1YUKA

The crystal structure of the psi/hybrid domain/ i-egf1 segment from the human integrin beta2 at 1.8 resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
94
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEQKQLSPQKVTLYLRPGQAAAFNVTFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Integrin beta-2 A chain
publication title The Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin {beta}2 Subunit at 1.8-A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 94
sequence length 99
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.150 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yukA02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1yukA01
5E6RB 4UM9D 3ZE2B 3AL8A 4GZ8A 1YUKA 2VDNB 2VDPB 3NIGB 3NIFB 3OL2A 3OKWA 5E6SB 4Z7OB 4UM9B 4WJKB 2VDRB 2VDLB 4WK0B 3FCUB 2VDQB 4FWWA 3VI4B 5E6UB 4WK2B 4O3UB 1U8CB 3OKYB 3ZDXB 3ZE1B 3AL9A 1SSLA 2UZYB 3AL8B 4K3JB 4WK4B 3T3PB 3AFCA 2P26A 2VC2B 3ZDZB 3OL2B 3ZE0B 4Z7NB 2P28A 3T3MB 5HDBB 4UM8B 1TYEB 2VDMB 1SHYB 1OLZA 2VDKB 4O3TB 2VDOB 3NVQA 3ZDYB 4Z7QB 3VI3B 3NIDB
chains in the Genus database with same CATH superfamily
3HKZA 3G6E1 2F4MA 3CCM1 4A3BI 5D1OA 1TWFI 3ZDZB 1FDIA 3CCQ1 3KIHA 3CC21 4DGLA 4E2YA 1ZB8A 4HGZA 3HOWI 2J6AA 3ZDYB 3IR7A 1Z03A 2GTHA 2IV2X 2E9HA 1JJ2Z 3S2DI 1USPA 1FDOA 3G4SZ 3S14I 1Q811 3I55Z 3NDIA 4MD8A 1I6HI 2R93I 3CXCZ 2QEXZ 4A3II 3CCJ1 4AYBA 4O3UB 4K3JB 3CME1 1PFTA 3D2LA 3HOZI 3CCLZ 3M4OI 2JS4A 3MONA 1K8A2 2EGTA 3CCE1 1YI2Z 1TWAI 2G2KA 5T64A 1N2FA 3NIDB 3GCFA 5FLXb 2E2JI 1TFIA 2I3CA 1K9M1 2NVXI 1VQPZ 1QVFZ 4RV9A 4WK0B 5IP9I 1VQLZ 2V3VA 3J81b 3FCUB 2VDQB 4NH1C 4DQYB 3EEDA 4WK2B 3ZE1B 2DE7A 1KD11 3AL9A 2RBLA 3MZLB 1ZH1A 3JAMf 1KC81 2VC2B 3D9XA 3K7AI 3ZE0B 1X0TA 4A93I 2JUBA 4NBAA 2OTJZ 2OTL1 2VDMB 1OLZA 1VQNZ 4O3TB 3I551 2NVYI 3J80b 1TWHI 2VPWA 2QEX1 3U50C 2VDPB 3F3FC 3OL2A 3F3PC 1K732 5A2Qb 4E30A 3G6EZ 3VI4B 1X3ZA 3CCSZ 1VQMZ 3I07A 5E6UB 3ESWA 2VPXA 2JIRA 2JA7I 2E2II 3CC71 2P28A 2Q4ZA 3CCQZ 3GTKI 3CC2Z 2H85A 1YJW1 4E31A 1Q821 2AYDA 2JIQA 2P3YA 2KPIA 3NDJA 3J7A4 3I4NI 3CC41 3P5JB 3CPWZ 3H0GI 2B63I 2Y0SA 4XX2A 3TDHB 2AKLA 2NVTI 3CMEZ 4A3CI 4NBEA 1M901 5E6RB 1QXFA 2VDNB 3IX0A 3CCEZ 1NUIA 4A3GI 4S1TA 1R9TI 4UM9B 3CCS1 2W03A 2PM9A 1VQM1 3PO2I 3NH5A 1Q812 4Y52I 5D1PA 4NFRA 1Q7Y1 3AFCA 3S1RI 3T3MB 2V8KA 3T4NB 1VQ91 3S17I 4Z7QB 2JA5I 3S2HI 3QWUA 4UM9D 3ZE2B 4BXXI 2GU2A 1YHQ1 1RO4A 2OTLZ 1YUKA 3NIGB 3NH4A 5C4XI 1YJN1 5LL6f 5FLMI 3M3YI 5T67A 2F4OA 1QVGZ 1K9M2 1S72Z 3TE5B 3G711 3CCU1 4A3FI 3GTQI 2QRDB 2VF1A 4WK4B 1X3WA 1NJI2 2JWHA 4BBSI 4BY1I 2VPYA 1KD12 3KIFA 2QRCB 1SHYB 1KC82 3CC7Z 4A3MI 4MRIA 1LQLA 2RIQA 1N8R1 2Q51A 2RT9A 2HU9A 3NIFB 4MD7A 2HF1A 3JAMb 2VDRB 1TWCI 3BG1B 4RVFA 1YJWZ 3GTLI 5C4JI 1YIJ1 4HGYA 4E32A 1JJ2Y 4FWWA 1P9NA 3VMHA 3PO3S 3S16I 3ZDXB 3OW2Z 4A3EI 1SSLA 3AL8B 3T3PB 5CM2M 3CXCY 3CC4Z 3GTMS 3D6WA 1VQK1 2JWGA 3NVQA 5IT9f 2VUGA 3PO3I 1QF8A 4DK1A 3VB9A 3GTMI 1S721 3CCV1 1W2BZ 4X6AI 2IZ3A 1VQO1 1Q822 1RQFA 2WAQA 1Q16A 3NH8A 3GTOI 3RZOI 1TWGI 1Q861 4BY7I 1RO2A 1QVFY 2O4HA 2NVQI 2V8JA 3IF8A 2E2HI 3OW2Y 4Y7NI 2DE6A 2NAPA 3NFZA 1VQ9Z 3S15I 4E2WA 2BJOA 1VQ5Z 2JNYA 3HOXI 1YHQZ 1SFOI 1YIT1 2GTIA 2OZKA 1KQSZ 1YJNZ 1Y1WI 2M48A 1NP6A 4E2XA 2UZYB 1I50I 2QA4Z 2JIOA 4NBDA 3G71Z 1Y1VS 3CCUZ 3CMAZ 5IP7I 1Z01A 2WB1A 4QTTA 4NB9A 4CL1A 4RS4A 4E33A 4NBGA 2LEXA 1RNIA 2VDLB 1Y1VI 1YUAA 2V8IA 3HOYI 3BG0B 1ML8A 3I4MI 4MONA 1WCMI 2YU9I 1YIJZ 4RVDA 5AN9F 2OOYB 4UM8B 2QR1B 2R6MA 3EERA 3IFUA 2JA8I 3CPWY 1VQ51 1M1K1 1VQ6Z 2QLVB 1VQKZ 5C44I 3AL8A 3CD61 4E2ZA 1YJ91 1L1OC 2ZAEB 2JIPA 1SIWA 4A3DI 1N8R2 3S1NI 2QA41 1KRLA 3CCVZ 1U8CB 2LIYA 1VQOZ 2QREB 4BBRI 3CMA1 1VQ81 1S7MA 3CCRZ 1TYEB 2K3RA 2R92I 3HOUI 2VDOB 5C3EI 2V45A 2R7ZI 3VI3B 2DE5A 1WIIA 4MD9A 2VPZA 1VQ7Z 2JR6A 3VTNA 1Z02A 4NB8A 1VQ4Z 1ZB9A 5IT9b 3FQMA 2PMZA 2P26A 1YITZ 3I561 4Z7NB 3FQQA 1K83I 1QVGY 1VQ61 1Q862 2JMOA 2KI7B 1WJ2A 5D1OB 3RZDI 3S1QI 3GTJI 5E6SB 2PK7A 4A3JI 4WJKB 2K5RA 3GTPI 1NJI1 5FLXf 4MXUA 1JWHC 4MH4A 4NBFA 4RVGA 1RLYA 3CCR1 2VUMI 2LFUA 1USPB 1K8A1 1I3QI 3J81f 2JA6I 2OOXB 4RVHA 2QKDA 3MZKB 4TNUA 3G4S1 1AA6A 1Y8CA 1VLAA 4QTUA 1VQ71 3S1MI 3HOVI 1WZNA 3CQZI 4GZ8A 2RHBA 2JIMA 4NBHA 3OKWA 4EWCA 1M902 4A3LI 1VQ41 3GTGI 1QYPA 3CD6Z 1WW9A 1YJ9Z 2W04A 3CCMZ 3J80f 3CCL1 2M6NA 3OKYB 2IZ4A 3H3VJ 5T6BA 1YI21 1W2BY 5A2Qf 3FKII 2YADA 3Q87A 2VDKB 4NOZA 1Q7Y2 1VQ8Z 1VQP1 4A3KI 1K731 1VQL1 2RPRA 2E7ZA 4NBBA 4Z7OB 3GKQA 1M1K2 4NBCA 1RO0A 2O53A 4HH4A 3LUSA 2OTJ1 1VQN1 3CCJZ 3OL2B 3VMIA 3VMGA 1KQSY 5HDBB 1DL6A 3I56Z
chains in the Genus database with same CATH topology
3HKZA 3G6E1 2F4MA 3CCM1 4A3BI 5D1OA 1TWFI 3ZDZB 3CCQ1 3KIHA 3CC21 4DGLA 4E2YA 1ZB8A 4HGZA 3HOWI 2J6AA 3ZDYB 1Z03A 2GTHA 2E9HA 1JJ2Z 3S2DI 1USPA 3G4SZ 3S14I 1Q811 3I55Z 3NDIA 4MD8A 1I6HI 2R93I 3CXCZ 2QEXZ 4A3II 3CCJ1 4AYBA 4O3UB 4K3JB 3CME1 1PFTA 3HOZI 3CCLZ 3M4OI 2JS4A 3MONA 1K8A2 2EGTA 3CCE1 1YI2Z 1TWAI 2G2KA 5T64A 1N2FA 3NIDB 3GCFA 5FLXb 2E2JI 1TFIA 2I3CA 1K9M1 2NVXI 1VQPZ 1QVFZ 4RV9A 4WK0B 5IP9I 1VQLZ 3J81b 3FCUB 2VDQB 4NH1C 4DQYB 3EEDA 4WK2B 3ZE1B 2DE7A 1KD11 3AL9A 2RBLA 3MZLB 1ZH1A 3JAMf 1KC81 2VC2B 3D9XA 3K7AI 3ZE0B 1X0TA 4A93I 2JUBA 4NBAA 2OTJZ 2OTL1 2VDMB 1OLZA 1VQNZ 4O3TB 3I551 2NVYI 3J80b 1TWHI 2QEX1 3U50C 2VDPB 3F3FC 3OL2A 3F3PC 1K732 5A2Qb 4E30A 3G6EZ 3VI4B 1X3ZA 3CCSZ 1VQMZ 3I07A 5E6UB 3ESWA 2JA7I 2E2II 3CC71 2P28A 2Q4ZA 3CCQZ 3GTKI 3CC2Z 2H85A 1YJW1 4E31A 1Q821 2P3YA 2KPIA 3NDJA 3J7A4 3I4NI 3CC41 3P5JB 3CPWZ 3H0GI 2B63I 2Y0SA 4XX2A 3TDHB 2AKLA 2NVTI 3CMEZ 4A3CI 4NBEA 1M901 5E6RB 2VDNB 3IX0A 3CCEZ 1NUIA 4A3GI 4S1TA 1R9TI 4UM9B 3CCS1 2W03A 2PM9A 1VQM1 3PO2I 3NH5A 1Q812 4Y52I 5D1PA 4NFRA 1Q7Y1 3AFCA 3S1RI 3T3MB 2V8KA 1VQ91 3T4NB 3S17I 4Z7QB 2JA5I 3S2HI 3QWUA 4UM9D 3ZE2B 4BXXI 2GU2A 1YHQ1 1RO4A 2OTLZ 1YUKA 3NIGB 3NH4A 5C4XI 1YJN1 5LL6f 5FLMI 3M3YI 5T67A 2F4OA 1QVGZ 1K9M2 1S72Z 3TE5B 3G711 3CCU1 4A3FI 3GTQI 2QRDB 2VF1A 4WK4B 1X3WA 1NJI2 2JWHA 4BBSI 4BY1I 1KD12 3KIFA 2QRCB 1SHYB 1KC82 3CC7Z 4A3MI 4MRIA 1LQLA 2RIQA 1N8R1 2Q51A 2RT9A 2HU9A 3NIFB 4MD7A 2HF1A 3JAMb 2VDRB 1TWCI 3BG1B 4RVFA 1YJWZ 3GTLI 5C4JI 1YIJ1 4HGYA 4E32A 1JJ2Y 4FWWA 1P9NA 3VMHA 3PO3S 3S16I 3ZDXB 3OW2Z 4A3EI 1SSLA 3AL8B 3T3PB 5CM2M 3CXCY 3CC4Z 3GTMS 3D6WA 1VQK1 2JWGA 3NVQA 5IT9f 2VUGA 3PO3I 1QF8A 4DK1A 3VB9A 3GTMI 1S721 3CCV1 1W2BZ 4X6AI 2IZ3A 1VQO1 1Q822 1RQFA 2WAQA 3NH8A 3GTOI 3RZOI 1TWGI 1Q861 4BY7I 1RO2A 1QVFY 2O4HA 2NVQI 2V8JA 3IF8A 2E2HI 3OW2Y 4Y7NI 2DE6A 3NFZA 1VQ9Z 3S15I 4E2WA 2BJOA 1VQ5Z 2JNYA 3HOXI 1YHQZ 1SFOI 1YIT1 2GTIA 2OZKA 1KQSZ 1YJNZ 1Y1WI 2M48A 1NP6A 4E2XA 2UZYB 1I50I 2QA4Z 4NBDA 3G71Z 1Y1VS 3CCUZ 3CMAZ 5IP7I 1Z01A 2WB1A 4QTTA 4NB9A 4CL1A 4RS4A 4E33A 4NBGA 1RNIA 2VDLB 1Y1VI 1YUAA 2V8IA 3HOYI 3BG0B 1ML8A 3I4MI 4MONA 1WCMI 2YU9I 1YIJZ 4RVDA 5AN9F 2OOYB 4UM8B 2QR1B 2R6MA 3EERA 3IFUA 2JA8I 3CPWY 1VQ51 1M1K1 1VQ6Z 2QLVB 1VQKZ 5C44I 3AL8A 3CD61 4E2ZA 1YJ91 1L1OC 2ZAEB 4A3DI 1N8R2 3S1NI 2QA41 1KRLA 3CCVZ 1U8CB 2LIYA 1VQOZ 2QREB 4BBRI 3CMA1 1VQ81 1S7MA 3CCRZ 1TYEB 2K3RA 2R92I 3HOUI 2VDOB 5C3EI 2R7ZI 3VI3B 2DE5A 1WIIA 4MD9A 1VQ7Z 2JR6A 3VTNA 1Z02A 4NB8A 1VQ4Z 1ZB9A 5IT9b 3FQMA 2PMZA 2P26A 1YITZ 3I561 4Z7NB 3FQQA 1K83I 1QVGY 1VQ61 1Q862 2JMOA 2KI7B 5D1OB 3RZDI 3S1QI 3GTJI 5E6SB 2PK7A 4A3JI 4WJKB 2K5RA 3GTPI 1NJI1 5FLXf 4MXUA 1JWHC 4MH4A 4NBFA 4RVGA 1RLYA 3CCR1 2VUMI 2LFUA 1USPB 1K8A1 1I3QI 3J81f 2JA6I 2OOXB 4RVHA 2QKDA 3MZKB 4TNUA 3G4S1 1VLAA 4QTUA 1VQ71 3S1MI 3HOVI 3CQZI 4GZ8A 2RHBA 4NBHA 3OKWA 4EWCA 1M902 4A3LI 1VQ41 3GTGI 1QYPA 3CD6Z 1WW9A 1YJ9Z 2W04A 3CCMZ 3J80f 3CCL1 2M6NA 3OKYB 2IZ4A 3H3VJ 5T6BA 1YI21 1W2BY 5A2Qf 3FKII 2YADA 3Q87A 2VDKB 4NOZA 1Q7Y2 1VQ8Z 1VQP1 4A3KI 1K731 1VQL1 2RPRA 4NBBA 4Z7OB 3GKQA 1M1K2 4NBCA 1RO0A 2O53A 4HH4A 3LUSA 2OTJ1 1VQN1 3CCJZ 3OL2B 3VMIA 3VMGA 1KQSY 5HDBB 1DL6A 3I56Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6R B;  4UM9 D;  3ZE2 B;  3AL8 A;  4GZ8 A;  1YUK A;  2VDN B;  2VDP B;  3NIG B;  3NIF B;  3OL2 A;  3OKW A;  5E6S B;  4Z7O B;  4UM9 B;  4WJK B;  2VDR B;  2VDL B;  4WK0 B;  3FCU B;  2VDQ B;  4FWW A;  3VI4 B;  5E6U B;  4WK2 B;  4O3U B;  1U8C B;  3OKY B;  3ZDX B;  3ZE1 B;  3AL9 A;  1SSL A;  2UZY B;  3AL8 B;  4K3J B;  4WK4 B;  3T3P B;  3AFC A;  2P26 A;  2VC2 B;  3ZDZ B;  3OL2 B;  3ZE0 B;  4Z7N B;  2P28 A;  3T3M B;  5HDB B;  4UM8 B;  1TYE B;  2VDM B;  1SHY B;  1OLZ A;  2VDK B;  4O3T B;  2VDO B;  3NVQ A;  3ZDY B;  4Z7Q B;  3VI3 B;  3NID B; 
#chains in the Genus database with same CATH topology
 3HKZ A;  3G6E 1;  2F4M A;  3CCM 1;  4A3B I;  5D1O A;  1TWF I;  3ZDZ B;  1FDI A;  3CCQ 1;  3KIH A;  3CC2 1;  4DGL A;  4E2Y A;  1ZB8 A;  4HGZ A;  3HOW I;  2J6A A;  3ZDY B;  3IR7 A;  1Z03 A;  2GTH A;  2IV2 X;  2E9H A;  1JJ2 Z;  3S2D I;  1USP A;  1FDO A;  3G4S Z;  3S14 I;  1Q81 1;  3I55 Z;  3NDI A;  4MD8 A;  1I6H I;  2R93 I;  3CXC Z;  2QEX Z;  4A3I I;  3CCJ 1;  4AYB A;  4O3U B;  4K3J B;  3CME 1;  1PFT A;  3D2L A;  3HOZ I;  3CCL Z;  3M4O I;  2JS4 A;  3MON A;  1K8A 2;  2EGT A;  3CCE 1;  1YI2 Z;  1TWA I;  2G2K A;  5T64 A;  1N2F A;  3NID B;  3GCF A;  5FLX b;  2E2J I;  1TFI A;  2I3C A;  1K9M 1;  2NVX I;  1VQP Z;  1QVF Z;  4RV9 A;  4WK0 B;  5IP9 I;  1VQL Z;  2V3V A;  3J81 b;  3FCU B;  2VDQ B;  4NH1 C;  4DQY B;  3EED A;  4WK2 B;  3ZE1 B;  2DE7 A;  1KD1 1;  3AL9 A;  2RBL A;  3MZL B;  1ZH1 A;  3JAM f;  1KC8 1;  2VC2 B;  3D9X A;  3K7A I;  3ZE0 B;  1X0T A;  4A93 I;  2JUB A;  4NBA A;  2OTJ Z;  2OTL 1;  2VDM B;  1OLZ A;  1VQN Z;  4O3T B;  3I55 1;  2NVY I;  3J80 b;  1TWH I;  2VPW A;  2QEX 1;  3U50 C;  2VDP B;  3F3F C;  3OL2 A;  3F3P C;  1K73 2;  5A2Q b;  4E30 A;  3G6E Z;  3VI4 B;  1X3Z A;  3CCS Z;  1VQM Z;  3I07 A;  5E6U B;  3ESW A;  2VPX A;  2JIR A;  2JA7 I;  2E2I I;  3CC7 1;  2P28 A;  2Q4Z A;  3CCQ Z;  3GTK I;  3CC2 Z;  2H85 A;  1YJW 1;  4E31 A;  1Q82 1;  2AYD A;  2JIQ A;  2P3Y A;  2KPI A;  3NDJ A;  3J7A 4;  3I4N I;  3CC4 1;  3P5J B;  3CPW Z;  3H0G I;  2B63 I;  2Y0S A;  4XX2 A;  3TDH B;  2AKL A;  2NVT I;  3CME Z;  4A3C I;  4NBE A;  1M90 1;  5E6R B;  1QXF A;  2VDN B;  3IX0 A;  3CCE Z;  1NUI A;  4A3G I;  4S1T A;  1R9T I;  4UM9 B;  3CCS 1;  2W03 A;  2PM9 A;  1VQM 1;  3PO2 I;  3NH5 A;  1Q81 2;  4Y52 I;  5D1P A;  4NFR A;  1Q7Y 1;  3AFC A;  3S1R I;  3T3M B;  2V8K A;  3T4N B;  1VQ9 1;  3S17 I;  4Z7Q B;  2JA5 I;  3S2H I;  3QWU A;  4UM9 D;  3ZE2 B;  4BXX I;  2GU2 A;  1YHQ 1;  1RO4 A;  2OTL Z;  1YUK A;  3NIG B;  3NH4 A;  5C4X I;  1YJN 1;  5LL6 f;  5FLM I;  3M3Y I;  5T67 A;  2F4O A;  1QVG Z;  1K9M 2;  1S72 Z;  3TE5 B;  3G71 1;  3CCU 1;  4A3F I;  3GTQ I;  2QRD B;  2VF1 A;  4WK4 B;  1X3W A;  1NJI 2;  2JWH A;  4BBS I;  4BY1 I;  2VPY A;  1KD1 2;  3KIF A;  2QRC B;  1SHY B;  1KC8 2;  3CC7 Z;  4A3M I;  4MRI A;  1LQL A;  2RIQ A;  1N8R 1;  2Q51 A;  2RT9 A;  2HU9 A;  3NIF B;  4MD7 A;  2HF1 A;  3JAM b;  2VDR B;  1TWC I;  3BG1 B;  4RVF A;  1YJW Z;  3GTL I;  5C4J I;  1YIJ 1;  4HGY A;  4E32 A;  1JJ2 Y;  4FWW A;  1P9N A;  3VMH A;  3PO3 S;  3S16 I;  3ZDX B;  3OW2 Z;  4A3E I;  1SSL A;  3AL8 B;  3T3P B;  5CM2 M;  3CXC Y;  3CC4 Z;  3GTM S;  3D6W A;  1VQK 1;  2JWG A;  3NVQ A;  5IT9 f;  2VUG A;  3PO3 I;  1QF8 A;  4DK1 A;  3VB9 A;  3GTM I;  1S72 1;  3CCV 1;  1W2B Z;  4X6A I;  2IZ3 A;  1VQO 1;  1Q82 2;  1RQF A;  2WAQ A;  1Q16 A;  3NH8 A;  3GTO I;  3RZO I;  1TWG I;  1Q86 1;  4BY7 I;  1RO2 A;  1QVF Y;  2O4H A;  2NVQ I;  2V8J A;  3IF8 A;  2E2H I;  3OW2 Y;  4Y7N I;  2DE6 A;  2NAP A;  3NFZ A;  1VQ9 Z;  3S15 I;  4E2W A;  2BJO A;  1VQ5 Z;  2JNY A;  3HOX I;  1YHQ Z;  1SFO I;  1YIT 1;  2GTI A;  2OZK A;  1KQS Z;  1YJN Z;  1Y1W I;  2M48 A;  1NP6 A;  4E2X A;  2UZY B;  1I50 I;  2QA4 Z;  2JIO A;  4NBD A;  3G71 Z;  1Y1V S;  3CCU Z;  3CMA Z;  5IP7 I;  1Z01 A;  2WB1 A;  4QTT A;  4NB9 A;  4CL1 A;  4RS4 A;  4E33 A;  4NBG A;  2LEX A;  1RNI A;  2VDL B;  1Y1V I;  1YUA A;  2V8I A;  3HOY I;  3BG0 B;  1ML8 A;  3I4M I;  4MON A;  1WCM I;  2YU9 I;  1YIJ Z;  4RVD A;  5AN9 F;  2OOY B;  4UM8 B;  2QR1 B;  2R6M A;  3EER A;  3IFU A;  2JA8 I;  3CPW Y;  1VQ5 1;  1M1K 1;  1VQ6 Z;  2QLV B;  1VQK Z;  5C44 I;  3AL8 A;  3CD6 1;  4E2Z A;  1YJ9 1;  1L1O C;  2ZAE B;  2JIP A;  1SIW A;  4A3D I;  1N8R 2;  3S1N I;  2QA4 1;  1KRL A;  3CCV Z;  1U8C B;  2LIY A;  1VQO Z;  2QRE B;  4BBR I;  3CMA 1;  1VQ8 1;  1S7M A;  3CCR Z;  1TYE B;  2K3R A;  2R92 I;  3HOU I;  2VDO B;  5C3E I;  2V45 A;  2R7Z I;  3VI3 B;  2DE5 A;  1WII A;  4MD9 A;  2VPZ A;  1VQ7 Z;  2JR6 A;  3VTN A;  1Z02 A;  4NB8 A;  1VQ4 Z;  1ZB9 A;  5IT9 b;  3FQM A;  2PMZ A;  2P26 A;  1YIT Z;  3I56 1;  4Z7N B;  3FQQ A;  1K83 I;  1QVG Y;  1VQ6 1;  1Q86 2;  2JMO A;  2KI7 B;  1WJ2 A;  5D1O B;  3RZD I;  3S1Q I;  3GTJ I;  5E6S B;  2PK7 A;  4A3J I;  4WJK B;  2K5R A;  3GTP I;  1NJI 1;  5FLX f;  4MXU A;  1JWH C;  4MH4 A;  4NBF A;  4RVG A;  1RLY A;  3CCR 1;  2VUM I;  2LFU A;  1USP B;  1K8A 1;  1I3Q I;  3J81 f;  2JA6 I;  2OOX B;  4RVH A;  2QKD A;  3MZK B;  4TNU A;  3G4S 1;  1AA6 A;  1Y8C A;  1VLA A;  4QTU A;  1VQ7 1;  3S1M I;  3HOV I;  1WZN A;  3CQZ I;  4GZ8 A;  2RHB A;  2JIM A;  4NBH A;  3OKW A;  4EWC A;  1M90 2;  4A3L I;  1VQ4 1;  3GTG I;  1QYP A;  3CD6 Z;  1WW9 A;  1YJ9 Z;  2W04 A;  3CCM Z;  3J80 f;  3CCL 1;  2M6N A;  3OKY B;  2IZ4 A;  3H3V J;  5T6B A;  1YI2 1;  1W2B Y;  5A2Q f;  3FKI I;  2YAD A;  3Q87 A;  2VDK B;  4NOZ A;  1Q7Y 2;  1VQ8 Z;  1VQP 1;  4A3K I;  1K73 1;  1VQL 1;  2RPR A;  2E7Z A;  4NBB A;  4Z7O B;  3GKQ A;  1M1K 2;  4NBC A;  1RO0 A;  2O53 A;  4HH4 A;  3LUS A;  2OTJ 1;  1VQN 1;  3CCJ Z;  3OL2 B;  3VMI A;  3VMG A;  1KQS Y;  5HDB B;  1DL6 A;  3I56 Z; 
#chains in the Genus database with same CATH homology
 3HKZ A;  3G6E 1;  2F4M A;  3CCM 1;  4A3B I;  5D1O A;  1TWF I;  3ZDZ B;  3CCQ 1;  3KIH A;  3CC2 1;  4DGL A;  4E2Y A;  1ZB8 A;  4HGZ A;  3HOW I;  2J6A A;  3ZDY B;  1Z03 A;  2GTH A;  2E9H A;  1JJ2 Z;  3S2D I;  1USP A;  3G4S Z;  3S14 I;  1Q81 1;  3I55 Z;  3NDI A;  4MD8 A;  1I6H I;  2R93 I;  3CXC Z;  2QEX Z;  4A3I I;  3CCJ 1;  4AYB A;  4O3U B;  4K3J B;  3CME 1;  1PFT A;  3HOZ I;  3CCL Z;  3M4O I;  2JS4 A;  3MON A;  1K8A 2;  2EGT A;  3CCE 1;  1YI2 Z;  1TWA I;  2G2K A;  5T64 A;  1N2F A;  3NID B;  3GCF A;  5FLX b;  2E2J I;  1TFI A;  2I3C A;  1K9M 1;  2NVX I;  1VQP Z;  1QVF Z;  4RV9 A;  4WK0 B;  5IP9 I;  1VQL Z;  3J81 b;  3FCU B;  2VDQ B;  4NH1 C;  4DQY B;  3EED A;  4WK2 B;  3ZE1 B;  2DE7 A;  1KD1 1;  3AL9 A;  2RBL A;  3MZL B;  1ZH1 A;  3JAM f;  1KC8 1;  2VC2 B;  3D9X A;  3K7A I;  3ZE0 B;  1X0T A;  4A93 I;  2JUB A;  4NBA A;  2OTJ Z;  2OTL 1;  2VDM B;  1OLZ A;  1VQN Z;  4O3T B;  3I55 1;  2NVY I;  3J80 b;  1TWH I;  2QEX 1;  3U50 C;  2VDP B;  3F3F C;  3OL2 A;  3F3P C;  1K73 2;  5A2Q b;  4E30 A;  3G6E Z;  3VI4 B;  1X3Z A;  3CCS Z;  1VQM Z;  3I07 A;  5E6U B;  3ESW A;  2JA7 I;  2E2I I;  3CC7 1;  2P28 A;  2Q4Z A;  3CCQ Z;  3GTK I;  3CC2 Z;  2H85 A;  1YJW 1;  4E31 A;  1Q82 1;  2P3Y A;  2KPI A;  3NDJ A;  3J7A 4;  3I4N I;  3CC4 1;  3P5J B;  3CPW Z;  3H0G I;  2B63 I;  2Y0S A;  4XX2 A;  3TDH B;  2AKL A;  2NVT I;  3CME Z;  4A3C I;  4NBE A;  1M90 1;  5E6R B;  2VDN B;  3IX0 A;  3CCE Z;  1NUI A;  4A3G I;  4S1T A;  1R9T I;  4UM9 B;  3CCS 1;  2W03 A;  2PM9 A;  1VQM 1;  3PO2 I;  3NH5 A;  1Q81 2;  4Y52 I;  5D1P A;  4NFR A;  1Q7Y 1;  3AFC A;  3S1R I;  3T3M B;  2V8K A;  1VQ9 1;  3T4N B;  3S17 I;  4Z7Q B;  2JA5 I;  3S2H I;  3QWU A;  4UM9 D;  3ZE2 B;  4BXX I;  2GU2 A;  1YHQ 1;  1RO4 A;  2OTL Z;  1YUK A;  3NIG B;  3NH4 A;  5C4X I;  1YJN 1;  5LL6 f;  5FLM I;  3M3Y I;  5T67 A;  2F4O A;  1QVG Z;  1K9M 2;  1S72 Z;  3TE5 B;  3G71 1;  3CCU 1;  4A3F I;  3GTQ I;  2QRD B;  2VF1 A;  4WK4 B;  1X3W A;  1NJI 2;  2JWH A;  4BBS I;  4BY1 I;  1KD1 2;  3KIF A;  2QRC B;  1SHY B;  1KC8 2;  3CC7 Z;  4A3M I;  4MRI A;  1LQL A;  2RIQ A;  1N8R 1;  2Q51 A;  2RT9 A;  2HU9 A;  3NIF B;  4MD7 A;  2HF1 A;  3JAM b;  2VDR B;  1TWC I;  3BG1 B;  4RVF A;  1YJW Z;  3GTL I;  5C4J I;  1YIJ 1;  4HGY A;  4E32 A;  1JJ2 Y;  4FWW A;  1P9N A;  3VMH A;  3PO3 S;  3S16 I;  3ZDX B;  3OW2 Z;  4A3E I;  1SSL A;  3AL8 B;  3T3P B;  5CM2 M;  3CXC Y;  3CC4 Z;  3GTM S;  3D6W A;  1VQK 1;  2JWG A;  3NVQ A;  5IT9 f;  2VUG A;  3PO3 I;  1QF8 A;  4DK1 A;  3VB9 A;  3GTM I;  1S72 1;  3CCV 1;  1W2B Z;  4X6A I;  2IZ3 A;  1VQO 1;  1Q82 2;  1RQF A;  2WAQ A;  3NH8 A;  3GTO I;  3RZO I;  1TWG I;  1Q86 1;  4BY7 I;  1RO2 A;  1QVF Y;  2O4H A;  2NVQ I;  2V8J A;  3IF8 A;  2E2H I;  3OW2 Y;  4Y7N I;  2DE6 A;  3NFZ A;  1VQ9 Z;  3S15 I;  4E2W A;  2BJO A;  1VQ5 Z;  2JNY A;  3HOX I;  1YHQ Z;  1SFO I;  1YIT 1;  2GTI A;  2OZK A;  1KQS Z;  1YJN Z;  1Y1W I;  2M48 A;  1NP6 A;  4E2X A;  2UZY B;  1I50 I;  2QA4 Z;  4NBD A;  3G71 Z;  1Y1V S;  3CCU Z;  3CMA Z;  5IP7 I;  1Z01 A;  2WB1 A;  4QTT A;  4NB9 A;  4CL1 A;  4RS4 A;  4E33 A;  4NBG A;  1RNI A;  2VDL B;  1Y1V I;  1YUA A;  2V8I A;  3HOY I;  3BG0 B;  1ML8 A;  3I4M I;  4MON A;  1WCM I;  2YU9 I;  1YIJ Z;  4RVD A;  5AN9 F;  2OOY B;  4UM8 B;  2QR1 B;  2R6M A;  3EER A;  3IFU A;  2JA8 I;  3CPW Y;  1VQ5 1;  1M1K 1;  1VQ6 Z;  2QLV B;  1VQK Z;  5C44 I;  3AL8 A;  3CD6 1;  4E2Z A;  1YJ9 1;  1L1O C;  2ZAE B;  4A3D I;  1N8R 2;  3S1N I;  2QA4 1;  1KRL A;  3CCV Z;  1U8C B;  2LIY A;  1VQO Z;  2QRE B;  4BBR I;  3CMA 1;  1VQ8 1;  1S7M A;  3CCR Z;  1TYE B;  2K3R A;  2R92 I;  3HOU I;  2VDO B;  5C3E I;  2R7Z I;  3VI3 B;  2DE5 A;  1WII A;  4MD9 A;  1VQ7 Z;  2JR6 A;  3VTN A;  1Z02 A;  4NB8 A;  1VQ4 Z;  1ZB9 A;  5IT9 b;  3FQM A;  2PMZ A;  2P26 A;  1YIT Z;  3I56 1;  4Z7N B;  3FQQ A;  1K83 I;  1QVG Y;  1VQ6 1;  1Q86 2;  2JMO A;  2KI7 B;  5D1O B;  3RZD I;  3S1Q I;  3GTJ I;  5E6S B;  2PK7 A;  4A3J I;  4WJK B;  2K5R A;  3GTP I;  1NJI 1;  5FLX f;  4MXU A;  1JWH C;  4MH4 A;  4NBF A;  4RVG A;  1RLY A;  3CCR 1;  2VUM I;  2LFU A;  1USP B;  1K8A 1;  1I3Q I;  3J81 f;  2JA6 I;  2OOX B;  4RVH A;  2QKD A;  3MZK B;  4TNU A;  3G4S 1;  1VLA A;  4QTU A;  1VQ7 1;  3S1M I;  3HOV I;  3CQZ I;  4GZ8 A;  2RHB A;  4NBH A;  3OKW A;  4EWC A;  1M90 2;  4A3L I;  1VQ4 1;  3GTG I;  1QYP A;  3CD6 Z;  1WW9 A;  1YJ9 Z;  2W04 A;  3CCM Z;  3J80 f;  3CCL 1;  2M6N A;  3OKY B;  2IZ4 A;  3H3V J;  5T6B A;  1YI2 1;  1W2B Y;  5A2Q f;  3FKI I;  2YAD A;  3Q87 A;  2VDK B;  4NOZ A;  1Q7Y 2;  1VQ8 Z;  1VQP 1;  4A3K I;  1K73 1;  1VQL 1;  2RPR A;  4NBB A;  4Z7O B;  3GKQ A;  1M1K 2;  4NBC A;  1RO0 A;  2O53 A;  4HH4 A;  3LUS A;  2OTJ 1;  1VQN 1;  3CCJ Z;  3OL2 B;  3VMI A;  3VMG A;  1KQS Y;  5HDB B;  1DL6 A;  3I56 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...