  3EER A;  3CCJ Z;  3U50 C;  3CCS Z;  3J81 b;  1X3Z A;  1QF8 A;  4NOZ A;  3CCQ Z;  2R6M A;  4HH4 A;  4QTU A;  3T4N B;  2GTH A;  4NBH A;  2JWH A;  4Z7Q B;  3FQQ A;  3CCV Z;  1Q7Y 1;  4NFR A;  4MRI A;  3FQM A;  2JUB A;  3MON A;  5T6B A;  2VDM B;  2BJO A;  1VQ5 Z;  5E6S B;  1KRL A;  1ZH1 A;  5D1O B;  3KIH A;  3CD6 1;  3JAM b;  2NVY I;  2OTJ Z;  3S1Q I;  1Y1V S;  3NID B;  1Q82 2;  1VQ7 Z;  2DE7 A;  2W04 A;  1USP B;  3CCQ 1;  4DGL A;  3PO3 I;  4NB8 A;  4A3J I;  3ZDY B;  4WJK B;  3NVQ A;  1QYP A;  3HOY I;  2OTL Z;  3KIF A;  3H3V J;  4AYB A;  3CMA 1;  2OOX B;  3CCV 1;  1K8A 2;  2WB1 A;  1WCM I;  1WII A;  3MZK B;  2E2H I;  3HOX I;  3P5J B;  3PO3 S;  1VQ4 Z;  3NFZ A;  4O3T B;  3VI4 B;  1VQ5 1;  1TWG I;  4DK1 A;  3CPW Y;  4WK0 B;  1VQO Z;  1WW9 A;  1TWA I;  2PMZ A;  2VDP B;  2DE5 A;  1YJN Z;  1K73 1;  2GU2 A;  5T67 A;  3EED A;  3MZL B;  4MH4 A;  3ESW A;  1S72 Z;  4A3C I;  2OTJ 1;  1NUI A;  3CC4 Z;  2YU9 I;  4WK2 B;  5E6U B;  3S16 I;  3LUS A;  2VC2 B;  1YHQ Z;  4E2W A;  2J6A A;  4A3G I;  4RVH A;  1JJ2 Y;  4A93 I;  2OTL 1;  2JWG A;  2H85 A;  2I3C A;  1YJW Z;  1TFI A;  2IZ4 A;  1NJI 1;  1VQN Z;  3AL8 A;  4A3B I;  1YIT Z;  1VQ4 1;  2P26 A;  4E33 A;  4MXU A;  1VQO 1;  4O3U B;  3CPW Z;  1ML8 A;  1VQK Z;  4E2Y A;  4BY7 I;  1YJN 1;  1K8A 1;  1S72 1;  4RVD A;  2KI7 B;  3S2H I;  3S15 I;  1YHQ 1;  1KC8 2;  5HDB B;  1VQ6 Z;  4RVF A;  4EWC A;  2OOY B;  1SSL A;  4GZ8 A;  4K3J B;  1RO0 A;  1JJ2 Z;  2V8I A;  1YJW 1;  2VUG A;  2RPR A;  3CXC Y;  1Q86 2;  1VQN 1;  4RV9 A;  3AL9 A;  2QR1 B;  1YIT 1;  4WK4 B;  2KPI A;  2K5R A;  4FWW A;  2VUM I;  2QEX 1;  1K83 I;  1Z01 A;  4BBS I;  1VLA A;  3I55 1;  3K7A I;  2Q51 A;  3I07 A;  4HGZ A;  1VQK 1;  1VQM Z;  3IX0 A;  5C3E I;  1JWH C;  2JA5 I;  2NVQ I;  3G4S 1;  2NVT I;  2F4O A;  2PK7 A;  1DL6 A;  3HOZ I;  3HKZ A;  2M6N A;  3G71 Z;  4UM9 B;  3CMA Z;  2PM9 A;  1K73 2;  4NBC A;  2E2I I;  1I50 I;  3CME 1;  3F3P C;  1VQ6 1;  1M90 1;  4NBD A;  4XX2 A;  5A2Q f;  1TYE B;  1RNI A;  1NP6 A;  2VDL B;  3CXC Z;  2V8K A;  1NJI 2;  3H0G I;  3ZDZ B;  1KC8 1;  2QKD A;  4QTT A;  2W03 A;  2GTI A;  2K3R A;  3GCF A;  1VQM 1;  3TDH B;  1YI2 Z;  1ZB9 A;  1Q86 1;  4MON A;  5D1O A;  4A3M I;  4E2Z A;  3GTK I;  2JA8 I;  3TE5 B;  2O4H A;  3G71 1;  1N8R 1;  5C44 I;  2R93 I;  3FKI I;  1X0T A;  1SFO I;  2HU9 A;  2RT9 A;  3J7A 4;  3T3M B;  4DQY B;  2UZY B;  4Z7N B;  2P28 A;  3GTP I;  1YUA A;  1I3Q I;  3CC2 Z;  3I56 Z;  5D1P A;  2VDR B;  3M3Y I;  4A3D I;  4NB9 A;  1K9M 2;  1KQS Y;  5A2Q b;  2F4M A;  3CC7 Z;  2JS4 A;  3GTM I;  3NDJ A;  2O53 A;  4MD9 A;  3HOW I;  1VQ9 Z;  4A3E I;  3CQZ I;  2QRC B;  1YI2 1;  1YJ9 Z;  4HGY A;  3I4N I;  3GTM S;  3OW2 Y;  4A3L I;  3GKQ A;  4NBG A;  4X6A I;  2YAD A;  1X3W A;  2QEX Z;  3NDI A;  3F3F C;  1VQ8 1;  3CC2 1;  3I55 Z;  3I56 1;  1P9N A;  2ZAE B;  3S1R I;  1M90 2;  3OL2 B;  3ZE0 B;  3VB9 A;  4NH1 C;  3CCR 1;  3G4S Z;  1KQS Z;  3CC7 1;  2E2J I;  5IP7 I;  2VDN B;  1N2F A;  4E31 A;  4NBA A;  5T64 A;  1YIJ Z;  1VQ9 1;  3S2D I;  3M4O I;  3CCM 1;  1YJ9 1;  2JA6 I;  4BXX I;  3ZE2 B;  3CME Z;  3VMH A;  1PFT A;  2RHB A;  1K9M 1;  3OW2 Z;  3S17 I;  3GTG I;  1N8R 2;  2VDK B;  3G6E 1;  2Y0S A;  1R9T I;  3IF8 A;  1TWF I;  2JNY A;  3CCU 1;  5C4J I;  1VQL Z;  1RO4 A;  5IT9 f;  2OZK A;  3CCL Z;  4NBF A;  3NH4 A;  3RZD I;  2JMO A;  2M48 A;  2LIY A;  4A3K I;  3D9X A;  5C4X I;  1YIJ 1;  1M1K 2;  1L1O C;  3IFU A;  4E32 A;  1VQP 1;  1RLY A;  2VDO B;  3NH5 A;  1S7M A;  3Q87 A;  3NIF B;  2AKL A;  3FCU B;  4BBR I;  3PO2 I;  1OLZ A;  3CCE 1;  1RO2 A;  4MD7 A;  1QVG Y;  1VQL 1;  3ZE1 B;  3ZDX B;  2JR6 A;  3CCL 1;  1KD1 1;  1Q81 1;  2QRE B;  2VF1 A;  3GTQ I;  1TWH I;  2QA4 Z;  5IT9 b;  3GTJ I;  1Y1V I;  5E6R B;  3HOU I;  2Q4Z A;  4UM8 B;  3CCJ 1;  1LQL A;  1VQ8 Z;  3CCS 1;  1ZB8 A;  2R92 I;  1USP A;  1SHY B;  4Y7N I;  3VI3 B;  3S14 I;  4BY1 I;  2R7Z I;  3GTL I;  1M1K 1;  3CCR Z;  3HOV I;  1W2B Y;  1Z03 A;  5AN9 F;  1Y1W I;  4NBB A;  3D6W A;  3J80 f;  3BG0 B;  3GTO I;  3S1N I;  5FLM I;  3CCM Z;  5LL6 f;  4E30 A;  1QVG Z;  4RS4 A;  2QA4 1;  2VDQ B;  1QVF Y;  4RVG A;  3VTN A;  4CL1 A;  1TWC I;  2B63 I;  3NIG B;  3AL8 B;  2WAQ A;  2HF1 A;  5FLX f;  3NH8 A;  4TNU A;  3G6E Z;  2QLV B;  1VQ7 1;  4Y52 I;  4S1T A;  3CCU Z;  3AFC A;  3VMI A;  4E2X A;  2LFU A;  2NVX I;  4UM9 D;  1YUK A;  4Z7O B;  3BG1 B;  1W2B Z;  3I4M I;  1Q82 1;  3J81 f;  2IZ3 A;  3J80 b;  1Q7Y 2;  1U8C B;  3OL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...