1YUKA

The crystal structure of the psi/hybrid domain/ i-egf1 segment from the human integrin beta2 at 1.8 resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
94
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEQKQLSPQKVTLYLRPGQAAAFNVTFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin {beta}2 Subunit at 1.8-A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin beta-2 A chain
total genus 17
structure length 94
sequence length 99
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.150 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yukA02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1yukA01
3OL2B 4K3JB 3T3MB 3AL9A 3OL2A 4Z7NB 4GZ8A 3NIFB 3AL8A 2VDQB 2P26A 2VDOB 4WK4B 3ZDXB 4O3UB 3VI3B 2VDPB 5E6SB 3OKYB 5E6RB 3ZDYB 3ZDZB 4UM9B 1SSLA 2VDMB 2VDRB 5HDBB 2VC2B 1SHYB 1YUKA 1TYEB 4UM8B 4WJKB 4WK2B 3VI4B 3NVQA 4WK0B 3FCUB 1U8CB 3OKWA 1OLZA 2P28A 3NIDB 3ZE2B 3ZE1B 3NIGB 4Z7OB 2UZYB 5E6UB 4UM9D 3ZE0B 3AL8B 4Z7QB 3AFCA 3T3PB 2VDNB 2VDKB 4FWWA 4O3TB 2VDLB
chains in the Genus database with same CATH superfamily
2YU9I 1VQ5Z 2AYDA 1PFTA 3NH8A 3J80f 3TE5B 1K8A2 1VQL1 2QA41 3I4MI 4MD8A 1M902 1QVFZ 2JIRA 4S1TA 3HOVI 1N2FA 3J80b 2H85A 4DQYB 1Z02A 2Y0SA 4A3EI 2F4MA 2JS4A 2QR1B 1K9M2 3S1MI 1WW9A 1M1K2 1VQK1 1N8R2 2JIQA 2RBLA 5D1OA 2Q4ZA 3D9XA 3I55Z 3Q87A 3FQMA 3F3FC 3S17I 4A3FI 2QLVB 4NB9A 5C4XI 4A3LI 2QEX1 3JAMf 1VQOZ 2QRCB 3G4S1 1VQO1 2VPYA 2W03A 3CCLZ 5CM2M 1I6HI 5IP7I 2QA4Z 1Z01A 3CME1 2VDKB 3CC2Z 1VQN1 2F4OA 1S721 2VUGA 4NBGA 3AL9A 3OL2A 3M3YI 2OTLZ 3P5JB 3CCUZ 2HU9A 3HOXI 2VDPB 4NBDA 3NFZA 5AN9F 2Q51A 3G71Z 1YUKA 1KRLA 1LQLA 3GTGI 1QVFY 3JAMb 3CD6Z 3GTPI 1Y8CA 2V3VA 3GTLI 1TWAI 2VDNB 3I4NI 1YJNZ 3HOWI 3OL2B 4NOZA 3BG1B 2NVTI 3QWUA 5IT9f 3ZDXB 3OW2Z 1NUIA 5T67A 1X3ZA 2R92I 2LIYA 1USPA 3GTKI 3NH5A 3ESWA 3CCEZ 4BY7I 1OLZA 1P9NA 2NVYI 3NIGB 3AL8B 4Z7QB 4FWWA 1WZNA 1YJN1 1YI2Z 1YIJ1 2JA6I 1QVGY 1ZH1A 2E2II 3CD61 3S2DI 3AL8A 2VPXA 2E2JI 3NDIA 4UM9B 2P3YA 1WIIA 3GTQI 1SIWA 2B63I 5A2Qb 4NFRA 2R6MA 3S15I 3CQZI 1N8R1 3J81b 2UZYB 3CPWZ 3AFCA 1RO0A 2KPIA 2QREB 2VPWA 3U50C 3T3MB 1KC82 1S7MA 4Z7NB 2DE6A 4A93I 2R93I 3S1NI 1QYPA 3CCSZ 3S1RI 2VDQB 2P26A 2QKDA 1X0TA 3S16I 3CCL1 5E6RB 2QEXZ 3H0GI 4BBSI 4NBAA 1Q821 2ZAEB 4E31A 3VMHA 3I551 3CCQZ 1VQ41 3EERA 3ZE2B 2P28A 1AA6A 3CMAZ 1VQKZ 2IZ4A 1W2BZ 2OTL1 3CC4Z 1YITZ 1VQ6Z 1Q822 4DGLA 1S72Z 2RHBA 1JJ2Y 3KIHA 2GTIA 2BJOA 4MH4A 1RQFA 1K83I 4BY1I 3HOZI 4RVFA 2JA8I 4WK4B 3VI3B 5T6BA 2V8KA 3CMEZ 5D1OB 3OKYB 2J6AA 3GTMS 3IFUA 1TWGI 5LL6f 2VDRB 3GTOI 3S1QI 3OW2Y 3VI4B 3FCUB 1VQLZ 1YJ9Z 4BXXI 1Q811 3ZE1B 4HGYA 2LFUA 2PMZA 4RVGA 3G6EZ 1I50I 2W04A 1VLAA 4MXUA 3CXCZ 3RZDI 5E6SB 4NBHA 3ZDZB 1VQ4Z 2VDMB 4A3DI 1VQ71 5HDBB 3CXCY 3RZOI 5C4JI 4MD7A 4HH4A 3NIDB 5IP9I 3VMIA 1YUAA 1DL6A 3HKZA 4RVDA 4E2YA 1RO4A 1VQ51 2DE5A 1KC81 2E7ZA 2JNYA 3J81f 2AKLA 3HOYI 3MZKB 3J7A4 4XX2A 5A2Qf 3EEDA 2KI7B 4E33A 1M1K1 4NBEA 4HGZA 4MONA 3CCQ1 4UM8B 1NJI1 3GCFA 3PO3I 1NP6A 1Q16A 4NBFA 2LEXA 4DK1A 3BG0B 1VQMZ 2NVQI 2E9HA 2O4HA 4GZ8A 3VMGA 1VQ8Z 1RNIA 2GTHA 2VDOB 4MRIA 4E30A 1I3QI 2JMOA 1Y1WI 2V8IA 3ZDYB 2IV2X 3VB9A 2JR6A 2NAPA 3CCE1 1SHYB 3I561 4RVHA 4WK0B 5FLXb 4E2XA 5IT9b 2JIOA 2PM9A 3MONA 1YHQ1 4UM9D 2QRDB 2V8JA 2V45A 2OOYB 3IX0A 4MD9A 1K8A1 1Q861 1USPB 4K3JB 3CPWY 1TWFI 1K9M1 5C44I 4BBRI 3HOUI 4X6AI 1VQ9Z 2O53A 4A3CI 4O3TB 2RIQA 1KD12 4EWCA 3CC7Z 2R7ZI 2K5RA 4AYBA 2G2KA 2OTJZ 3G711 4WJKB 4WK2B 1U8CB 4A3KI 1QVGZ 1KQSZ 2I3CA 1Y1VS 2WB1A 1VQPZ 3GTJI 3G6E1 1TWCI 1M901 2JIPA 3CCMZ 1Q7Y2 2NVXI 1FDOA 1YJ91 1Q7Y1 3G4SZ 3GKQA 2PK7A 3FKII 1SSLA 1KQSY 2VC2B 1Q812 3CCVZ 2JA7I 4NH1C 1ZB9A 3NDJA 4QTUA 1NJI2 2OZKA 1JJ2Z 3ZE0B 3CCM1 1Y1VI 2DE7A 2VPZA 3IR7A 3CCU1 1VQP1 4A3MI 1YIT1 4RV9A 3T4NB 3S2HI 3FQQA 3CC21 1VQNZ 3S14I 2OTJ1 1RO2A 2K3RA 3CCV1 4NB8A 3KIFA 4A3JI 1TYEB 1QF8A 3LUSA 1TFIA 4TNUA 5E6UB 3CCS1 3K7AI 2VDLB 3PO2I 1VQ61 3CC41 3CMA1 1R9TI 1W2BY 1QXFA 3F3PC 3MZLB 3D2LA 1RLYA 3CC71 2VUMI 3OKWA 4A3BI 1FDIA 4Z7OB 1YIJZ 2RPRA 3CCJZ 4NBBA 1VQ91 4RS4A 5FLMI 4E2WA 3D6WA 2M6NA 2JIMA 3CCRZ 2YADA 3NIFB 2HF1A 5T64A 2JWHA 1YHQZ 1YJWZ 1YJW1 4E2ZA 5FLXf 1L1OC 3IF8A 3I56Z 4Y52I 5C3EI 1X3WA 3I07A 3CCR1 3CCJ1 4A3II 2JWGA 1TWHI 4Y7NI 1Z03A 2VF1A 1VQ81 1YI21 1JWHC 1WCMI 3GTMI 1ML8A 2M48A 2EGTA 1VQM1 1KD11 1SFOI 3PO3S 2OOXB 4O3UB 4QTTA 2JUBA 4CL1A 3NH4A 4E32A 4A3GI 1VQ7Z 5D1PA 1WJ2A 1K732 1Q862 2JA5I 2IZ3A 3TDHB 4NBCA 1K731 2GU2A 2E2HI 2RT9A 3M4OI 3T3PB 3NVQA 2WAQA 3H3VJ 3VTNA 1ZB8A
chains in the Genus database with same CATH topology
2YU9I 1VQ5Z 1PFTA 3NH8A 3J80f 3TE5B 1K8A2 1VQL1 2QA41 3I4MI 4MD8A 1M902 1QVFZ 4S1TA 3HOVI 1N2FA 3J80b 2H85A 4DQYB 1Z02A 2Y0SA 4A3EI 2F4MA 2JS4A 2QR1B 1K9M2 3S1MI 1WW9A 1M1K2 1VQK1 1N8R2 2RBLA 5D1OA 2Q4ZA 3D9XA 3I55Z 3Q87A 3FQMA 3F3FC 3S17I 4A3FI 2QLVB 4NB9A 5C4XI 4A3LI 2QEX1 3JAMf 1VQOZ 2QRCB 3G4S1 1VQO1 2W03A 3CCLZ 5CM2M 1I6HI 5IP7I 2QA4Z 1Z01A 3CME1 2VDKB 3CC2Z 1VQN1 2F4OA 1S721 2VUGA 4NBGA 3AL9A 3OL2A 3M3YI 2OTLZ 3P5JB 3CCUZ 2HU9A 3HOXI 2VDPB 4NBDA 3NFZA 5AN9F 2Q51A 3G71Z 1YUKA 1KRLA 1LQLA 3GTGI 1QVFY 3JAMb 3CD6Z 3GTPI 3GTLI 1TWAI 2VDNB 3I4NI 1YJNZ 3HOWI 3OL2B 4NOZA 3BG1B 2NVTI 3QWUA 5IT9f 3ZDXB 3OW2Z 1NUIA 5T67A 1X3ZA 2R92I 2LIYA 1USPA 3GTKI 3NH5A 3ESWA 3CCEZ 4BY7I 1OLZA 1P9NA 2NVYI 3NIGB 3AL8B 4Z7QB 4FWWA 1YJN1 1YI2Z 1YIJ1 2JA6I 1QVGY 1ZH1A 2E2II 3CD61 3S2DI 3AL8A 2E2JI 3NDIA 4UM9B 2P3YA 1WIIA 3GTQI 2B63I 5A2Qb 4NFRA 2R6MA 3S15I 3CQZI 1N8R1 3J81b 2UZYB 3CPWZ 3AFCA 2KPIA 1RO0A 2QREB 3U50C 3T3MB 1KC82 1S7MA 4Z7NB 2DE6A 4A93I 2R93I 3S1NI 1QYPA 3CCSZ 3S1RI 2VDQB 2P26A 2QKDA 1X0TA 3S16I 3CCL1 5E6RB 2QEXZ 3H0GI 4BBSI 4NBAA 1Q821 2ZAEB 4E31A 3VMHA 3I551 3CCQZ 1VQ41 3EERA 3ZE2B 2P28A 3CMAZ 1VQKZ 2IZ4A 1W2BZ 2OTL1 3CC4Z 1YITZ 1VQ6Z 1Q822 4DGLA 1S72Z 2RHBA 1JJ2Y 3KIHA 2GTIA 2BJOA 4MH4A 1RQFA 1K83I 4BY1I 3HOZI 4RVFA 2JA8I 4WK4B 3VI3B 5T6BA 2V8KA 3CMEZ 5D1OB 3OKYB 2J6AA 3GTMS 3IFUA 1TWGI 5LL6f 2VDRB 3GTOI 3S1QI 3OW2Y 3VI4B 3FCUB 1VQLZ 1YJ9Z 4BXXI 1Q811 3ZE1B 4HGYA 2LFUA 2PMZA 4RVGA 3G6EZ 1I50I 2W04A 1VLAA 4MXUA 3CXCZ 3RZDI 5E6SB 4NBHA 3ZDZB 1VQ4Z 2VDMB 4A3DI 1VQ71 5HDBB 3CXCY 3RZOI 5C4JI 4MD7A 4HH4A 3NIDB 5IP9I 3VMIA 1YUAA 1DL6A 3HKZA 4RVDA 4E2YA 1RO4A 1VQ51 2DE5A 1KC81 2JNYA 3J81f 2AKLA 3HOYI 3MZKB 3J7A4 4XX2A 5A2Qf 3EEDA 2KI7B 4E33A 1M1K1 4NBEA 4HGZA 4MONA 3CCQ1 4UM8B 1NJI1 3GCFA 3PO3I 1NP6A 4NBFA 4DK1A 3BG0B 1VQMZ 2NVQI 2E9HA 2O4HA 4GZ8A 3VMGA 1RNIA 2GTHA 1VQ8Z 2VDOB 4MRIA 4E30A 1I3QI 2JMOA 1Y1WI 2V8IA 3ZDYB 3VB9A 2JR6A 3CCE1 1SHYB 3I561 4RVHA 4WK0B 5FLXb 4E2XA 5IT9b 2PM9A 3MONA 1YHQ1 4UM9D 2QRDB 2V8JA 2OOYB 3IX0A 4MD9A 1K8A1 1Q861 1USPB 4K3JB 3CPWY 1TWFI 1K9M1 5C44I 4BBRI 3HOUI 4X6AI 1VQ9Z 2O53A 4A3CI 4O3TB 2RIQA 1KD12 4EWCA 3CC7Z 2R7ZI 2K5RA 4AYBA 2G2KA 2OTJZ 3G711 4WJKB 4WK2B 1U8CB 4A3KI 1QVGZ 1KQSZ 2I3CA 1Y1VS 2WB1A 1VQPZ 3GTJI 3G6E1 1TWCI 1M901 3CCMZ 1Q7Y2 2NVXI 1YJ91 1Q7Y1 3G4SZ 3GKQA 2PK7A 3FKII 1SSLA 1KQSY 2VC2B 1Q812 3CCVZ 2JA7I 4NH1C 1ZB9A 3NDJA 4QTUA 1NJI2 2OZKA 1JJ2Z 3ZE0B 3CCM1 1Y1VI 2DE7A 3CCU1 1VQP1 4A3MI 1YIT1 4RV9A 3T4NB 3S2HI 3FQQA 3CC21 1VQNZ 3S14I 2OTJ1 1RO2A 2K3RA 3CCV1 4NB8A 3KIFA 4A3JI 1TYEB 1QF8A 3LUSA 1TFIA 4TNUA 5E6UB 3CCS1 3K7AI 2VDLB 3PO2I 1VQ61 3CC41 3CMA1 1R9TI 1W2BY 3F3PC 3MZLB 1RLYA 3CC71 2VUMI 3OKWA 4A3BI 4Z7OB 1YIJZ 2RPRA 3CCJZ 4NBBA 1VQ91 4RS4A 5FLMI 3D6WA 4E2WA 2M6NA 3CCRZ 2YADA 3NIFB 2HF1A 5T64A 2JWHA 1YHQZ 1YJWZ 1YJW1 4E2ZA 5FLXf 1L1OC 3IF8A 3I56Z 4Y52I 5C3EI 1X3WA 3I07A 3CCR1 3CCJ1 4A3II 2JWGA 1TWHI 4Y7NI 1Z03A 2VF1A 1VQ81 1YI21 1JWHC 1WCMI 3GTMI 1ML8A 2M48A 2EGTA 1VQM1 1KD11 1SFOI 3PO3S 2OOXB 4O3UB 4QTTA 2JUBA 4CL1A 3NH4A 4E32A 4A3GI 1VQ7Z 5D1PA 1K732 1Q862 2JA5I 2IZ3A 3TDHB 4NBCA 1K731 2GU2A 2E2HI 2RT9A 3M4OI 3T3PB 3NVQA 2WAQA 3H3VJ 3VTNA 1ZB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL2 B;  4K3J B;  3T3M B;  3AL9 A;  3OL2 A;  4Z7N B;  4GZ8 A;  3NIF B;  3AL8 A;  2VDQ B;  2P26 A;  2VDO B;  4WK4 B;  3ZDX B;  4O3U B;  3VI3 B;  2VDP B;  5E6S B;  3OKY B;  5E6R B;  3ZDY B;  3ZDZ B;  4UM9 B;  1SSL A;  2VDM B;  2VDR B;  5HDB B;  2VC2 B;  1SHY B;  1YUK A;  1TYE B;  4UM8 B;  4WJK B;  4WK2 B;  3VI4 B;  3NVQ A;  4WK0 B;  3FCU B;  1U8C B;  3OKW A;  1OLZ A;  2P28 A;  3NID B;  3ZE2 B;  3ZE1 B;  3NIG B;  4Z7O B;  2UZY B;  5E6U B;  4UM9 D;  3ZE0 B;  3AL8 B;  4Z7Q B;  3AFC A;  3T3P B;  2VDN B;  2VDK B;  4FWW A;  4O3T B;  2VDL B; 
#chains in the Genus database with same CATH topology
 2YU9 I;  1VQ5 Z;  2AYD A;  1PFT A;  3NH8 A;  3J80 f;  3TE5 B;  1K8A 2;  1VQL 1;  2QA4 1;  3I4M I;  4MD8 A;  1M90 2;  1QVF Z;  2JIR A;  4S1T A;  3HOV I;  1N2F A;  3J80 b;  2H85 A;  4DQY B;  1Z02 A;  2Y0S A;  4A3E I;  2F4M A;  2JS4 A;  2QR1 B;  1K9M 2;  3S1M I;  1WW9 A;  1M1K 2;  1VQK 1;  1N8R 2;  2JIQ A;  2RBL A;  5D1O A;  2Q4Z A;  3D9X A;  3I55 Z;  3Q87 A;  3FQM A;  3F3F C;  3S17 I;  4A3F I;  2QLV B;  4NB9 A;  5C4X I;  4A3L I;  2QEX 1;  3JAM f;  1VQO Z;  2QRC B;  3G4S 1;  1VQO 1;  2VPY A;  2W03 A;  3CCL Z;  5CM2 M;  1I6H I;  5IP7 I;  2QA4 Z;  1Z01 A;  3CME 1;  2VDK B;  3CC2 Z;  1VQN 1;  2F4O A;  1S72 1;  2VUG A;  4NBG A;  3AL9 A;  3OL2 A;  3M3Y I;  2OTL Z;  3P5J B;  3CCU Z;  2HU9 A;  3HOX I;  2VDP B;  4NBD A;  3NFZ A;  5AN9 F;  2Q51 A;  3G71 Z;  1YUK A;  1KRL A;  1LQL A;  3GTG I;  1QVF Y;  3JAM b;  3CD6 Z;  3GTP I;  1Y8C A;  2V3V A;  3GTL I;  1TWA I;  2VDN B;  3I4N I;  1YJN Z;  3HOW I;  3OL2 B;  4NOZ A;  3BG1 B;  2NVT I;  3QWU A;  5IT9 f;  3ZDX B;  3OW2 Z;  1NUI A;  5T67 A;  1X3Z A;  2R92 I;  2LIY A;  1USP A;  3GTK I;  3NH5 A;  3ESW A;  3CCE Z;  4BY7 I;  1OLZ A;  1P9N A;  2NVY I;  3NIG B;  3AL8 B;  4Z7Q B;  4FWW A;  1WZN A;  1YJN 1;  1YI2 Z;  1YIJ 1;  2JA6 I;  1QVG Y;  1ZH1 A;  2E2I I;  3CD6 1;  3S2D I;  3AL8 A;  2VPX A;  2E2J I;  3NDI A;  4UM9 B;  2P3Y A;  1WII A;  3GTQ I;  1SIW A;  2B63 I;  5A2Q b;  4NFR A;  2R6M A;  3S15 I;  3CQZ I;  1N8R 1;  3J81 b;  2UZY B;  3CPW Z;  3AFC A;  1RO0 A;  2KPI A;  2QRE B;  2VPW A;  3U50 C;  3T3M B;  1KC8 2;  1S7M A;  4Z7N B;  2DE6 A;  4A93 I;  2R93 I;  3S1N I;  1QYP A;  3CCS Z;  3S1R I;  2VDQ B;  2P26 A;  2QKD A;  1X0T A;  3S16 I;  3CCL 1;  5E6R B;  2QEX Z;  3H0G I;  4BBS I;  4NBA A;  1Q82 1;  2ZAE B;  4E31 A;  3VMH A;  3I55 1;  3CCQ Z;  1VQ4 1;  3EER A;  3ZE2 B;  2P28 A;  1AA6 A;  3CMA Z;  1VQK Z;  2IZ4 A;  1W2B Z;  2OTL 1;  3CC4 Z;  1YIT Z;  1VQ6 Z;  1Q82 2;  4DGL A;  1S72 Z;  2RHB A;  1JJ2 Y;  3KIH A;  2GTI A;  2BJO A;  4MH4 A;  1RQF A;  1K83 I;  4BY1 I;  3HOZ I;  4RVF A;  2JA8 I;  4WK4 B;  3VI3 B;  5T6B A;  2V8K A;  3CME Z;  5D1O B;  3OKY B;  2J6A A;  3GTM S;  3IFU A;  1TWG I;  5LL6 f;  2VDR B;  3GTO I;  3S1Q I;  3OW2 Y;  3VI4 B;  3FCU B;  1VQL Z;  1YJ9 Z;  4BXX I;  1Q81 1;  3ZE1 B;  4HGY A;  2LFU A;  2PMZ A;  4RVG A;  3G6E Z;  1I50 I;  2W04 A;  1VLA A;  4MXU A;  3CXC Z;  3RZD I;  5E6S B;  4NBH A;  3ZDZ B;  1VQ4 Z;  2VDM B;  4A3D I;  1VQ7 1;  5HDB B;  3CXC Y;  3RZO I;  5C4J I;  4MD7 A;  4HH4 A;  3NID B;  5IP9 I;  3VMI A;  1YUA A;  1DL6 A;  3HKZ A;  4RVD A;  4E2Y A;  1RO4 A;  1VQ5 1;  2DE5 A;  1KC8 1;  2E7Z A;  2JNY A;  3J81 f;  2AKL A;  3HOY I;  3MZK B;  3J7A 4;  4XX2 A;  5A2Q f;  3EED A;  2KI7 B;  4E33 A;  1M1K 1;  4NBE A;  4HGZ A;  4MON A;  3CCQ 1;  4UM8 B;  1NJI 1;  3GCF A;  3PO3 I;  1NP6 A;  1Q16 A;  4NBF A;  2LEX A;  4DK1 A;  3BG0 B;  1VQM Z;  2NVQ I;  2E9H A;  2O4H A;  4GZ8 A;  3VMG A;  1VQ8 Z;  1RNI A;  2GTH A;  2VDO B;  4MRI A;  4E30 A;  1I3Q I;  2JMO A;  1Y1W I;  2V8I A;  3ZDY B;  2IV2 X;  3VB9 A;  2JR6 A;  2NAP A;  3CCE 1;  1SHY B;  3I56 1;  4RVH A;  4WK0 B;  5FLX b;  4E2X A;  5IT9 b;  2JIO A;  2PM9 A;  3MON A;  1YHQ 1;  4UM9 D;  2QRD B;  2V8J A;  2V45 A;  2OOY B;  3IX0 A;  4MD9 A;  1K8A 1;  1Q86 1;  1USP B;  4K3J B;  3CPW Y;  1TWF I;  1K9M 1;  5C44 I;  4BBR I;  3HOU I;  4X6A I;  1VQ9 Z;  2O53 A;  4A3C I;  4O3T B;  2RIQ A;  1KD1 2;  4EWC A;  3CC7 Z;  2R7Z I;  2K5R A;  4AYB A;  2G2K A;  2OTJ Z;  3G71 1;  4WJK B;  4WK2 B;  1U8C B;  4A3K I;  1QVG Z;  1KQS Z;  2I3C A;  1Y1V S;  2WB1 A;  1VQP Z;  3GTJ I;  3G6E 1;  1TWC I;  1M90 1;  2JIP A;  3CCM Z;  1Q7Y 2;  2NVX I;  1FDO A;  1YJ9 1;  1Q7Y 1;  3G4S Z;  3GKQ A;  2PK7 A;  3FKI I;  1SSL A;  1KQS Y;  2VC2 B;  1Q81 2;  3CCV Z;  2JA7 I;  4NH1 C;  1ZB9 A;  3NDJ A;  4QTU A;  1NJI 2;  2OZK A;  1JJ2 Z;  3ZE0 B;  3CCM 1;  1Y1V I;  2DE7 A;  2VPZ A;  3IR7 A;  3CCU 1;  1VQP 1;  4A3M I;  1YIT 1;  4RV9 A;  3T4N B;  3S2H I;  3FQQ A;  3CC2 1;  1VQN Z;  3S14 I;  2OTJ 1;  1RO2 A;  2K3R A;  3CCV 1;  4NB8 A;  3KIF A;  4A3J I;  1TYE B;  1QF8 A;  3LUS A;  1TFI A;  4TNU A;  5E6U B;  3CCS 1;  3K7A I;  2VDL B;  3PO2 I;  1VQ6 1;  3CC4 1;  3CMA 1;  1R9T I;  1W2B Y;  1QXF A;  3F3P C;  3MZL B;  3D2L A;  1RLY A;  3CC7 1;  2VUM I;  3OKW A;  4A3B I;  1FDI A;  4Z7O B;  1YIJ Z;  2RPR A;  3CCJ Z;  4NBB A;  1VQ9 1;  4RS4 A;  5FLM I;  4E2W A;  3D6W A;  2M6N A;  2JIM A;  3CCR Z;  2YAD A;  3NIF B;  2HF1 A;  5T64 A;  2JWH A;  1YHQ Z;  1YJW Z;  1YJW 1;  4E2Z A;  5FLX f;  1L1O C;  3IF8 A;  3I56 Z;  4Y52 I;  5C3E I;  1X3W A;  3I07 A;  3CCR 1;  3CCJ 1;  4A3I I;  2JWG A;  1TWH I;  4Y7N I;  1Z03 A;  2VF1 A;  1VQ8 1;  1YI2 1;  1JWH C;  1WCM I;  3GTM I;  1ML8 A;  2M48 A;  2EGT A;  1VQM 1;  1KD1 1;  1SFO I;  3PO3 S;  2OOX B;  4O3U B;  4QTT A;  2JUB A;  4CL1 A;  3NH4 A;  4E32 A;  4A3G I;  1VQ7 Z;  5D1P A;  1WJ2 A;  1K73 2;  1Q86 2;  2JA5 I;  2IZ3 A;  3TDH B;  4NBC A;  1K73 1;  2GU2 A;  2E2H I;  2RT9 A;  3M4O I;  3T3P B;  3NVQ A;  2WAQ A;  3H3V J;  3VTN A;  1ZB8 A; 
#chains in the Genus database with same CATH homology
 2YU9 I;  1VQ5 Z;  1PFT A;  3NH8 A;  3J80 f;  3TE5 B;  1K8A 2;  1VQL 1;  2QA4 1;  3I4M I;  4MD8 A;  1M90 2;  1QVF Z;  4S1T A;  3HOV I;  1N2F A;  3J80 b;  2H85 A;  4DQY B;  1Z02 A;  2Y0S A;  4A3E I;  2F4M A;  2JS4 A;  2QR1 B;  1K9M 2;  3S1M I;  1WW9 A;  1M1K 2;  1VQK 1;  1N8R 2;  2RBL A;  5D1O A;  2Q4Z A;  3D9X A;  3I55 Z;  3Q87 A;  3FQM A;  3F3F C;  3S17 I;  4A3F I;  2QLV B;  4NB9 A;  5C4X I;  4A3L I;  2QEX 1;  3JAM f;  1VQO Z;  2QRC B;  3G4S 1;  1VQO 1;  2W03 A;  3CCL Z;  5CM2 M;  1I6H I;  5IP7 I;  2QA4 Z;  1Z01 A;  3CME 1;  2VDK B;  3CC2 Z;  1VQN 1;  2F4O A;  1S72 1;  2VUG A;  4NBG A;  3AL9 A;  3OL2 A;  3M3Y I;  2OTL Z;  3P5J B;  3CCU Z;  2HU9 A;  3HOX I;  2VDP B;  4NBD A;  3NFZ A;  5AN9 F;  2Q51 A;  3G71 Z;  1YUK A;  1KRL A;  1LQL A;  3GTG I;  1QVF Y;  3JAM b;  3CD6 Z;  3GTP I;  3GTL I;  1TWA I;  2VDN B;  3I4N I;  1YJN Z;  3HOW I;  3OL2 B;  4NOZ A;  3BG1 B;  2NVT I;  3QWU A;  5IT9 f;  3ZDX B;  3OW2 Z;  1NUI A;  5T67 A;  1X3Z A;  2R92 I;  2LIY A;  1USP A;  3GTK I;  3NH5 A;  3ESW A;  3CCE Z;  4BY7 I;  1OLZ A;  1P9N A;  2NVY I;  3NIG B;  3AL8 B;  4Z7Q B;  4FWW A;  1YJN 1;  1YI2 Z;  1YIJ 1;  2JA6 I;  1QVG Y;  1ZH1 A;  2E2I I;  3CD6 1;  3S2D I;  3AL8 A;  2E2J I;  3NDI A;  4UM9 B;  2P3Y A;  1WII A;  3GTQ I;  2B63 I;  5A2Q b;  4NFR A;  2R6M A;  3S15 I;  3CQZ I;  1N8R 1;  3J81 b;  2UZY B;  3CPW Z;  3AFC A;  2KPI A;  1RO0 A;  2QRE B;  3U50 C;  3T3M B;  1KC8 2;  1S7M A;  4Z7N B;  2DE6 A;  4A93 I;  2R93 I;  3S1N I;  1QYP A;  3CCS Z;  3S1R I;  2VDQ B;  2P26 A;  2QKD A;  1X0T A;  3S16 I;  3CCL 1;  5E6R B;  2QEX Z;  3H0G I;  4BBS I;  4NBA A;  1Q82 1;  2ZAE B;  4E31 A;  3VMH A;  3I55 1;  3CCQ Z;  1VQ4 1;  3EER A;  3ZE2 B;  2P28 A;  3CMA Z;  1VQK Z;  2IZ4 A;  1W2B Z;  2OTL 1;  3CC4 Z;  1YIT Z;  1VQ6 Z;  1Q82 2;  4DGL A;  1S72 Z;  2RHB A;  1JJ2 Y;  3KIH A;  2GTI A;  2BJO A;  4MH4 A;  1RQF A;  1K83 I;  4BY1 I;  3HOZ I;  4RVF A;  2JA8 I;  4WK4 B;  3VI3 B;  5T6B A;  2V8K A;  3CME Z;  5D1O B;  3OKY B;  2J6A A;  3GTM S;  3IFU A;  1TWG I;  5LL6 f;  2VDR B;  3GTO I;  3S1Q I;  3OW2 Y;  3VI4 B;  3FCU B;  1VQL Z;  1YJ9 Z;  4BXX I;  1Q81 1;  3ZE1 B;  4HGY A;  2LFU A;  2PMZ A;  4RVG A;  3G6E Z;  1I50 I;  2W04 A;  1VLA A;  4MXU A;  3CXC Z;  3RZD I;  5E6S B;  4NBH A;  3ZDZ B;  1VQ4 Z;  2VDM B;  4A3D I;  1VQ7 1;  5HDB B;  3CXC Y;  3RZO I;  5C4J I;  4MD7 A;  4HH4 A;  3NID B;  5IP9 I;  3VMI A;  1YUA A;  1DL6 A;  3HKZ A;  4RVD A;  4E2Y A;  1RO4 A;  1VQ5 1;  2DE5 A;  1KC8 1;  2JNY A;  3J81 f;  2AKL A;  3HOY I;  3MZK B;  3J7A 4;  4XX2 A;  5A2Q f;  3EED A;  2KI7 B;  4E33 A;  1M1K 1;  4NBE A;  4HGZ A;  4MON A;  3CCQ 1;  4UM8 B;  1NJI 1;  3GCF A;  3PO3 I;  1NP6 A;  4NBF A;  4DK1 A;  3BG0 B;  1VQM Z;  2NVQ I;  2E9H A;  2O4H A;  4GZ8 A;  3VMG A;  1RNI A;  2GTH A;  1VQ8 Z;  2VDO B;  4MRI A;  4E30 A;  1I3Q I;  2JMO A;  1Y1W I;  2V8I A;  3ZDY B;  3VB9 A;  2JR6 A;  3CCE 1;  1SHY B;  3I56 1;  4RVH A;  4WK0 B;  5FLX b;  4E2X A;  5IT9 b;  2PM9 A;  3MON A;  1YHQ 1;  4UM9 D;  2QRD B;  2V8J A;  2OOY B;  3IX0 A;  4MD9 A;  1K8A 1;  1Q86 1;  1USP B;  4K3J B;  3CPW Y;  1TWF I;  1K9M 1;  5C44 I;  4BBR I;  3HOU I;  4X6A I;  1VQ9 Z;  2O53 A;  4A3C I;  4O3T B;  2RIQ A;  1KD1 2;  4EWC A;  3CC7 Z;  2R7Z I;  2K5R A;  4AYB A;  2G2K A;  2OTJ Z;  3G71 1;  4WJK B;  4WK2 B;  1U8C B;  4A3K I;  1QVG Z;  1KQS Z;  2I3C A;  1Y1V S;  2WB1 A;  1VQP Z;  3GTJ I;  3G6E 1;  1TWC I;  1M90 1;  3CCM Z;  1Q7Y 2;  2NVX I;  1YJ9 1;  1Q7Y 1;  3G4S Z;  3GKQ A;  2PK7 A;  3FKI I;  1SSL A;  1KQS Y;  2VC2 B;  1Q81 2;  3CCV Z;  2JA7 I;  4NH1 C;  1ZB9 A;  3NDJ A;  4QTU A;  1NJI 2;  2OZK A;  1JJ2 Z;  3ZE0 B;  3CCM 1;  1Y1V I;  2DE7 A;  3CCU 1;  1VQP 1;  4A3M I;  1YIT 1;  4RV9 A;  3T4N B;  3S2H I;  3FQQ A;  3CC2 1;  1VQN Z;  3S14 I;  2OTJ 1;  1RO2 A;  2K3R A;  3CCV 1;  4NB8 A;  3KIF A;  4A3J I;  1TYE B;  1QF8 A;  3LUS A;  1TFI A;  4TNU A;  5E6U B;  3CCS 1;  3K7A I;  2VDL B;  3PO2 I;  1VQ6 1;  3CC4 1;  3CMA 1;  1R9T I;  1W2B Y;  3F3P C;  3MZL B;  1RLY A;  3CC7 1;  2VUM I;  3OKW A;  4A3B I;  4Z7O B;  1YIJ Z;  2RPR A;  3CCJ Z;  4NBB A;  1VQ9 1;  4RS4 A;  5FLM I;  3D6W A;  4E2W A;  2M6N A;  3CCR Z;  2YAD A;  3NIF B;  2HF1 A;  5T64 A;  2JWH A;  1YHQ Z;  1YJW Z;  1YJW 1;  4E2Z A;  5FLX f;  1L1O C;  3IF8 A;  3I56 Z;  4Y52 I;  5C3E I;  1X3W A;  3I07 A;  3CCR 1;  3CCJ 1;  4A3I I;  2JWG A;  1TWH I;  4Y7N I;  1Z03 A;  2VF1 A;  1VQ8 1;  1YI2 1;  1JWH C;  1WCM I;  3GTM I;  1ML8 A;  2M48 A;  2EGT A;  1VQM 1;  1KD1 1;  1SFO I;  3PO3 S;  2OOX B;  4O3U B;  4QTT A;  2JUB A;  4CL1 A;  3NH4 A;  4E32 A;  4A3G I;  1VQ7 Z;  5D1P A;  1K73 2;  1Q86 2;  2JA5 I;  2IZ3 A;  3TDH B;  4NBC A;  1K73 1;  2GU2 A;  2E2H I;  2RT9 A;  3M4O I;  3T3P B;  3NVQ A;  2WAQ A;  3H3V J;  3VTN A;  1ZB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...