1YUKA

The crystal structure of the psi/hybrid domain/ i-egf1 segment from the human integrin beta2 at 1.8 resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
94
Chain Sequence
b'QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEQKQLSPQKVTLYLRPGQAAAFNVTFRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-2 A chain
publication title The Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin {beta}2 Subunit at 1.8-A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 17
structure length 94
sequence length 99
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.150 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yukA02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1yukA01
2VDLB 1SHYB 4Z7NB 2VDKB 3NVQA 4K3JB 2UZYB 4Z7QB 3NIDB 3AL9A 4UM9D 5E6RB 3ZDZB 2VDRB 3AFCA 3ZE1B 2VDQB 3AL8B 4O3TB 4UM9B 2P26A 4WK2B 2VDNB 4O3UB 1OLZA 4FWWA 3FCUB 3AL8A 3OKYB 2VC2B 1YUKA 4WK4B 3OL2B 1SSLA 1TYEB 4Z7OB 3NIFB 4WK0B 2P28A 5E6UB 1U8CB 3OL2A 5E6SB 5HDBB 3OKWA 2VDPB 3ZE2B 2VDOB 3T3PB 4WJKB 2VDMB 3NIGB 4GZ8A 3T3MB 3ZE0B 3ZDXB 3VI3B 3ZDYB 3VI4B 4UM8B
chains in the Genus database with same CATH superfamily
3FQQA 1YJNZ 1NJI2 3HKZA 2IZ4A 2UZYB 3NIDB 1KD12 4NOZA 2P26A 2PM9A 4A3MI 4FWWA 2WAQA 3PO2I 2QREB 4QTUA 4BY1I 2JIMA 3KIFA 1M902 2KI7B 1VQ6Z 4NFRA 3CMAZ 1W2BY 1K9M2 1QXFA 1WZNA 4A93I 3QWUA 3S17I 3CCVZ 3VMGA 3CCQ1 3G4SZ 3EEDA 2K3RA 1S721 1Q861 3D9XA 3CCJ1 1SHYB 2VPYA 2E2JI 1TFIA 1R9TI 3CMEZ 3PO3S 3OW2Z 3NH8A 4O3TB 1X3WA 2RPRA 3GTOI 4MH4A 5C4XI 3I55Z 4Z7OB 1I6HI 1JJ2Z 4A3EI 2VDPB 2JUBA 4WJKB 5IP9I 1Q862 3I4MI 3I56Z 3P5JB 4NBGA 4HH4A 3J7A4 2JA5I 2VPXA 2OZKA 2V8KA 3CPWZ 4UM9D 2O4HA 2JR6A 2QRCB 3CC21 2B63I 1VQ81 3H0GI 3FCUB 2F4OA 5LL6f 3OW2Y 1KC82 4WK4B 2M6NA 3TE5B 2NVXI 5T67A 1YI21 2QKDA 4BY7I 1VQOZ 1VQP1 3G6E1 3NIGB 2NVYI 4Y52I 1YIJZ 3I07A 4E2YA 3BG0B 3GTGI 2E9HA 3GTMS 4UM8B 2M48A 2P3YA 4DQYB 1YIT1 2NVQI 1RNIA 2LFUA 3D6WA 2V8JA 4HGYA 5AN9F 1Y1VS 3CPWY 1OLZA 1SFOI 3FKII 4EWCA 1WIIA 2IZ3A 5IP7I 1VQ71 3VTNA 2JNYA 3GTMI 2Y0SA 3HOWI 4WK0B 2P28A 3GTKI 3M4OI 2JIQA 3CCE1 3CCMZ 4NBCA 2RBLA 2F4MA 1Y1VI 3IX0A 1DL6A 1VQKZ 2YU9I 3BG1B 2VDQB 2VUGA 3S16I 1QVFY 2Q51A 4HGZA 4E33A 3CCUZ 1K8A1 5C44I 2DE5A 1W2BZ 2JA8I 3VMIA 3S1MI 2PMZA 3G711 2HU9A 1VQMZ 4GZ8A 3T3MB 1YJN1 1Q811 4Y7NI 2GTIA 1YJWZ 2BJOA 2OOYB 1Z01A 4A3II 1Q7Y2 1NP6A 4A3KI 1VQLZ 3S1NI 2JWHA 1NUIA 1Q822 3VMHA 1USPA 2R7ZI 2V45A 3J81b 3ZE1B 3RZDI 4RS4A 3CCL1 4E2ZA 2QEXZ 5D1OB 1Q812 3CCV1 1QF8A 3J81f 1YJ9Z 2JA7I 2PK7A 1RLYA 1TWHI 4MD8A 1KQSZ 4A3FI 3CC71 5E6RB 3AL9A 3ZDZB 2NAPA 2Q4ZA 3I551 4A3CI 3IFUA 3OKYB 2VC2B 2QA4Z 3I561 2JWGA 2JA6I 2AKLA 1L1OC 3OKWA 4RVHA 3PO3I 5T64A 3KIHA 2HF1A 4AYBA 2G2KA 2E2HI 3S14I 1VQNZ 3K7AI 5C4JI 1KQSY 2JIOA 2ZAEB 3CCJZ 4X6AI 2GTHA 4A3DI 2E2II 2QRDB 2OTJ1 3NDJA 1FDOA 1YHQ1 1JWHC 4A3BI 2VDOB 3MZKB 2H85A 4NBAA 1RO4A 1ML8A 4NBHA 3CC4Z 3VI4B 4MRIA 1I50I 2JMOA 3J80b 3FQMA 4Z7NB 5C3EI 3NVQA 4K3JB 4DK1A 2OTL1 2KPIA 1VQ91 4NB9A 1QVFZ 1QVGZ 2W03A 3CCRZ 2DE7A 3EERA 3CCM1 2JS4A 4NH1C 1RO0A 1TWCI 3GCFA 2V8IA 3CC2Z 3D2LA 1VQ8Z 3RZOI 3ZE2B 3J80f 3GKQA 1N2FA 5A2Qb 3CD61 2R6MA 1VQ5Z 1X3ZA 1VQK1 1VLAA 3G6EZ 1RO2A 1Y1WI 2OOXB 1SIWA 4MD7A 3GTQI 4NB8A 1K83I 4TNUA 4E2XA 2EGTA 1YITZ 5A2Qf 2IV2X 4MD9A 3S1RI 4NBDA 2YADA 1QVGY 1KRLA 4MONA 3CCS1 1TYEB 1VQ4Z 3S1QI 1WW9A 1N8R1 4E32A 3NDIA 2RHBA 3CCEZ 2JIRA 2R92I 4E2WA 2VDKB 2J6AA 1ZB9A 3CXCZ 2RT9A 2QEX1 1K8A2 2QLVB 1VQ61 4E30A 3CMA1 2VUMI 2VPZA 3IR7A 1N8R2 3OL2B 1SSLA 2NVTI 5HDBB 3G4S1 1S7MA 3M3YI 1LQLA 3GTLI 2V3VA 4NBEA 3TDHB 3JAMb 4A3GI 3H3VJ 3VB9A 3CME1 4NBBA 3HOUI 3S2DI 4RVDA 2QA41 5FLMI 3ESWA 3CXCY 1ZB8A 1Z03A 4CL1A 4WK2B 2O53A 3JAMf 1RQFA 4RVGA 3OL2A 5D1OA 3MONA 3CCLZ 3T3PB 2W04A 4A3JI 1VQN1 3ZE0B 2QR1B 1TWGI 3ZDYB 5FLXb 3F3PC 3HOYI 3NFZA 2AYDA 3CCQZ 1M1K1 5IT9b 4BBRI 3GTPI 1S72Z 4O3UB 3CC7Z 1Z02A 3NH5A 1WCMI 1VQO1 1P9NA 3NIFB 1AA6A 3CC41 1U8CB 1YIJ1 5FLXf 1KC81 2VDMB 1TWFI 3IF8A 1PFTA 5IT9f 1M1K2 1YUAA 3CCR1 2VDLB 2R93I 1I3QI 2GU2A 3AL8B 3S2HI 1TWAI 2VDNB 5CM2M 1VQ51 2JIPA 4RVFA 2LIYA 2I3CA 1JJ2Y 3U50C 2DE6A 3LUSA 4BBSI 2OTJZ 2WB1A 1YHQZ 3I4NI 1YI2Z 1VQPZ 2LEXA 4MXUA 1Y8CA 2VDRB 1VQ41 3CCU1 4RV9A 1FDIA 4UM9B 1X0TA 2OTLZ 3AL8A 3S15I 1VQ9Z 1YUKA 1VQM1 3HOZI 2E7ZA 1YJW1 3MZLB 4DGLA 3HOVI 1K731 4A3LI 3GTJI 1VQ7Z 1VQL1 2K5RA 1ZH1A 3CQZI 1USPB 3CD6Z 2VF1A 1Q7Y1 4Z7QB 3AFCA 2RIQA 3T4NB 4BXXI 1Q821 4S1TA 1NJI1 1QYPA 1K732 3F3FC 5T6BA 1KD11 4XX2A 1YJ91 5E6UB 2VPWA 5E6SB 3NH4A 5D1PA 4NBFA 3CCSZ 4QTTA 1M901 3ZDXB 1WJ2A 4E31A 1Q16A 3Q87A 3VI3B 3G71Z 1K9M1 3HOXI
chains in the Genus database with same CATH topology
3FQQA 1YJNZ 1NJI2 3HKZA 2IZ4A 2UZYB 3NIDB 1KD12 4NOZA 2P26A 2PM9A 4A3MI 4FWWA 2WAQA 3PO2I 2QREB 4QTUA 4BY1I 3KIFA 1M902 2KI7B 1VQ6Z 4NFRA 3CMAZ 1W2BY 1K9M2 4A93I 3QWUA 3S17I 3CCVZ 3VMGA 3CCQ1 3G4SZ 3EEDA 2K3RA 1S721 1Q861 3D9XA 3CCJ1 1SHYB 2E2JI 3PO3S 1TFIA 1R9TI 3CMEZ 3OW2Z 3NH8A 4O3TB 1X3WA 2RPRA 3GTOI 4MH4A 5C4XI 3I55Z 4Z7OB 1I6HI 1JJ2Z 4A3EI 2VDPB 2JUBA 4WJKB 5IP9I 1Q862 3I4MI 3I56Z 3P5JB 4NBGA 4HH4A 3J7A4 2JA5I 2OZKA 2V8KA 3CPWZ 4UM9D 2O4HA 2JR6A 2QRCB 3CC21 2B63I 1VQ81 3H0GI 3FCUB 2F4OA 5LL6f 3OW2Y 1KC82 4WK4B 2M6NA 3TE5B 2NVXI 5T67A 1YI21 2QKDA 4BY7I 1VQOZ 1VQP1 3G6E1 3NIGB 2NVYI 4Y52I 1YIJZ 3I07A 4E2YA 3BG0B 3GTGI 2E9HA 3GTMS 4UM8B 2M48A 2P3YA 4DQYB 1YIT1 2NVQI 1RNIA 2LFUA 3D6WA 2V8JA 4HGYA 5AN9F 1Y1VS 3CPWY 1OLZA 1SFOI 3FKII 4EWCA 1WIIA 2IZ3A 5IP7I 1VQ71 3VTNA 2JNYA 3GTMI 2Y0SA 3HOWI 4WK0B 2P28A 3GTKI 3M4OI 3CCE1 3CCMZ 4NBCA 2RBLA 2F4MA 1Y1VI 3IX0A 1DL6A 1VQKZ 2YU9I 3BG1B 2VDQB 2VUGA 3S16I 1QVFY 2Q51A 4HGZA 4E33A 3CCUZ 1K8A1 5C44I 2DE5A 1W2BZ 2JA8I 3VMIA 3S1MI 2PMZA 3G711 2HU9A 1VQMZ 4GZ8A 3T3MB 1YJN1 1Q811 4Y7NI 2GTIA 1YJWZ 2BJOA 2OOYB 1Z01A 4A3II 1Q7Y2 1NP6A 4A3KI 1VQLZ 3S1NI 2JWHA 1NUIA 1Q822 3VMHA 1USPA 2R7ZI 3J81b 3ZE1B 3RZDI 4RS4A 3CCL1 4E2ZA 2QEXZ 5D1OB 1Q812 3CCV1 1QF8A 3J81f 1YJ9Z 2JA7I 2PK7A 1RLYA 1TWHI 4MD8A 1KQSZ 4A3FI 3CC71 5E6RB 3AL9A 3ZDZB 2Q4ZA 3I551 4A3CI 3IFUA 3OKYB 2VC2B 2QA4Z 3I561 2JWGA 2JA6I 2AKLA 1L1OC 3OKWA 4RVHA 3PO3I 5T64A 3KIHA 2HF1A 4AYBA 2G2KA 2E2HI 3S14I 1VQNZ 3K7AI 5C4JI 1KQSY 2ZAEB 3CCJZ 4X6AI 2GTHA 4A3DI 2E2II 2QRDB 2OTJ1 3NDJA 1YHQ1 1JWHC 4A3BI 2VDOB 3MZKB 2H85A 4NBAA 1RO4A 1ML8A 4NBHA 3CC4Z 3VI4B 4MRIA 1I50I 2JMOA 3J80b 3FQMA 4Z7NB 5C3EI 3NVQA 4K3JB 4DK1A 2OTL1 2KPIA 1VQ91 4NB9A 1QVFZ 1QVGZ 2W03A 3CCRZ 2DE7A 3EERA 3CCM1 2JS4A 4NH1C 1RO0A 1TWCI 3GCFA 2V8IA 3CC2Z 1VQ8Z 3RZOI 3ZE2B 3J80f 3GKQA 1N2FA 5A2Qb 3CD61 2R6MA 1VQ5Z 1X3ZA 1VQK1 1VLAA 3G6EZ 1RO2A 1Y1WI 2OOXB 4MD7A 3GTQI 4NB8A 1K83I 4TNUA 4E2XA 2EGTA 1YITZ 5A2Qf 4MD9A 3S1RI 4NBDA 2YADA 1QVGY 1KRLA 4MONA 3CCS1 1TYEB 1VQ4Z 3S1QI 1WW9A 1N8R1 4E32A 3NDIA 2RHBA 3CCEZ 2R92I 4E2WA 2VDKB 2J6AA 1ZB9A 3CXCZ 2RT9A 2QEX1 1K8A2 2QLVB 1VQ61 4E30A 3CMA1 2VUMI 1N8R2 3OL2B 1SSLA 2NVTI 5HDBB 3G4S1 1S7MA 3M3YI 1LQLA 3GTLI 4NBEA 3TDHB 3JAMb 4A3GI 3H3VJ 3VB9A 3CME1 4NBBA 3HOUI 3S2DI 4RVDA 2QA41 5FLMI 3ESWA 3CXCY 1ZB8A 1Z03A 4CL1A 4WK2B 2O53A 3JAMf 1RQFA 4RVGA 3OL2A 5D1OA 3MONA 3CCLZ 3T3PB 2W04A 4A3JI 1VQN1 3ZE0B 2QR1B 1TWGI 3ZDYB 5FLXb 3F3PC 3HOYI 3NFZA 3CCQZ 1M1K1 5IT9b 4BBRI 3GTPI 1S72Z 4O3UB 3CC7Z 1Z02A 3NH5A 1WCMI 1VQO1 1P9NA 3NIFB 3CC41 1U8CB 1YIJ1 5FLXf 1KC81 2VDMB 1TWFI 3IF8A 1PFTA 5IT9f 1M1K2 1YUAA 3CCR1 2VDLB 2R93I 1I3QI 2GU2A 3AL8B 3S2HI 1TWAI 2VDNB 5CM2M 1VQ51 4RVFA 2LIYA 2I3CA 1JJ2Y 3U50C 2DE6A 3LUSA 4BBSI 2OTJZ 2WB1A 1YHQZ 3I4NI 1YI2Z 1VQPZ 4MXUA 2VDRB 1VQ41 3CCU1 4RV9A 4UM9B 1X0TA 2OTLZ 3AL8A 3S15I 1VQ9Z 1YUKA 1VQM1 3HOZI 1YJW1 3MZLB 4DGLA 3HOVI 1K731 4A3LI 3GTJI 1VQ7Z 1VQL1 2K5RA 1ZH1A 3CQZI 1USPB 3CD6Z 2VF1A 1Q7Y1 4Z7QB 3AFCA 2RIQA 3T4NB 4BXXI 1Q821 4S1TA 1NJI1 1QYPA 1K732 3F3FC 5T6BA 1KD11 4XX2A 1YJ91 5E6UB 5E6SB 3NH4A 5D1PA 4NBFA 3CCSZ 4QTTA 1M901 3ZDXB 4E31A 3Q87A 3VI3B 3G71Z 1K9M1 3HOXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDL B;  1SHY B;  4Z7N B;  2VDK B;  3NVQ A;  4K3J B;  2UZY B;  4Z7Q B;  3NID B;  3AL9 A;  4UM9 D;  5E6R B;  3ZDZ B;  2VDR B;  3AFC A;  3ZE1 B;  2VDQ B;  3AL8 B;  4O3T B;  4UM9 B;  2P26 A;  4WK2 B;  2VDN B;  4O3U B;  1OLZ A;  4FWW A;  3FCU B;  3AL8 A;  3OKY B;  2VC2 B;  1YUK A;  4WK4 B;  3OL2 B;  1SSL A;  1TYE B;  4Z7O B;  3NIF B;  4WK0 B;  2P28 A;  5E6U B;  1U8C B;  3OL2 A;  5E6S B;  5HDB B;  3OKW A;  2VDP B;  3ZE2 B;  2VDO B;  3T3P B;  4WJK B;  2VDM B;  3NIG B;  4GZ8 A;  3T3M B;  3ZE0 B;  3ZDX B;  3VI3 B;  3ZDY B;  3VI4 B;  4UM8 B; 
#chains in the Genus database with same CATH topology
 3FQQ A;  1YJN Z;  1NJI 2;  3HKZ A;  2IZ4 A;  2UZY B;  3NID B;  1KD1 2;  4NOZ A;  2P26 A;  2PM9 A;  4A3M I;  4FWW A;  2WAQ A;  3PO2 I;  2QRE B;  4QTU A;  4BY1 I;  2JIM A;  3KIF A;  1M90 2;  2KI7 B;  1VQ6 Z;  4NFR A;  3CMA Z;  1W2B Y;  1K9M 2;  1QXF A;  1WZN A;  4A93 I;  3QWU A;  3S17 I;  3CCV Z;  3VMG A;  3CCQ 1;  3G4S Z;  3EED A;  2K3R A;  1S72 1;  1Q86 1;  3D9X A;  3CCJ 1;  1SHY B;  2VPY A;  2E2J I;  1TFI A;  1R9T I;  3CME Z;  3PO3 S;  3OW2 Z;  3NH8 A;  4O3T B;  1X3W A;  2RPR A;  3GTO I;  4MH4 A;  5C4X I;  3I55 Z;  4Z7O B;  1I6H I;  1JJ2 Z;  4A3E I;  2VDP B;  2JUB A;  4WJK B;  5IP9 I;  1Q86 2;  3I4M I;  3I56 Z;  3P5J B;  4NBG A;  4HH4 A;  3J7A 4;  2JA5 I;  2VPX A;  2OZK A;  2V8K A;  3CPW Z;  4UM9 D;  2O4H A;  2JR6 A;  2QRC B;  3CC2 1;  2B63 I;  1VQ8 1;  3H0G I;  3FCU B;  2F4O A;  5LL6 f;  3OW2 Y;  1KC8 2;  4WK4 B;  2M6N A;  3TE5 B;  2NVX I;  5T67 A;  1YI2 1;  2QKD A;  4BY7 I;  1VQO Z;  1VQP 1;  3G6E 1;  3NIG B;  2NVY I;  4Y52 I;  1YIJ Z;  3I07 A;  4E2Y A;  3BG0 B;  3GTG I;  2E9H A;  3GTM S;  4UM8 B;  2M48 A;  2P3Y A;  4DQY B;  1YIT 1;  2NVQ I;  1RNI A;  2LFU A;  3D6W A;  2V8J A;  4HGY A;  5AN9 F;  1Y1V S;  3CPW Y;  1OLZ A;  1SFO I;  3FKI I;  4EWC A;  1WII A;  2IZ3 A;  5IP7 I;  1VQ7 1;  3VTN A;  2JNY A;  3GTM I;  2Y0S A;  3HOW I;  4WK0 B;  2P28 A;  3GTK I;  3M4O I;  2JIQ A;  3CCE 1;  3CCM Z;  4NBC A;  2RBL A;  2F4M A;  1Y1V I;  3IX0 A;  1DL6 A;  1VQK Z;  2YU9 I;  3BG1 B;  2VDQ B;  2VUG A;  3S16 I;  1QVF Y;  2Q51 A;  4HGZ A;  4E33 A;  3CCU Z;  1K8A 1;  5C44 I;  2DE5 A;  1W2B Z;  2JA8 I;  3VMI A;  3S1M I;  2PMZ A;  3G71 1;  2HU9 A;  1VQM Z;  4GZ8 A;  3T3M B;  1YJN 1;  1Q81 1;  4Y7N I;  2GTI A;  1YJW Z;  2BJO A;  2OOY B;  1Z01 A;  4A3I I;  1Q7Y 2;  1NP6 A;  4A3K I;  1VQL Z;  3S1N I;  2JWH A;  1NUI A;  1Q82 2;  3VMH A;  1USP A;  2R7Z I;  2V45 A;  3J81 b;  3ZE1 B;  3RZD I;  4RS4 A;  3CCL 1;  4E2Z A;  2QEX Z;  5D1O B;  1Q81 2;  3CCV 1;  1QF8 A;  3J81 f;  1YJ9 Z;  2JA7 I;  2PK7 A;  1RLY A;  1TWH I;  4MD8 A;  1KQS Z;  4A3F I;  3CC7 1;  5E6R B;  3AL9 A;  3ZDZ B;  2NAP A;  2Q4Z A;  3I55 1;  4A3C I;  3IFU A;  3OKY B;  2VC2 B;  2QA4 Z;  3I56 1;  2JWG A;  2JA6 I;  2AKL A;  1L1O C;  3OKW A;  4RVH A;  3PO3 I;  5T64 A;  3KIH A;  2HF1 A;  4AYB A;  2G2K A;  2E2H I;  3S14 I;  1VQN Z;  3K7A I;  5C4J I;  1KQS Y;  2JIO A;  2ZAE B;  3CCJ Z;  4X6A I;  2GTH A;  4A3D I;  2E2I I;  2QRD B;  2OTJ 1;  3NDJ A;  1FDO A;  1YHQ 1;  1JWH C;  4A3B I;  2VDO B;  3MZK B;  2H85 A;  4NBA A;  1RO4 A;  1ML8 A;  4NBH A;  3CC4 Z;  3VI4 B;  4MRI A;  1I50 I;  2JMO A;  3J80 b;  3FQM A;  4Z7N B;  5C3E I;  3NVQ A;  4K3J B;  4DK1 A;  2OTL 1;  2KPI A;  1VQ9 1;  4NB9 A;  1QVF Z;  1QVG Z;  2W03 A;  3CCR Z;  2DE7 A;  3EER A;  3CCM 1;  2JS4 A;  4NH1 C;  1RO0 A;  1TWC I;  3GCF A;  2V8I A;  3CC2 Z;  3D2L A;  1VQ8 Z;  3RZO I;  3ZE2 B;  3J80 f;  3GKQ A;  1N2F A;  5A2Q b;  3CD6 1;  2R6M A;  1VQ5 Z;  1X3Z A;  1VQK 1;  1VLA A;  3G6E Z;  1RO2 A;  1Y1W I;  2OOX B;  1SIW A;  4MD7 A;  3GTQ I;  4NB8 A;  1K83 I;  4TNU A;  4E2X A;  2EGT A;  1YIT Z;  5A2Q f;  2IV2 X;  4MD9 A;  3S1R I;  4NBD A;  2YAD A;  1QVG Y;  1KRL A;  4MON A;  3CCS 1;  1TYE B;  1VQ4 Z;  3S1Q I;  1WW9 A;  1N8R 1;  4E32 A;  3NDI A;  2RHB A;  3CCE Z;  2JIR A;  2R92 I;  4E2W A;  2VDK B;  2J6A A;  1ZB9 A;  3CXC Z;  2RT9 A;  2QEX 1;  1K8A 2;  2QLV B;  1VQ6 1;  4E30 A;  3CMA 1;  2VUM I;  2VPZ A;  3IR7 A;  1N8R 2;  3OL2 B;  1SSL A;  2NVT I;  5HDB B;  3G4S 1;  1S7M A;  3M3Y I;  1LQL A;  3GTL I;  2V3V A;  4NBE A;  3TDH B;  3JAM b;  4A3G I;  3H3V J;  3VB9 A;  3CME 1;  4NBB A;  3HOU I;  3S2D I;  4RVD A;  2QA4 1;  5FLM I;  3ESW A;  3CXC Y;  1ZB8 A;  1Z03 A;  4CL1 A;  4WK2 B;  2O53 A;  3JAM f;  1RQF A;  4RVG A;  3OL2 A;  5D1O A;  3MON A;  3CCL Z;  3T3P B;  2W04 A;  4A3J I;  1VQN 1;  3ZE0 B;  2QR1 B;  1TWG I;  3ZDY B;  5FLX b;  3F3P C;  3HOY I;  3NFZ A;  2AYD A;  3CCQ Z;  1M1K 1;  5IT9 b;  4BBR I;  3GTP I;  1S72 Z;  4O3U B;  3CC7 Z;  1Z02 A;  3NH5 A;  1WCM I;  1VQO 1;  1P9N A;  3NIF B;  1AA6 A;  3CC4 1;  1U8C B;  1YIJ 1;  5FLX f;  1KC8 1;  2VDM B;  1TWF I;  3IF8 A;  1PFT A;  5IT9 f;  1M1K 2;  1YUA A;  3CCR 1;  2VDL B;  2R93 I;  1I3Q I;  2GU2 A;  3AL8 B;  3S2H I;  1TWA I;  2VDN B;  5CM2 M;  1VQ5 1;  2JIP A;  4RVF A;  2LIY A;  2I3C A;  1JJ2 Y;  3U50 C;  2DE6 A;  3LUS A;  4BBS I;  2OTJ Z;  2WB1 A;  1YHQ Z;  3I4N I;  1YI2 Z;  1VQP Z;  2LEX A;  4MXU A;  1Y8C A;  2VDR B;  1VQ4 1;  3CCU 1;  4RV9 A;  1FDI A;  4UM9 B;  1X0T A;  2OTL Z;  3AL8 A;  3S15 I;  1VQ9 Z;  1YUK A;  1VQM 1;  3HOZ I;  2E7Z A;  1YJW 1;  3MZL B;  4DGL A;  3HOV I;  1K73 1;  4A3L I;  3GTJ I;  1VQ7 Z;  1VQL 1;  2K5R A;  1ZH1 A;  3CQZ I;  1USP B;  3CD6 Z;  2VF1 A;  1Q7Y 1;  4Z7Q B;  3AFC A;  2RIQ A;  3T4N B;  4BXX I;  1Q82 1;  4S1T A;  1NJI 1;  1QYP A;  1K73 2;  3F3F C;  5T6B A;  1KD1 1;  4XX2 A;  1YJ9 1;  5E6U B;  2VPW A;  5E6S B;  3NH4 A;  5D1P A;  4NBF A;  3CCS Z;  4QTT A;  1M90 1;  3ZDX B;  1WJ2 A;  4E31 A;  1Q16 A;  3Q87 A;  3VI3 B;  3G71 Z;  1K9M 1;  3HOX I; 
#chains in the Genus database with same CATH homology
 3FQQ A;  1YJN Z;  1NJI 2;  3HKZ A;  2IZ4 A;  2UZY B;  3NID B;  1KD1 2;  4NOZ A;  2P26 A;  2PM9 A;  4A3M I;  4FWW A;  2WAQ A;  3PO2 I;  2QRE B;  4QTU A;  4BY1 I;  3KIF A;  1M90 2;  2KI7 B;  1VQ6 Z;  4NFR A;  3CMA Z;  1W2B Y;  1K9M 2;  4A93 I;  3QWU A;  3S17 I;  3CCV Z;  3VMG A;  3CCQ 1;  3G4S Z;  3EED A;  2K3R A;  1S72 1;  1Q86 1;  3D9X A;  3CCJ 1;  1SHY B;  2E2J I;  3PO3 S;  1TFI A;  1R9T I;  3CME Z;  3OW2 Z;  3NH8 A;  4O3T B;  1X3W A;  2RPR A;  3GTO I;  4MH4 A;  5C4X I;  3I55 Z;  4Z7O B;  1I6H I;  1JJ2 Z;  4A3E I;  2VDP B;  2JUB A;  4WJK B;  5IP9 I;  1Q86 2;  3I4M I;  3I56 Z;  3P5J B;  4NBG A;  4HH4 A;  3J7A 4;  2JA5 I;  2OZK A;  2V8K A;  3CPW Z;  4UM9 D;  2O4H A;  2JR6 A;  2QRC B;  3CC2 1;  2B63 I;  1VQ8 1;  3H0G I;  3FCU B;  2F4O A;  5LL6 f;  3OW2 Y;  1KC8 2;  4WK4 B;  2M6N A;  3TE5 B;  2NVX I;  5T67 A;  1YI2 1;  2QKD A;  4BY7 I;  1VQO Z;  1VQP 1;  3G6E 1;  3NIG B;  2NVY I;  4Y52 I;  1YIJ Z;  3I07 A;  4E2Y A;  3BG0 B;  3GTG I;  2E9H A;  3GTM S;  4UM8 B;  2M48 A;  2P3Y A;  4DQY B;  1YIT 1;  2NVQ I;  1RNI A;  2LFU A;  3D6W A;  2V8J A;  4HGY A;  5AN9 F;  1Y1V S;  3CPW Y;  1OLZ A;  1SFO I;  3FKI I;  4EWC A;  1WII A;  2IZ3 A;  5IP7 I;  1VQ7 1;  3VTN A;  2JNY A;  3GTM I;  2Y0S A;  3HOW I;  4WK0 B;  2P28 A;  3GTK I;  3M4O I;  3CCE 1;  3CCM Z;  4NBC A;  2RBL A;  2F4M A;  1Y1V I;  3IX0 A;  1DL6 A;  1VQK Z;  2YU9 I;  3BG1 B;  2VDQ B;  2VUG A;  3S16 I;  1QVF Y;  2Q51 A;  4HGZ A;  4E33 A;  3CCU Z;  1K8A 1;  5C44 I;  2DE5 A;  1W2B Z;  2JA8 I;  3VMI A;  3S1M I;  2PMZ A;  3G71 1;  2HU9 A;  1VQM Z;  4GZ8 A;  3T3M B;  1YJN 1;  1Q81 1;  4Y7N I;  2GTI A;  1YJW Z;  2BJO A;  2OOY B;  1Z01 A;  4A3I I;  1Q7Y 2;  1NP6 A;  4A3K I;  1VQL Z;  3S1N I;  2JWH A;  1NUI A;  1Q82 2;  3VMH A;  1USP A;  2R7Z I;  3J81 b;  3ZE1 B;  3RZD I;  4RS4 A;  3CCL 1;  4E2Z A;  2QEX Z;  5D1O B;  1Q81 2;  3CCV 1;  1QF8 A;  3J81 f;  1YJ9 Z;  2JA7 I;  2PK7 A;  1RLY A;  1TWH I;  4MD8 A;  1KQS Z;  4A3F I;  3CC7 1;  5E6R B;  3AL9 A;  3ZDZ B;  2Q4Z A;  3I55 1;  4A3C I;  3IFU A;  3OKY B;  2VC2 B;  2QA4 Z;  3I56 1;  2JWG A;  2JA6 I;  2AKL A;  1L1O C;  3OKW A;  4RVH A;  3PO3 I;  5T64 A;  3KIH A;  2HF1 A;  4AYB A;  2G2K A;  2E2H I;  3S14 I;  1VQN Z;  3K7A I;  5C4J I;  1KQS Y;  2ZAE B;  3CCJ Z;  4X6A I;  2GTH A;  4A3D I;  2E2I I;  2QRD B;  2OTJ 1;  3NDJ A;  1YHQ 1;  1JWH C;  4A3B I;  2VDO B;  3MZK B;  2H85 A;  4NBA A;  1RO4 A;  1ML8 A;  4NBH A;  3CC4 Z;  3VI4 B;  4MRI A;  1I50 I;  2JMO A;  3J80 b;  3FQM A;  4Z7N B;  5C3E I;  3NVQ A;  4K3J B;  4DK1 A;  2OTL 1;  2KPI A;  1VQ9 1;  4NB9 A;  1QVF Z;  1QVG Z;  2W03 A;  3CCR Z;  2DE7 A;  3EER A;  3CCM 1;  2JS4 A;  4NH1 C;  1RO0 A;  1TWC I;  3GCF A;  2V8I A;  3CC2 Z;  1VQ8 Z;  3RZO I;  3ZE2 B;  3J80 f;  3GKQ A;  1N2F A;  5A2Q b;  3CD6 1;  2R6M A;  1VQ5 Z;  1X3Z A;  1VQK 1;  1VLA A;  3G6E Z;  1RO2 A;  1Y1W I;  2OOX B;  4MD7 A;  3GTQ I;  4NB8 A;  1K83 I;  4TNU A;  4E2X A;  2EGT A;  1YIT Z;  5A2Q f;  4MD9 A;  3S1R I;  4NBD A;  2YAD A;  1QVG Y;  1KRL A;  4MON A;  3CCS 1;  1TYE B;  1VQ4 Z;  3S1Q I;  1WW9 A;  1N8R 1;  4E32 A;  3NDI A;  2RHB A;  3CCE Z;  2R92 I;  4E2W A;  2VDK B;  2J6A A;  1ZB9 A;  3CXC Z;  2RT9 A;  2QEX 1;  1K8A 2;  2QLV B;  1VQ6 1;  4E30 A;  3CMA 1;  2VUM I;  1N8R 2;  3OL2 B;  1SSL A;  2NVT I;  5HDB B;  3G4S 1;  1S7M A;  3M3Y I;  1LQL A;  3GTL I;  4NBE A;  3TDH B;  3JAM b;  4A3G I;  3H3V J;  3VB9 A;  3CME 1;  4NBB A;  3HOU I;  3S2D I;  4RVD A;  2QA4 1;  5FLM I;  3ESW A;  3CXC Y;  1ZB8 A;  1Z03 A;  4CL1 A;  4WK2 B;  2O53 A;  3JAM f;  1RQF A;  4RVG A;  3OL2 A;  5D1O A;  3MON A;  3CCL Z;  3T3P B;  2W04 A;  4A3J I;  1VQN 1;  3ZE0 B;  2QR1 B;  1TWG I;  3ZDY B;  5FLX b;  3F3P C;  3HOY I;  3NFZ A;  3CCQ Z;  1M1K 1;  5IT9 b;  4BBR I;  3GTP I;  1S72 Z;  4O3U B;  3CC7 Z;  1Z02 A;  3NH5 A;  1WCM I;  1VQO 1;  1P9N A;  3NIF B;  3CC4 1;  1U8C B;  1YIJ 1;  5FLX f;  1KC8 1;  2VDM B;  1TWF I;  3IF8 A;  1PFT A;  5IT9 f;  1M1K 2;  1YUA A;  3CCR 1;  2VDL B;  2R93 I;  1I3Q I;  2GU2 A;  3AL8 B;  3S2H I;  1TWA I;  2VDN B;  5CM2 M;  1VQ5 1;  4RVF A;  2LIY A;  2I3C A;  1JJ2 Y;  3U50 C;  2DE6 A;  3LUS A;  4BBS I;  2OTJ Z;  2WB1 A;  1YHQ Z;  3I4N I;  1YI2 Z;  1VQP Z;  4MXU A;  2VDR B;  1VQ4 1;  3CCU 1;  4RV9 A;  4UM9 B;  1X0T A;  2OTL Z;  3AL8 A;  3S15 I;  1VQ9 Z;  1YUK A;  1VQM 1;  3HOZ I;  1YJW 1;  3MZL B;  4DGL A;  3HOV I;  1K73 1;  4A3L I;  3GTJ I;  1VQ7 Z;  1VQL 1;  2K5R A;  1ZH1 A;  3CQZ I;  1USP B;  3CD6 Z;  2VF1 A;  1Q7Y 1;  4Z7Q B;  3AFC A;  2RIQ A;  3T4N B;  4BXX I;  1Q82 1;  4S1T A;  1NJI 1;  1QYP A;  1K73 2;  3F3F C;  5T6B A;  1KD1 1;  4XX2 A;  1YJ9 1;  5E6U B;  5E6S B;  3NH4 A;  5D1P A;  4NBF A;  3CCS Z;  4QTT A;  1M90 1;  3ZDX B;  4E31 A;  3Q87 A;  3VI3 B;  3G71 Z;  1K9M 1;  3HOX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...