1YUKA

The crystal structure of the psi/hybrid domain/ i-egf1 segment from the human integrin beta2 at 1.8 resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
94
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEQKQLSPQKVTLYLRPGQAAAFNVTFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-2 A chain
publication title The Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin {beta}2 Subunit at 1.8-A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 17
structure length 94
sequence length 99
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.150 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yukA02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 1yukA01
3ZDZB 3ZE2B 3OL2A 3ZE0B 1U8CB 3VI3B 4Z7NB 5E6UB 3AL8A 1SHYB 2VDPB 4K3JB 4O3TB 4WK4B 3OKWA 2VDLB 3ZDYB 3ZDXB 1OLZA 3NIGB 2VDRB 2VC2B 3NIFB 1TYEB 3T3MB 5E6RB 3FCUB 4WK2B 2VDNB 3AFCA 3NIDB 4WJKB 2P28A 5HDBB 4WK0B 3ZE1B 1YUKA 2P26A 3OL2B 2VDOB 4O3UB 4Z7OB 4UM8B 3OKYB 2VDKB 2UZYB 4UM9D 5E6SB 4UM9B 4GZ8A 4Z7QB 3AL9A 3AL8B 1SSLA 2VDMB 3T3PB 3VI4B 3NVQA 2VDQB 4FWWA
chains in the Genus database with same CATH superfamily
1P9NA 2YU9I 4DGLA 3ZE0B 2LFUA 3S1QI 1TWAI 2NVYI 2O4HA 2JA7I 3CCQZ 3J7A4 2V8JA 4E2WA 1N8R2 3NH4A 3OW2Z 5IT9f 3M4OI 1TWGI 3AL9A 2RT9A 2OTJ1 1FDOA 4DQYB 3OL2A 3GTJI 2BJOA 2R92I 2P3YA 1M1K2 3OW2Y 1QVGZ 2JIMA 4O3TB 1KC81 2ZAEB 2VPYA 3T3MB 2JIQA 3NFZA 3CCU1 5HDBB 3NIDB 3J80f 1YHQ1 3GTMS 1Q7Y1 3G711 1QVGY 2QA41 3CXCZ 3NDIA 3CCRZ 4HGZA 3K7AI 3CQZI 2K5RA 2QLVB 1PFTA 3I07A 5IP9I 3CD6Z 1K8A1 1DL6A 3AL8A 4RV9A 4BY7I 3CCS1 3GTPI 3VMIA 4NB8A 4MXUA 2J6AA 2VF1A 3T3PB 3MONA 3GCFA 1VQPZ 1YJWZ 4NBHA 3HOYI 2W03A 4NB9A 3PO3S 3CCLZ 2VPXA 4UM9D 1VQNZ 1VLAA 4FWWA 2EGTA 4E2ZA 3T4NB 1NJI1 2VDPB 4K3JB 2RHBA 3HOZI 1Q812 2OTJZ 1I3QI 2VPZA 1VQO1 3CCMZ 1AA6A 3MZLB 3J81f 1VQ91 3FCUB 3ZE2B 3HKZA 4A3KI 1USPB 2E7ZA 1X3ZA 2JNYA 1VQL1 4Y52I 2V8KA 5A2Qb 2JA6I 3CCUZ 1VQ5Z 1YHQZ 1YJN1 2QR1B 3NDJA 1NP6A 3G71Z 2QA4Z 2QRCB 1L1OC 2W04A 1YIJ1 2Q4ZA 5LL6f 2JWGA 4CL1A 2DE7A 2Y0SA 3FKII 1Q862 4NFRA 1Y8CA 3S15I 4A3GI 3CCR1 1YJ91 2VDNB 1ZB9A 3I551 4Z7OB 3GTQI 3PO3I 3CPWY 2VDKB 3D6WA 3CD61 3Q87A 1SSLA 2DE6A 5C3EI 1YIT1 4A3EI 5T67A 2JA8I 3CCJ1 1RO2A 4MRIA 2JIPA 3IF8A 1X0TA 4E2XA 2HU9A 3KIFA 1VQP1 3G4SZ 1Z03A 1YJW1 4BBRI 4NBDA 1KC82 3ESWA 3S17I 3ZDXB 1RO4A 4A3BI 4XX2A 1Q861 1S7MA 4QTTA 2NVQI 3CCL1 1RO0A 2F4MA 3BG1B 1VQN1 1YUKA 2P26A 4O3UB 1Q7Y2 1VQOZ 5AN9F 4BBSI 1QXFA 1VQ9Z 3RZOI 3NVQA 2VDQB 5T6BA 3ZDZB 2QRDB 2JA5I 2QKDA 3JAMb 3CCM1 1K8A2 5E6UB 2K3RA 1SHYB 1KRLA 4WK4B 1VQLZ 3S1RI 2PK7A 2JUBA 3NH5A 3HOVI 1YJNZ 5FLXb 5E6RB 2AKLA 1VQ51 1YIJZ 1Q822 4E31A 1YI21 1YJ9Z 5IP7I 3I55Z 4AYBA 5CM2M 2YADA 4BY1I 1NJI2 4A3FI 4NBBA 4MD8A 4NBGA 1YITZ 2WAQA 2RPRA 1N2FA 3NH8A 3CCJZ 2I3CA 1KQSZ 1SFOI 2LEXA 3TE5B 2VC2B 4NH1C 2E2JI 2QREB 3OL2B 1VQK1 1YUAA 3BG0B 2R7ZI 3EEDA 3GTGI 2G2KA 2JIRA 1VQ6Z 1Q821 4X6AI 3S1MI 3VTNA 1WIIA 1KD12 1Y1VS 2VUGA 3G4S1 1KQSY 4RVGA 2B63I 2H85A 3VI3B 3GKQA 4QTUA 5D1OA 3RZDI 1TWFI 4BXXI 3FQMA 2AYDA 1JWHC 1Z02A 4A3CI 2Q51A 3GTMI 2E2HI 2P28A 1X3WA 2QEX1 5E6SB 3M3YI 2VPWA 2IV2X 2JS4A 2RIQA 4MH4A 1KD11 2M48A 4NOZA 3CPWZ 3S14I 3S2HI 4RVHA 1YI2Z 1W2BZ 1RQFA 3ZE1B 4WK0B 3D9XA 1S72Z 1I6HI 3D2LA 1Y1VI 1K9M2 3CCV1 3CMAZ 5IT9b 2VDMB 1W2BY 1VQ81 5D1PA 3FQQA 2NVXI 1VQKZ 3CC4Z 2KPIA 2DE5A 1K732 1JJ2Z 2KI7B 3QWUA 3OKWA 3VB9A 3VMHA 2HF1A 2JR6A 3ZDYB 2PM9A 3F3PC 1RLYA 4HGYA 1VQ61 4HH4A 1TYEB 3AFCA 3I4NI 5A2Qf 1WW9A 4MD9A 4UM8B 1LQLA 4RVDA 1M902 3U50C 5C4JI 1K9M1 1JJ2Y 3TDHB 3VI4B 3PO2I 5T64A 2F4OA 1U8CB 2QEXZ 3IX0A 2R6MA 2OOXB 4A3DI 4A3II 1K731 4EWCA 3CC7Z 3CC21 3H0GI 2PMZA 2IZ4A 4WK2B 4WJKB 3G6E1 2VDOB 2GU2A 2UZYB 4GZ8A 3P5JB 3HOXI 2OTL1 1M901 2IZ3A 2M6NA 2JMOA 2OZKA 3GTOI 4Y7NI 4NBEA 1VQM1 4Z7NB 1TWCI 1FDIA 1SIWA 4RVFA 5FLMI 3CCVZ 1VQ4Z 2GTHA 4A3MI 1S721 4E32A 2VDLB 1VQ8Z 4A93I 3I561 3CME1 3VMGA 1OLZA 1N8R1 2LIYA 1TWHI 3CMA1 2VDRB 2O53A 2OOYB 1K83I 3GTLI 1QVFZ 1NUIA 2E9HA 3JAMf 3CC41 3J81b 2NVTI 1VQ71 2JIOA 3H3VJ 3F3FC 3HOWI 3CCE1 1USPA 2NAPA 1M1K1 1TFIA 5FLXf 4E2YA 4E30A 3HOUI 2R93I 1QVFY 1Q16A 4A3LI 3CXCY 3MZKB 2WB1A 4NBAA 1WZNA 3NIGB 3NIFB 3S16I 4A3JI 1RNIA 4S1TA 5C4XI 3CC2Z 1ZH1A 1Y1WI 4NBCA 3AL8B 3CCQ1 4Z7QB 3CC71 4E33A 3G6EZ 2RBLA 2V8IA 4RS4A 4NBFA 3S1NI 2OTLZ 3EERA 3I4MI 3KIHA 1ZB8A 2JWHA 1VQMZ 4MONA 2GTIA 1QF8A 4DK1A 3S2DI 5C44I 3OKYB 1R9TI 3I56Z 3CMEZ 5D1OB 1WJ2A 2E2II 1VQ41 1I50I 3LUSA 1ML8A 1QYPA 4TNUA 1Q811 1VQ7Z 1WCMI 4MD7A 3CCEZ 1Z01A 3IR7A 3CCSZ 2V45A 3IFUA 3GTKI 2VUMI 4UM9B 2V3VA 3J80b
chains in the Genus database with same CATH topology
1P9NA 2YU9I 4DGLA 3ZE0B 2LFUA 3S1QI 1TWAI 2NVYI 2O4HA 2JA7I 3CCQZ 3J7A4 2V8JA 4E2WA 1N8R2 3NH4A 3OW2Z 5IT9f 3M4OI 1TWGI 3AL9A 2RT9A 2OTJ1 4DQYB 3OL2A 3GTJI 2BJOA 2R92I 2P3YA 1M1K2 3OW2Y 1QVGZ 4O3TB 1KC81 2ZAEB 3T3MB 3NFZA 3CCU1 5HDBB 3NIDB 3J80f 1YHQ1 3GTMS 1Q7Y1 3G711 1QVGY 2QA41 3CXCZ 3NDIA 3CCRZ 4HGZA 3K7AI 3CQZI 2K5RA 2QLVB 1PFTA 3I07A 5IP9I 3CD6Z 1K8A1 1DL6A 3AL8A 4RV9A 4BY7I 3CCS1 3GTPI 3VMIA 4NB8A 4MXUA 2J6AA 2VF1A 3T3PB 3MONA 3GCFA 1VQPZ 1YJWZ 4NBHA 3HOYI 2W03A 4NB9A 3PO3S 3CCLZ 4UM9D 1VQNZ 1VLAA 4FWWA 2EGTA 4E2ZA 3T4NB 1NJI1 2VDPB 4K3JB 2RHBA 3HOZI 1Q812 2OTJZ 1I3QI 1VQO1 3CCMZ 3MZLB 3J81f 1VQ91 3FCUB 3ZE2B 3HKZA 4A3KI 1USPB 1X3ZA 2JNYA 1VQL1 4Y52I 2V8KA 5A2Qb 2JA6I 3CCUZ 1VQ5Z 1YHQZ 1YJN1 2QR1B 3NDJA 1NP6A 3G71Z 2QA4Z 2QRCB 1L1OC 2W04A 1YIJ1 2Q4ZA 5LL6f 2JWGA 4CL1A 2DE7A 2Y0SA 3FKII 1Q862 4NFRA 3S15I 4A3GI 3CCR1 1YJ91 2VDNB 1ZB9A 3I551 4Z7OB 3GTQI 3PO3I 3CPWY 2VDKB 3D6WA 3CD61 3Q87A 1SSLA 2DE6A 5C3EI 1YIT1 4A3EI 5T67A 2JA8I 3CCJ1 1RO2A 4MRIA 3IF8A 1X0TA 4E2XA 2HU9A 3KIFA 1VQP1 3G4SZ 1Z03A 1YJW1 4BBRI 4NBDA 1KC82 3ESWA 3S17I 3ZDXB 1RO4A 4A3BI 4XX2A 1Q861 1S7MA 4QTTA 2NVQI 3CCL1 1RO0A 2F4MA 3BG1B 1VQN1 1YUKA 2P26A 4O3UB 1Q7Y2 1VQOZ 5AN9F 4BBSI 1VQ9Z 3RZOI 3NVQA 2VDQB 5T6BA 3ZDZB 2QRDB 2JA5I 2QKDA 3JAMb 3CCM1 1K8A2 5E6UB 2K3RA 1SHYB 1KRLA 4WK4B 1VQLZ 3S1RI 2PK7A 2JUBA 3NH5A 3HOVI 1YJNZ 5FLXb 5E6RB 2AKLA 1VQ51 1YIJZ 1Q822 4E31A 1YI21 1YJ9Z 5IP7I 3I55Z 4AYBA 5CM2M 2YADA 4BY1I 1NJI2 4A3FI 4NBBA 4MD8A 4NBGA 1YITZ 2WAQA 2RPRA 1N2FA 3NH8A 3CCJZ 2I3CA 1KQSZ 1SFOI 3TE5B 2VC2B 4NH1C 2E2JI 2QREB 3OL2B 1VQK1 1YUAA 3BG0B 2R7ZI 3EEDA 3GTGI 2G2KA 1VQ6Z 1Q821 4X6AI 3S1MI 3VTNA 1WIIA 1KD12 1Y1VS 2VUGA 3G4S1 1KQSY 4RVGA 2B63I 2H85A 3VI3B 3GKQA 4QTUA 5D1OA 3RZDI 1TWFI 4BXXI 3FQMA 1JWHC 1Z02A 4A3CI 2Q51A 3GTMI 2E2HI 2P28A 1X3WA 2QEX1 5E6SB 3M3YI 2JS4A 2RIQA 4MH4A 1KD11 2M48A 4NOZA 3CPWZ 3S14I 3S2HI 4RVHA 1YI2Z 1W2BZ 1RQFA 3ZE1B 4WK0B 3D9XA 1S72Z 1I6HI 1Y1VI 1K9M2 3CCV1 3CMAZ 5IT9b 2VDMB 1W2BY 1VQ81 5D1PA 3FQQA 2NVXI 1VQKZ 3CC4Z 2KPIA 2DE5A 1K732 1JJ2Z 2KI7B 3QWUA 3OKWA 3VB9A 3VMHA 2HF1A 2JR6A 3ZDYB 2PM9A 3F3PC 1RLYA 4HGYA 1VQ61 4HH4A 1TYEB 3AFCA 3I4NI 5A2Qf 1WW9A 4MD9A 4UM8B 1LQLA 4RVDA 1M902 3U50C 5C4JI 1K9M1 1JJ2Y 3TDHB 3VI4B 3PO2I 5T64A 2F4OA 1U8CB 2QEXZ 3IX0A 2R6MA 2OOXB 4A3DI 4A3II 1K731 4EWCA 3CC7Z 3CC21 3H0GI 2PMZA 2IZ4A 4WK2B 4WJKB 3G6E1 2VDOB 2GU2A 2UZYB 4GZ8A 3P5JB 3HOXI 2OTL1 1M901 2IZ3A 2M6NA 2JMOA 2OZKA 3GTOI 4Y7NI 4NBEA 1VQM1 4Z7NB 1TWCI 4RVFA 5FLMI 3CCVZ 1VQ4Z 2GTHA 4A3MI 1S721 4E32A 2VDLB 1VQ8Z 4A93I 3I561 3CME1 3VMGA 1OLZA 1N8R1 2LIYA 1TWHI 3CMA1 2VDRB 2O53A 2OOYB 1K83I 3GTLI 1QVFZ 1NUIA 2E9HA 3JAMf 3CC41 3J81b 2NVTI 1VQ71 3H3VJ 3F3FC 3HOWI 3CCE1 1USPA 1M1K1 1TFIA 5FLXf 4E2YA 4E30A 3HOUI 2R93I 1QVFY 4A3LI 3CXCY 3MZKB 2WB1A 4NBAA 3NIGB 3NIFB 3S16I 4A3JI 1RNIA 4S1TA 5C4XI 3CC2Z 1ZH1A 1Y1WI 4NBCA 3AL8B 3CCQ1 4Z7QB 3CC71 4E33A 3G6EZ 2RBLA 2V8IA 4RS4A 4NBFA 3S1NI 2OTLZ 3EERA 3I4MI 3KIHA 1ZB8A 2JWHA 1VQMZ 4MONA 2GTIA 1QF8A 4DK1A 3S2DI 5C44I 3OKYB 1R9TI 3I56Z 3CMEZ 5D1OB 2E2II 1VQ41 1I50I 3LUSA 1ML8A 1QYPA 4TNUA 1Q811 1VQ7Z 1WCMI 4MD7A 3CCEZ 1Z01A 3CCSZ 3IFUA 3GTKI 2VUMI 4UM9B 3J80b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDZ B;  3ZE2 B;  3OL2 A;  3ZE0 B;  1U8C B;  3VI3 B;  4Z7N B;  5E6U B;  3AL8 A;  1SHY B;  2VDP B;  4K3J B;  4O3T B;  4WK4 B;  3OKW A;  2VDL B;  3ZDY B;  3ZDX B;  1OLZ A;  3NIG B;  2VDR B;  2VC2 B;  3NIF B;  1TYE B;  3T3M B;  5E6R B;  3FCU B;  4WK2 B;  2VDN B;  3AFC A;  3NID B;  4WJK B;  2P28 A;  5HDB B;  4WK0 B;  3ZE1 B;  1YUK A;  2P26 A;  3OL2 B;  2VDO B;  4O3U B;  4Z7O B;  4UM8 B;  3OKY B;  2VDK B;  2UZY B;  4UM9 D;  5E6S B;  4UM9 B;  4GZ8 A;  4Z7Q B;  3AL9 A;  3AL8 B;  1SSL A;  2VDM B;  3T3P B;  3VI4 B;  3NVQ A;  2VDQ B;  4FWW A; 
#chains in the Genus database with same CATH topology
 1P9N A;  2YU9 I;  4DGL A;  3ZE0 B;  2LFU A;  3S1Q I;  1TWA I;  2NVY I;  2O4H A;  2JA7 I;  3CCQ Z;  3J7A 4;  2V8J A;  4E2W A;  1N8R 2;  3NH4 A;  3OW2 Z;  5IT9 f;  3M4O I;  1TWG I;  3AL9 A;  2RT9 A;  2OTJ 1;  1FDO A;  4DQY B;  3OL2 A;  3GTJ I;  2BJO A;  2R92 I;  2P3Y A;  1M1K 2;  3OW2 Y;  1QVG Z;  2JIM A;  4O3T B;  1KC8 1;  2ZAE B;  2VPY A;  3T3M B;  2JIQ A;  3NFZ A;  3CCU 1;  5HDB B;  3NID B;  3J80 f;  1YHQ 1;  3GTM S;  1Q7Y 1;  3G71 1;  1QVG Y;  2QA4 1;  3CXC Z;  3NDI A;  3CCR Z;  4HGZ A;  3K7A I;  3CQZ I;  2K5R A;  2QLV B;  1PFT A;  3I07 A;  5IP9 I;  3CD6 Z;  1K8A 1;  1DL6 A;  3AL8 A;  4RV9 A;  4BY7 I;  3CCS 1;  3GTP I;  3VMI A;  4NB8 A;  4MXU A;  2J6A A;  2VF1 A;  3T3P B;  3MON A;  3GCF A;  1VQP Z;  1YJW Z;  4NBH A;  3HOY I;  2W03 A;  4NB9 A;  3PO3 S;  3CCL Z;  2VPX A;  4UM9 D;  1VQN Z;  1VLA A;  4FWW A;  2EGT A;  4E2Z A;  3T4N B;  1NJI 1;  2VDP B;  4K3J B;  2RHB A;  3HOZ I;  1Q81 2;  2OTJ Z;  1I3Q I;  2VPZ A;  1VQO 1;  3CCM Z;  1AA6 A;  3MZL B;  3J81 f;  1VQ9 1;  3FCU B;  3ZE2 B;  3HKZ A;  4A3K I;  1USP B;  2E7Z A;  1X3Z A;  2JNY A;  1VQL 1;  4Y52 I;  2V8K A;  5A2Q b;  2JA6 I;  3CCU Z;  1VQ5 Z;  1YHQ Z;  1YJN 1;  2QR1 B;  3NDJ A;  1NP6 A;  3G71 Z;  2QA4 Z;  2QRC B;  1L1O C;  2W04 A;  1YIJ 1;  2Q4Z A;  5LL6 f;  2JWG A;  4CL1 A;  2DE7 A;  2Y0S A;  3FKI I;  1Q86 2;  4NFR A;  1Y8C A;  3S15 I;  4A3G I;  3CCR 1;  1YJ9 1;  2VDN B;  1ZB9 A;  3I55 1;  4Z7O B;  3GTQ I;  3PO3 I;  3CPW Y;  2VDK B;  3D6W A;  3CD6 1;  3Q87 A;  1SSL A;  2DE6 A;  5C3E I;  1YIT 1;  4A3E I;  5T67 A;  2JA8 I;  3CCJ 1;  1RO2 A;  4MRI A;  2JIP A;  3IF8 A;  1X0T A;  4E2X A;  2HU9 A;  3KIF A;  1VQP 1;  3G4S Z;  1Z03 A;  1YJW 1;  4BBR I;  4NBD A;  1KC8 2;  3ESW A;  3S17 I;  3ZDX B;  1RO4 A;  4A3B I;  4XX2 A;  1Q86 1;  1S7M A;  4QTT A;  2NVQ I;  3CCL 1;  1RO0 A;  2F4M A;  3BG1 B;  1VQN 1;  1YUK A;  2P26 A;  4O3U B;  1Q7Y 2;  1VQO Z;  5AN9 F;  4BBS I;  1QXF A;  1VQ9 Z;  3RZO I;  3NVQ A;  2VDQ B;  5T6B A;  3ZDZ B;  2QRD B;  2JA5 I;  2QKD A;  3JAM b;  3CCM 1;  1K8A 2;  5E6U B;  2K3R A;  1SHY B;  1KRL A;  4WK4 B;  1VQL Z;  3S1R I;  2PK7 A;  2JUB A;  3NH5 A;  3HOV I;  1YJN Z;  5FLX b;  5E6R B;  2AKL A;  1VQ5 1;  1YIJ Z;  1Q82 2;  4E31 A;  1YI2 1;  1YJ9 Z;  5IP7 I;  3I55 Z;  4AYB A;  5CM2 M;  2YAD A;  4BY1 I;  1NJI 2;  4A3F I;  4NBB A;  4MD8 A;  4NBG A;  1YIT Z;  2WAQ A;  2RPR A;  1N2F A;  3NH8 A;  3CCJ Z;  2I3C A;  1KQS Z;  1SFO I;  2LEX A;  3TE5 B;  2VC2 B;  4NH1 C;  2E2J I;  2QRE B;  3OL2 B;  1VQK 1;  1YUA A;  3BG0 B;  2R7Z I;  3EED A;  3GTG I;  2G2K A;  2JIR A;  1VQ6 Z;  1Q82 1;  4X6A I;  3S1M I;  3VTN A;  1WII A;  1KD1 2;  1Y1V S;  2VUG A;  3G4S 1;  1KQS Y;  4RVG A;  2B63 I;  2H85 A;  3VI3 B;  3GKQ A;  4QTU A;  5D1O A;  3RZD I;  1TWF I;  4BXX I;  3FQM A;  2AYD A;  1JWH C;  1Z02 A;  4A3C I;  2Q51 A;  3GTM I;  2E2H I;  2P28 A;  1X3W A;  2QEX 1;  5E6S B;  3M3Y I;  2VPW A;  2IV2 X;  2JS4 A;  2RIQ A;  4MH4 A;  1KD1 1;  2M48 A;  4NOZ A;  3CPW Z;  3S14 I;  3S2H I;  4RVH A;  1YI2 Z;  1W2B Z;  1RQF A;  3ZE1 B;  4WK0 B;  3D9X A;  1S72 Z;  1I6H I;  3D2L A;  1Y1V I;  1K9M 2;  3CCV 1;  3CMA Z;  5IT9 b;  2VDM B;  1W2B Y;  1VQ8 1;  5D1P A;  3FQQ A;  2NVX I;  1VQK Z;  3CC4 Z;  2KPI A;  2DE5 A;  1K73 2;  1JJ2 Z;  2KI7 B;  3QWU A;  3OKW A;  3VB9 A;  3VMH A;  2HF1 A;  2JR6 A;  3ZDY B;  2PM9 A;  3F3P C;  1RLY A;  4HGY A;  1VQ6 1;  4HH4 A;  1TYE B;  3AFC A;  3I4N I;  5A2Q f;  1WW9 A;  4MD9 A;  4UM8 B;  1LQL A;  4RVD A;  1M90 2;  3U50 C;  5C4J I;  1K9M 1;  1JJ2 Y;  3TDH B;  3VI4 B;  3PO2 I;  5T64 A;  2F4O A;  1U8C B;  2QEX Z;  3IX0 A;  2R6M A;  2OOX B;  4A3D I;  4A3I I;  1K73 1;  4EWC A;  3CC7 Z;  3CC2 1;  3H0G I;  2PMZ A;  2IZ4 A;  4WK2 B;  4WJK B;  3G6E 1;  2VDO B;  2GU2 A;  2UZY B;  4GZ8 A;  3P5J B;  3HOX I;  2OTL 1;  1M90 1;  2IZ3 A;  2M6N A;  2JMO A;  2OZK A;  3GTO I;  4Y7N I;  4NBE A;  1VQM 1;  4Z7N B;  1TWC I;  1FDI A;  1SIW A;  4RVF A;  5FLM I;  3CCV Z;  1VQ4 Z;  2GTH A;  4A3M I;  1S72 1;  4E32 A;  2VDL B;  1VQ8 Z;  4A93 I;  3I56 1;  3CME 1;  3VMG A;  1OLZ A;  1N8R 1;  2LIY A;  1TWH I;  3CMA 1;  2VDR B;  2O53 A;  2OOY B;  1K83 I;  3GTL I;  1QVF Z;  1NUI A;  2E9H A;  3JAM f;  3CC4 1;  3J81 b;  2NVT I;  1VQ7 1;  2JIO A;  3H3V J;  3F3F C;  3HOW I;  3CCE 1;  1USP A;  2NAP A;  1M1K 1;  1TFI A;  5FLX f;  4E2Y A;  4E30 A;  3HOU I;  2R93 I;  1QVF Y;  1Q16 A;  4A3L I;  3CXC Y;  3MZK B;  2WB1 A;  4NBA A;  1WZN A;  3NIG B;  3NIF B;  3S16 I;  4A3J I;  1RNI A;  4S1T A;  5C4X I;  3CC2 Z;  1ZH1 A;  1Y1W I;  4NBC A;  3AL8 B;  3CCQ 1;  4Z7Q B;  3CC7 1;  4E33 A;  3G6E Z;  2RBL A;  2V8I A;  4RS4 A;  4NBF A;  3S1N I;  2OTL Z;  3EER A;  3I4M I;  3KIH A;  1ZB8 A;  2JWH A;  1VQM Z;  4MON A;  2GTI A;  1QF8 A;  4DK1 A;  3S2D I;  5C44 I;  3OKY B;  1R9T I;  3I56 Z;  3CME Z;  5D1O B;  1WJ2 A;  2E2I I;  1VQ4 1;  1I50 I;  3LUS A;  1ML8 A;  1QYP A;  4TNU A;  1Q81 1;  1VQ7 Z;  1WCM I;  4MD7 A;  3CCE Z;  1Z01 A;  3IR7 A;  3CCS Z;  2V45 A;  3IFU A;  3GTK I;  2VUM I;  4UM9 B;  2V3V A;  3J80 b; 
#chains in the Genus database with same CATH homology
 1P9N A;  2YU9 I;  4DGL A;  3ZE0 B;  2LFU A;  3S1Q I;  1TWA I;  2NVY I;  2O4H A;  2JA7 I;  3CCQ Z;  3J7A 4;  2V8J A;  4E2W A;  1N8R 2;  3NH4 A;  3OW2 Z;  5IT9 f;  3M4O I;  1TWG I;  3AL9 A;  2RT9 A;  2OTJ 1;  4DQY B;  3OL2 A;  3GTJ I;  2BJO A;  2R92 I;  2P3Y A;  1M1K 2;  3OW2 Y;  1QVG Z;  4O3T B;  1KC8 1;  2ZAE B;  3T3M B;  3NFZ A;  3CCU 1;  5HDB B;  3NID B;  3J80 f;  1YHQ 1;  3GTM S;  1Q7Y 1;  3G71 1;  1QVG Y;  2QA4 1;  3CXC Z;  3NDI A;  3CCR Z;  4HGZ A;  3K7A I;  3CQZ I;  2K5R A;  2QLV B;  1PFT A;  3I07 A;  5IP9 I;  3CD6 Z;  1K8A 1;  1DL6 A;  3AL8 A;  4RV9 A;  4BY7 I;  3CCS 1;  3GTP I;  3VMI A;  4NB8 A;  4MXU A;  2J6A A;  2VF1 A;  3T3P B;  3MON A;  3GCF A;  1VQP Z;  1YJW Z;  4NBH A;  3HOY I;  2W03 A;  4NB9 A;  3PO3 S;  3CCL Z;  4UM9 D;  1VQN Z;  1VLA A;  4FWW A;  2EGT A;  4E2Z A;  3T4N B;  1NJI 1;  2VDP B;  4K3J B;  2RHB A;  3HOZ I;  1Q81 2;  2OTJ Z;  1I3Q I;  1VQO 1;  3CCM Z;  3MZL B;  3J81 f;  1VQ9 1;  3FCU B;  3ZE2 B;  3HKZ A;  4A3K I;  1USP B;  1X3Z A;  2JNY A;  1VQL 1;  4Y52 I;  2V8K A;  5A2Q b;  2JA6 I;  3CCU Z;  1VQ5 Z;  1YHQ Z;  1YJN 1;  2QR1 B;  3NDJ A;  1NP6 A;  3G71 Z;  2QA4 Z;  2QRC B;  1L1O C;  2W04 A;  1YIJ 1;  2Q4Z A;  5LL6 f;  2JWG A;  4CL1 A;  2DE7 A;  2Y0S A;  3FKI I;  1Q86 2;  4NFR A;  3S15 I;  4A3G I;  3CCR 1;  1YJ9 1;  2VDN B;  1ZB9 A;  3I55 1;  4Z7O B;  3GTQ I;  3PO3 I;  3CPW Y;  2VDK B;  3D6W A;  3CD6 1;  3Q87 A;  1SSL A;  2DE6 A;  5C3E I;  1YIT 1;  4A3E I;  5T67 A;  2JA8 I;  3CCJ 1;  1RO2 A;  4MRI A;  3IF8 A;  1X0T A;  4E2X A;  2HU9 A;  3KIF A;  1VQP 1;  3G4S Z;  1Z03 A;  1YJW 1;  4BBR I;  4NBD A;  1KC8 2;  3ESW A;  3S17 I;  3ZDX B;  1RO4 A;  4A3B I;  4XX2 A;  1Q86 1;  1S7M A;  4QTT A;  2NVQ I;  3CCL 1;  1RO0 A;  2F4M A;  3BG1 B;  1VQN 1;  1YUK A;  2P26 A;  4O3U B;  1Q7Y 2;  1VQO Z;  5AN9 F;  4BBS I;  1VQ9 Z;  3RZO I;  3NVQ A;  2VDQ B;  5T6B A;  3ZDZ B;  2QRD B;  2JA5 I;  2QKD A;  3JAM b;  3CCM 1;  1K8A 2;  5E6U B;  2K3R A;  1SHY B;  1KRL A;  4WK4 B;  1VQL Z;  3S1R I;  2PK7 A;  2JUB A;  3NH5 A;  3HOV I;  1YJN Z;  5FLX b;  5E6R B;  2AKL A;  1VQ5 1;  1YIJ Z;  1Q82 2;  4E31 A;  1YI2 1;  1YJ9 Z;  5IP7 I;  3I55 Z;  4AYB A;  5CM2 M;  2YAD A;  4BY1 I;  1NJI 2;  4A3F I;  4NBB A;  4MD8 A;  4NBG A;  1YIT Z;  2WAQ A;  2RPR A;  1N2F A;  3NH8 A;  3CCJ Z;  2I3C A;  1KQS Z;  1SFO I;  3TE5 B;  2VC2 B;  4NH1 C;  2E2J I;  2QRE B;  3OL2 B;  1VQK 1;  1YUA A;  3BG0 B;  2R7Z I;  3EED A;  3GTG I;  2G2K A;  1VQ6 Z;  1Q82 1;  4X6A I;  3S1M I;  3VTN A;  1WII A;  1KD1 2;  1Y1V S;  2VUG A;  3G4S 1;  1KQS Y;  4RVG A;  2B63 I;  2H85 A;  3VI3 B;  3GKQ A;  4QTU A;  5D1O A;  3RZD I;  1TWF I;  4BXX I;  3FQM A;  1JWH C;  1Z02 A;  4A3C I;  2Q51 A;  3GTM I;  2E2H I;  2P28 A;  1X3W A;  2QEX 1;  5E6S B;  3M3Y I;  2JS4 A;  2RIQ A;  4MH4 A;  1KD1 1;  2M48 A;  4NOZ A;  3CPW Z;  3S14 I;  3S2H I;  4RVH A;  1YI2 Z;  1W2B Z;  1RQF A;  3ZE1 B;  4WK0 B;  3D9X A;  1S72 Z;  1I6H I;  1Y1V I;  1K9M 2;  3CCV 1;  3CMA Z;  5IT9 b;  2VDM B;  1W2B Y;  1VQ8 1;  5D1P A;  3FQQ A;  2NVX I;  1VQK Z;  3CC4 Z;  2KPI A;  2DE5 A;  1K73 2;  1JJ2 Z;  2KI7 B;  3QWU A;  3OKW A;  3VB9 A;  3VMH A;  2HF1 A;  2JR6 A;  3ZDY B;  2PM9 A;  3F3P C;  1RLY A;  4HGY A;  1VQ6 1;  4HH4 A;  1TYE B;  3AFC A;  3I4N I;  5A2Q f;  1WW9 A;  4MD9 A;  4UM8 B;  1LQL A;  4RVD A;  1M90 2;  3U50 C;  5C4J I;  1K9M 1;  1JJ2 Y;  3TDH B;  3VI4 B;  3PO2 I;  5T64 A;  2F4O A;  1U8C B;  2QEX Z;  3IX0 A;  2R6M A;  2OOX B;  4A3D I;  4A3I I;  1K73 1;  4EWC A;  3CC7 Z;  3CC2 1;  3H0G I;  2PMZ A;  2IZ4 A;  4WK2 B;  4WJK B;  3G6E 1;  2VDO B;  2GU2 A;  2UZY B;  4GZ8 A;  3P5J B;  3HOX I;  2OTL 1;  1M90 1;  2IZ3 A;  2M6N A;  2JMO A;  2OZK A;  3GTO I;  4Y7N I;  4NBE A;  1VQM 1;  4Z7N B;  1TWC I;  4RVF A;  5FLM I;  3CCV Z;  1VQ4 Z;  2GTH A;  4A3M I;  1S72 1;  4E32 A;  2VDL B;  1VQ8 Z;  4A93 I;  3I56 1;  3CME 1;  3VMG A;  1OLZ A;  1N8R 1;  2LIY A;  1TWH I;  3CMA 1;  2VDR B;  2O53 A;  2OOY B;  1K83 I;  3GTL I;  1QVF Z;  1NUI A;  2E9H A;  3JAM f;  3CC4 1;  3J81 b;  2NVT I;  1VQ7 1;  3H3V J;  3F3F C;  3HOW I;  3CCE 1;  1USP A;  1M1K 1;  1TFI A;  5FLX f;  4E2Y A;  4E30 A;  3HOU I;  2R93 I;  1QVF Y;  4A3L I;  3CXC Y;  3MZK B;  2WB1 A;  4NBA A;  3NIG B;  3NIF B;  3S16 I;  4A3J I;  1RNI A;  4S1T A;  5C4X I;  3CC2 Z;  1ZH1 A;  1Y1W I;  4NBC A;  3AL8 B;  3CCQ 1;  4Z7Q B;  3CC7 1;  4E33 A;  3G6E Z;  2RBL A;  2V8I A;  4RS4 A;  4NBF A;  3S1N I;  2OTL Z;  3EER A;  3I4M I;  3KIH A;  1ZB8 A;  2JWH A;  1VQM Z;  4MON A;  2GTI A;  1QF8 A;  4DK1 A;  3S2D I;  5C44 I;  3OKY B;  1R9T I;  3I56 Z;  3CME Z;  5D1O B;  2E2I I;  1VQ4 1;  1I50 I;  3LUS A;  1ML8 A;  1QYP A;  4TNU A;  1Q81 1;  1VQ7 Z;  1WCM I;  4MD7 A;  3CCE Z;  1Z01 A;  3CCS Z;  3IFU A;  3GTK I;  2VUM I;  4UM9 B;  3J80 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...