3CCE1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cce100
3I561 1VQ41 3G4SZ 1YIJZ 3CME1 3OW2Y 3CCRZ 1VQ5Z 2OTJZ 3CCLZ 1YJW1 1KC82 1YJ91 1VQ7Z 3CMA1 1M1K1 2QA4Z 1Q7Y2 1N8R1 1Q861 1K8A2 3I55Z 3CCMZ 1VQMZ 3G4S1 3CPWY 1KD12 1YIJ1 3CC4Z 3CCJZ 1QVGY 1VQ51 3CCL1 3CPWZ 1VQ71 2QA41 3CCQZ 3I551 3CCM1 1Q822 1QVGZ 1VQM1 1YHQZ 3CC41 3CCJ1 3CXCY 1NJI2 1VQLZ 1W2BY 3CCQ1 3CXCZ 1Q812 1YHQ1 3OW2Z 2QEXZ 3CCR1 2OTJ1 3CD6Z 1KC81 1VQL1 3G6EZ 1Q7Y1 1M902 1K8A1 1K9M2 1KQSY 2QEX1 1YITZ 1K732 1KD11 3CC7Z 1QVFY 1VQ6Z 1VQNZ 3CCUZ 1KQSZ 1VQOZ 3CD61 3CCVZ 3G6E1 1JJ2Y 1Q821 1YIT1 1W2BZ 1VQPZ 1NJI1 1VQKZ 1VQ61 3CC2Z 1M1K2 1VQN1 1YJNZ 2OTLZ 1VQO1 1N8R2 1Q862 3G71Z 1VQ9Z 3CCV1 1Q811 1VQ8Z 1YI2Z 1S72Z 3CCEZ 1VQP1 1VQK1 3CC21 3CCSZ 1YJN1 2OTL1 3G711 1VQ91 3I56Z 1M901 1VQ4Z 1K9M1 1YI21 1VQ81 1QVFZ 1S721 1K731 3CMEZ 3CCE1 3CC71 1YJWZ 3CMAZ 1YJ9Z 3CCS1 1JJ2Z 3CCU1
chains in the Genus database with same CATH superfamily
2VPZA 2Q4ZA 2QR1B 3G4SZ 1VQ41 1K83I 4NBBA 3CCRZ 2OTJZ 3IR7A 2VPWA 1YJW1 1Y1VI 1QYPA 3MZLB 3I55Z 3CCMZ 2JNYA 3G4S1 3S1RI 2PM9A 2NVQI 1Y8CA 1RLYA 4E2WA 3HOYI 4A3JI 4NBCA 3I551 3CCM1 1Q822 1YHQZ 2H85A 1NUIA 3PO3S 3RZDI 3BG1B 1YHQ1 1WCMI 4E2ZA 4A3KI 2WB1A 2V8KA 3G6EZ 1Q7Y1 2JIPA 1QXFA 2OOXB 1YITZ 1K732 5FLMI 2P28A 3F3PC 3CC7Z 5AN9F 2JIMA 1QVFY 4DGLA 2GTHA 2M48A 3CCUZ 1VQOZ 1KQSZ 2F4MA 5C4JI 3G6E1 3EEDA 1JJ2Y 1L1OC 4NBGA 5IT9b 2KI7B 4A3II 1YIT1 2JA6I 4A3MI 1W2BZ 1FDOA 1PFTA 1VQKZ 2DE7A 1YJNZ 1VQO1 3NFZA 1VQ9Z 2V8JA 2LFUA 1Q811 3RZOI 1VQ8Z 1YUAA 1NP6A 3FQMA 3CCEZ 2PK7A 1VQK1 2QRDB 1YJN1 1Z02A 2W04A 1RO4A 1VQ91 4NBFA 1VQ81 3CMEZ 3CCE1 2W03A 3S14I 1SFOI 2E2II 3S2HI 1DL6A 3GTMI 4MRIA 2VPYA 3U50C 2BJOA 1YIJZ 5D1OB 3CME1 1RQFA 1VQ5Z 3D6WA 3J80b 3CCLZ 1KC82 3KIHA 1M1K1 1Q861 3QWUA 1VQMZ 4A93I 3CPWY 3VMIA 1ZB9A 2J6AA 1YIJ1 4A3CI 1QVGY 1VQ51 3I4MI 2DE6A 3CCL1 4RV9A 5D1OA 3CCQZ 3NDJA 1VQM1 2RIQA 4E30A 4BY1I 2Q51A 3GTKI 3CXCY 5A2Qf 3VMHA 1AA6A 1TWCI 1X3WA 1TWAI 4A3EI 1VQLZ 2R7ZI 3CCQ1 4E2YA 2NVXI 2VUMI 3K7AI 3OW2Z 5IP7I 2QEXZ 3H0GI 2R92I 2NVYI 2OZKA 3CCR1 2OTJ1 3VB9A 3CD6Z 4Y52I 1VQL1 4MD9A 3GKQA 3J7A4 2QEX1 3MZKB 1RNIA 3KIFA 3LUSA 5IP9I 1I3QI 4A3FI 1RO2A 1Z03A 3CD61 2JIOA 4MD8A 5T67A 1Q821 1TWGI 4A3BI 3HOVI 1N8R2 4DK1A 3J81f 3IX0A 1WZNA 2E9HA 3CQZI 4NFRA 1I50I 3NDIA 1QF8A 4MD7A 2P3YA 4HGZA 2E2HI 3FKII 2AKLA 4BXXI 4BBSI 1TWFI 1YUKA 2KPIA 2RPRA 3HKZA 2K5RA 3M4OI 1K731 3GTMS 3NH4A 2JA8I 4BBRI 3CC71 3S1MI 2JS4A 4NB8A 3CCU1 3HOWI 3HOUI 3S17I 5C4XI 1ZB8A 4E2XA 3GTQI 2VUGA 5T64A 2QA4Z 1K8A2 2GU2A 1Z01A 1KD12 4MH4A 3CCJZ 2JUBA 2NAPA 4NBDA 5FLXf 5A2Qb 1I6HI 2JIQA 4BY7I 3CPWZ 4S1TA 2QA41 1QVGZ 5CM2M 3M3YI 3PO2I 4NOZA 1Y1VS 2JMOA 2LIYA 3CCJ1 1NJI2 3S1QI 1Q16A 1W2BY 3CXCZ 4HGYA 4RVDA 3D2LA 1P9NA 2M6NA 4EWCA 1KC81 3TE5B 1M902 2JA5I 1K9M2 1USPB 3JAMf 1LQLA 1N2FA 1WW9A 3GCFA 3GTLI 2R6MA 1VQ6Z 2QRCB 1VQNZ 2QKDA 3MONA 2G2KA 3IFUA 3J81b 1TWHI 4TNUA 1WJ2A 2E7ZA 1VLAA 3BG0B 2VPXA 3VTNA 2NVTI 2IZ3A 2YU9I 4A3DI 2JA7I 1VQ61 1VQN1 3G71Z 3F3FC 2EGTA 2WAQA 2IZ4A 1YI2Z 2GTIA 3I07A 1X3ZA 5C3EI 3HOZI 4RVFA 3NH5A 1ZH1A 3T4NB 3G711 4HH4A 3I56Z 2DE5A 5T6BA 4AYBA 3ESWA 1YI21 1QVFZ 3S15I 2QREB 3J80f 1S7MA 3CMAZ 2RT9A 1WIIA 1YJ9Z 1JJ2Z 2V3VA 1TFIA 2OOYB 4E31A 3I561 2RHBA 4MONA 3S1NI 2K3RA 2JR6A 3EERA 4RS4A 3OW2Y 3S2DI 2AYDA 5FLXb 1YJ91 1VQ7Z 3CMA1 1N8R1 1Q7Y2 3H3VJ 1ML8A 2HU9A 2B63I 2VF1A 3CC4Z 4NB9A 4E32A 1VQ71 1X0TA 4Y7NI 3D9XA 4XX2A 2Y0SA 4CL1A 3CC41 4A3LI 2ZAEB 2I3CA 3GTOI 3PO3I 3TDHB 1Q812 3GTPI 3JAMb 3HOXI 2V8IA 2O4HA 2O53A 3GTJI 2RBLA 1K8A1 1Y1WI 4RVGA 3VMGA 3FQQA 1FDIA 1KQSY 3GTGI 2LEXA 1KD11 2F4OA 3IF8A 3CCVZ 2QLVB 4QTTA 2HF1A 2V45A 3S16I 4NBEA 2PMZA 5C44I 1VQPZ 1NJI1 1JWHC 4NBAA 3CC2Z 4DQYB 1KRLA 1M1K2 2E2JI 2OTLZ 1Q862 3CCV1 4E33A 5IT9f 4QTUA 4X6AI 2YADA 1S72Z 2IV2X 5D1PA 4NBHA 1VQP1 1RO0A 3Q87A 3CC21 3P5JB 3CCSZ 4NH1C 2OTL1 2JIRA 3NH8A 1M901 1VQ4Z 4RVHA 3I4NI 2R93I 1K9M1 1S721 1SIWA 4MXUA 4A3GI 1USPA 1YJWZ 3CCS1 5LL6f 1R9TI
chains in the Genus database with same CATH topology
2Q4ZA 2QR1B 3G4SZ 1VQ41 1K83I 4NBBA 3CCRZ 2OTJZ 1YJW1 1Y1VI 1QYPA 3MZLB 3I55Z 3CCMZ 2JNYA 3G4S1 3S1RI 2PM9A 2NVQI 1RLYA 4E2WA 3HOYI 4A3JI 4NBCA 3I551 3CCM1 1Q822 1YHQZ 2H85A 1NUIA 3PO3S 3RZDI 3BG1B 1YHQ1 1WCMI 4E2ZA 4A3KI 2WB1A 2V8KA 3G6EZ 1Q7Y1 2OOXB 1YITZ 1K732 5FLMI 2P28A 3F3PC 3CC7Z 5AN9F 1QVFY 4DGLA 2GTHA 2M48A 3CCUZ 1VQOZ 1KQSZ 2F4MA 5C4JI 3G6E1 3EEDA 1JJ2Y 1L1OC 4NBGA 5IT9b 2KI7B 4A3II 1YIT1 2JA6I 4A3MI 1W2BZ 1PFTA 1VQKZ 2DE7A 1YJNZ 1VQO1 3NFZA 1VQ9Z 2V8JA 2LFUA 1Q811 3RZOI 1VQ8Z 1YUAA 1NP6A 3FQMA 3CCEZ 2PK7A 1VQK1 2QRDB 1YJN1 1Z02A 2W04A 1RO4A 1VQ91 4NBFA 1VQ81 3CMEZ 3CCE1 2W03A 3S14I 1SFOI 2E2II 3S2HI 1DL6A 3GTMI 4MRIA 3U50C 2BJOA 1YIJZ 5D1OB 3CME1 1RQFA 1VQ5Z 3D6WA 3J80b 3CCLZ 1KC82 3KIHA 1M1K1 1Q861 3QWUA 1VQMZ 4A93I 3CPWY 3VMIA 1ZB9A 2J6AA 1YIJ1 4A3CI 1QVGY 1VQ51 3I4MI 2DE6A 3CCL1 4RV9A 5D1OA 3CCQZ 3NDJA 1VQM1 2RIQA 4E30A 4BY1I 2Q51A 3GTKI 3CXCY 5A2Qf 3VMHA 1TWCI 1X3WA 1TWAI 4A3EI 1VQLZ 2R7ZI 3CCQ1 4E2YA 2NVXI 2VUMI 3K7AI 3OW2Z 5IP7I 2QEXZ 3H0GI 2R92I 2NVYI 2OZKA 3CCR1 2OTJ1 3VB9A 3CD6Z 4Y52I 1VQL1 4MD9A 3GKQA 3J7A4 2QEX1 3MZKB 1RNIA 3KIFA 3LUSA 5IP9I 1I3QI 4A3FI 1RO2A 1Z03A 3CD61 4MD8A 5T67A 1Q821 1TWGI 4A3BI 3HOVI 1N8R2 4DK1A 3J81f 3IX0A 2E9HA 3CQZI 4NFRA 1I50I 3NDIA 1QF8A 4MD7A 2P3YA 4HGZA 2E2HI 3FKII 2AKLA 4BXXI 4BBSI 1TWFI 1YUKA 2KPIA 2RPRA 3HKZA 2K5RA 3M4OI 1K731 3GTMS 3NH4A 2JA8I 4BBRI 3CC71 3S1MI 2JS4A 4NB8A 3CCU1 3HOWI 3HOUI 3S17I 5C4XI 1ZB8A 4E2XA 3GTQI 2VUGA 5T64A 2QA4Z 1K8A2 2GU2A 1Z01A 1KD12 4MH4A 3CCJZ 2JUBA 4NBDA 5FLXf 5A2Qb 1I6HI 4BY7I 3CPWZ 4S1TA 2QA41 1QVGZ 5CM2M 3M3YI 3PO2I 4NOZA 1Y1VS 2JMOA 2LIYA 3CCJ1 1NJI2 3S1QI 1W2BY 3CXCZ 4HGYA 4RVDA 1P9NA 2M6NA 4EWCA 1KC81 3TE5B 1M902 2JA5I 1K9M2 1USPB 3JAMf 1LQLA 1N2FA 1WW9A 3GCFA 3GTLI 2R6MA 1VQ6Z 2QRCB 1VQNZ 2QKDA 3MONA 2G2KA 3IFUA 3J81b 1TWHI 4TNUA 1VLAA 3BG0B 3VTNA 2NVTI 2IZ3A 2YU9I 4A3DI 2JA7I 1VQ61 1VQN1 3G71Z 3F3FC 2EGTA 2WAQA 2IZ4A 1YI2Z 2GTIA 3I07A 1X3ZA 5C3EI 3HOZI 4RVFA 3NH5A 1ZH1A 3T4NB 3G711 4HH4A 3I56Z 2DE5A 5T6BA 4AYBA 3ESWA 1YI21 1QVFZ 3S15I 2QREB 3J80f 1S7MA 3CMAZ 2RT9A 1WIIA 1YJ9Z 1JJ2Z 1TFIA 2OOYB 4E31A 3I561 2RHBA 4MONA 3S1NI 2K3RA 2JR6A 3EERA 4RS4A 3OW2Y 3S2DI 5FLXb 1YJ91 1VQ7Z 3CMA1 1N8R1 1Q7Y2 3H3VJ 1ML8A 2HU9A 2B63I 2VF1A 3CC4Z 4NB9A 4E32A 1VQ71 1X0TA 4Y7NI 3D9XA 4XX2A 2Y0SA 4CL1A 3CC41 4A3LI 2ZAEB 2I3CA 3GTOI 3PO3I 3TDHB 1Q812 3GTPI 3JAMb 3HOXI 2V8IA 2O4HA 2O53A 3GTJI 2RBLA 1K8A1 1Y1WI 4RVGA 3VMGA 3FQQA 1KQSY 3GTGI 1KD11 2F4OA 3IF8A 3CCVZ 2QLVB 4QTTA 2HF1A 3S16I 4NBEA 2PMZA 5C44I 1VQPZ 1NJI1 1JWHC 4NBAA 3CC2Z 4DQYB 1KRLA 1M1K2 2E2JI 2OTLZ 1Q862 3CCV1 4E33A 5IT9f 4QTUA 4X6AI 2YADA 1S72Z 5D1PA 4NBHA 1VQP1 1RO0A 3Q87A 3CC21 3P5JB 3CCSZ 4NH1C 2OTL1 3NH8A 1M901 1VQ4Z 4RVHA 3I4NI 2R93I 1K9M1 1S721 4MXUA 4A3GI 1USPA 1YJWZ 3CCS1 5LL6f 1R9TI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 1;  1VQ4 1;  3G4S Z;  1YIJ Z;  3CME 1;  3OW2 Y;  3CCR Z;  1VQ5 Z;  2OTJ Z;  3CCL Z;  1YJW 1;  1KC8 2;  1YJ9 1;  1VQ7 Z;  3CMA 1;  1M1K 1;  2QA4 Z;  1Q7Y 2;  1N8R 1;  1Q86 1;  1K8A 2;  3I55 Z;  3CCM Z;  1VQM Z;  3G4S 1;  3CPW Y;  1KD1 2;  1YIJ 1;  3CC4 Z;  3CCJ Z;  1QVG Y;  1VQ5 1;  3CCL 1;  3CPW Z;  1VQ7 1;  2QA4 1;  3CCQ Z;  3I55 1;  3CCM 1;  1Q82 2;  1QVG Z;  1VQM 1;  1YHQ Z;  3CC4 1;  3CCJ 1;  3CXC Y;  1NJI 2;  1VQL Z;  1W2B Y;  3CCQ 1;  3CXC Z;  1Q81 2;  1YHQ 1;  3OW2 Z;  2QEX Z;  3CCR 1;  2OTJ 1;  3CD6 Z;  1KC8 1;  1VQL 1;  3G6E Z;  1Q7Y 1;  1M90 2;  1K8A 1;  1K9M 2;  1KQS Y;  2QEX 1;  1YIT Z;  1K73 2;  1KD1 1;  3CC7 Z;  1QVF Y;  1VQ6 Z;  1VQN Z;  3CCU Z;  1KQS Z;  1VQO Z;  3CD6 1;  3CCV Z;  3G6E 1;  1JJ2 Y;  1Q82 1;  1YIT 1;  1W2B Z;  1VQP Z;  1NJI 1;  1VQK Z;  1VQ6 1;  3CC2 Z;  1M1K 2;  1VQN 1;  1YJN Z;  2OTL Z;  1VQO 1;  1N8R 2;  1Q86 2;  3G71 Z;  1VQ9 Z;  3CCV 1;  1Q81 1;  1VQ8 Z;  1YI2 Z;  1S72 Z;  3CCE Z;  1VQP 1;  1VQK 1;  3CC2 1;  3CCS Z;  1YJN 1;  2OTL 1;  3G71 1;  1VQ9 1;  3I56 Z;  1M90 1;  1VQ4 Z;  1K9M 1;  1YI2 1;  1VQ8 1;  1QVF Z;  1S72 1;  1K73 1;  3CME Z;  3CCE 1;  3CC7 1;  1YJW Z;  3CMA Z;  1YJ9 Z;  3CCS 1;  1JJ2 Z;  3CCU 1; 
#chains in the Genus database with same CATH topology
 2VPZ A;  2Q4Z A;  2QR1 B;  3G4S Z;  1VQ4 1;  1K83 I;  4NBB A;  3CCR Z;  2OTJ Z;  3IR7 A;  2VPW A;  1YJW 1;  1Y1V I;  1QYP A;  3MZL B;  3I55 Z;  3CCM Z;  2JNY A;  3G4S 1;  3S1R I;  2PM9 A;  2NVQ I;  1Y8C A;  1RLY A;  4E2W A;  3HOY I;  4A3J I;  4NBC A;  3I55 1;  3CCM 1;  1Q82 2;  1YHQ Z;  2H85 A;  1NUI A;  3PO3 S;  3RZD I;  3BG1 B;  1YHQ 1;  1WCM I;  4E2Z A;  4A3K I;  2WB1 A;  2V8K A;  3G6E Z;  1Q7Y 1;  2JIP A;  1QXF A;  2OOX B;  1YIT Z;  1K73 2;  5FLM I;  2P28 A;  3F3P C;  3CC7 Z;  5AN9 F;  2JIM A;  1QVF Y;  4DGL A;  2GTH A;  2M48 A;  3CCU Z;  1VQO Z;  1KQS Z;  2F4M A;  5C4J I;  3G6E 1;  3EED A;  1JJ2 Y;  1L1O C;  4NBG A;  5IT9 b;  2KI7 B;  4A3I I;  1YIT 1;  2JA6 I;  4A3M I;  1W2B Z;  1FDO A;  1PFT A;  1VQK Z;  2DE7 A;  1YJN Z;  1VQO 1;  3NFZ A;  1VQ9 Z;  2V8J A;  2LFU A;  1Q81 1;  3RZO I;  1VQ8 Z;  1YUA A;  1NP6 A;  3FQM A;  3CCE Z;  2PK7 A;  1VQK 1;  2QRD B;  1YJN 1;  1Z02 A;  2W04 A;  1RO4 A;  1VQ9 1;  4NBF A;  1VQ8 1;  3CME Z;  3CCE 1;  2W03 A;  3S14 I;  1SFO I;  2E2I I;  3S2H I;  1DL6 A;  3GTM I;  4MRI A;  2VPY A;  3U50 C;  2BJO A;  1YIJ Z;  5D1O B;  3CME 1;  1RQF A;  1VQ5 Z;  3D6W A;  3J80 b;  3CCL Z;  1KC8 2;  3KIH A;  1M1K 1;  1Q86 1;  3QWU A;  1VQM Z;  4A93 I;  3CPW Y;  3VMI A;  1ZB9 A;  2J6A A;  1YIJ 1;  4A3C I;  1QVG Y;  1VQ5 1;  3I4M I;  2DE6 A;  3CCL 1;  4RV9 A;  5D1O A;  3CCQ Z;  3NDJ A;  1VQM 1;  2RIQ A;  4E30 A;  4BY1 I;  2Q51 A;  3GTK I;  3CXC Y;  5A2Q f;  3VMH A;  1AA6 A;  1TWC I;  1X3W A;  1TWA I;  4A3E I;  1VQL Z;  2R7Z I;  3CCQ 1;  4E2Y A;  2NVX I;  2VUM I;  3K7A I;  3OW2 Z;  5IP7 I;  2QEX Z;  3H0G I;  2R92 I;  2NVY I;  2OZK A;  3CCR 1;  2OTJ 1;  3VB9 A;  3CD6 Z;  4Y52 I;  1VQL 1;  4MD9 A;  3GKQ A;  3J7A 4;  2QEX 1;  3MZK B;  1RNI A;  3KIF A;  3LUS A;  5IP9 I;  1I3Q I;  4A3F I;  1RO2 A;  1Z03 A;  3CD6 1;  2JIO A;  4MD8 A;  5T67 A;  1Q82 1;  1TWG I;  4A3B I;  3HOV I;  1N8R 2;  4DK1 A;  3J81 f;  3IX0 A;  1WZN A;  2E9H A;  3CQZ I;  4NFR A;  1I50 I;  3NDI A;  1QF8 A;  4MD7 A;  2P3Y A;  4HGZ A;  2E2H I;  3FKI I;  2AKL A;  4BXX I;  4BBS I;  1TWF I;  1YUK A;  2KPI A;  2RPR A;  3HKZ A;  2K5R A;  3M4O I;  1K73 1;  3GTM S;  3NH4 A;  2JA8 I;  4BBR I;  3CC7 1;  3S1M I;  2JS4 A;  4NB8 A;  3CCU 1;  3HOW I;  3HOU I;  3S17 I;  5C4X I;  1ZB8 A;  4E2X A;  3GTQ I;  2VUG A;  5T64 A;  2QA4 Z;  1K8A 2;  2GU2 A;  1Z01 A;  1KD1 2;  4MH4 A;  3CCJ Z;  2JUB A;  2NAP A;  4NBD A;  5FLX f;  5A2Q b;  1I6H I;  2JIQ A;  4BY7 I;  3CPW Z;  4S1T A;  2QA4 1;  1QVG Z;  5CM2 M;  3M3Y I;  3PO2 I;  4NOZ A;  1Y1V S;  2JMO A;  2LIY A;  3CCJ 1;  1NJI 2;  3S1Q I;  1Q16 A;  1W2B Y;  3CXC Z;  4HGY A;  4RVD A;  3D2L A;  1P9N A;  2M6N A;  4EWC A;  1KC8 1;  3TE5 B;  1M90 2;  2JA5 I;  1K9M 2;  1USP B;  3JAM f;  1LQL A;  1N2F A;  1WW9 A;  3GCF A;  3GTL I;  2R6M A;  1VQ6 Z;  2QRC B;  1VQN Z;  2QKD A;  3MON A;  2G2K A;  3IFU A;  3J81 b;  1TWH I;  4TNU A;  1WJ2 A;  2E7Z A;  1VLA A;  3BG0 B;  2VPX A;  3VTN A;  2NVT I;  2IZ3 A;  2YU9 I;  4A3D I;  2JA7 I;  1VQ6 1;  1VQN 1;  3G71 Z;  3F3F C;  2EGT A;  2WAQ A;  2IZ4 A;  1YI2 Z;  2GTI A;  3I07 A;  1X3Z A;  5C3E I;  3HOZ I;  4RVF A;  3NH5 A;  1ZH1 A;  3T4N B;  3G71 1;  4HH4 A;  3I56 Z;  2DE5 A;  5T6B A;  4AYB A;  3ESW A;  1YI2 1;  1QVF Z;  3S15 I;  2QRE B;  3J80 f;  1S7M A;  3CMA Z;  2RT9 A;  1WII A;  1YJ9 Z;  1JJ2 Z;  2V3V A;  1TFI A;  2OOY B;  4E31 A;  3I56 1;  2RHB A;  4MON A;  3S1N I;  2K3R A;  2JR6 A;  3EER A;  4RS4 A;  3OW2 Y;  3S2D I;  2AYD A;  5FLX b;  1YJ9 1;  1VQ7 Z;  3CMA 1;  1N8R 1;  1Q7Y 2;  3H3V J;  1ML8 A;  2HU9 A;  2B63 I;  2VF1 A;  3CC4 Z;  4NB9 A;  4E32 A;  1VQ7 1;  1X0T A;  4Y7N I;  3D9X A;  4XX2 A;  2Y0S A;  4CL1 A;  3CC4 1;  4A3L I;  2ZAE B;  2I3C A;  3GTO I;  3PO3 I;  3TDH B;  1Q81 2;  3GTP I;  3JAM b;  3HOX I;  2V8I A;  2O4H A;  2O53 A;  3GTJ I;  2RBL A;  1K8A 1;  1Y1W I;  4RVG A;  3VMG A;  3FQQ A;  1FDI A;  1KQS Y;  3GTG I;  2LEX A;  1KD1 1;  2F4O A;  3IF8 A;  3CCV Z;  2QLV B;  4QTT A;  2HF1 A;  2V45 A;  3S16 I;  4NBE A;  2PMZ A;  5C44 I;  1VQP Z;  1NJI 1;  1JWH C;  4NBA A;  3CC2 Z;  4DQY B;  1KRL A;  1M1K 2;  2E2J I;  2OTL Z;  1Q86 2;  3CCV 1;  4E33 A;  5IT9 f;  4QTU A;  4X6A I;  2YAD A;  1S72 Z;  2IV2 X;  5D1P A;  4NBH A;  1VQP 1;  1RO0 A;  3Q87 A;  3CC2 1;  3P5J B;  3CCS Z;  4NH1 C;  2OTL 1;  2JIR A;  3NH8 A;  1M90 1;  1VQ4 Z;  4RVH A;  3I4N I;  2R93 I;  1K9M 1;  1S72 1;  1SIW A;  4MXU A;  4A3G I;  1USP A;  1YJW Z;  3CCS 1;  5LL6 f;  1R9T I; 
#chains in the Genus database with same CATH homology
 2Q4Z A;  2QR1 B;  3G4S Z;  1VQ4 1;  1K83 I;  4NBB A;  3CCR Z;  2OTJ Z;  1YJW 1;  1Y1V I;  1QYP A;  3MZL B;  3I55 Z;  3CCM Z;  2JNY A;  3G4S 1;  3S1R I;  2PM9 A;  2NVQ I;  1RLY A;  4E2W A;  3HOY I;  4A3J I;  4NBC A;  3I55 1;  3CCM 1;  1Q82 2;  1YHQ Z;  2H85 A;  1NUI A;  3PO3 S;  3RZD I;  3BG1 B;  1YHQ 1;  1WCM I;  4E2Z A;  4A3K I;  2WB1 A;  2V8K A;  3G6E Z;  1Q7Y 1;  2OOX B;  1YIT Z;  1K73 2;  5FLM I;  2P28 A;  3F3P C;  3CC7 Z;  5AN9 F;  1QVF Y;  4DGL A;  2GTH A;  2M48 A;  3CCU Z;  1VQO Z;  1KQS Z;  2F4M A;  5C4J I;  3G6E 1;  3EED A;  1JJ2 Y;  1L1O C;  4NBG A;  5IT9 b;  2KI7 B;  4A3I I;  1YIT 1;  2JA6 I;  4A3M I;  1W2B Z;  1PFT A;  1VQK Z;  2DE7 A;  1YJN Z;  1VQO 1;  3NFZ A;  1VQ9 Z;  2V8J A;  2LFU A;  1Q81 1;  3RZO I;  1VQ8 Z;  1YUA A;  1NP6 A;  3FQM A;  3CCE Z;  2PK7 A;  1VQK 1;  2QRD B;  1YJN 1;  1Z02 A;  2W04 A;  1RO4 A;  1VQ9 1;  4NBF A;  1VQ8 1;  3CME Z;  3CCE 1;  2W03 A;  3S14 I;  1SFO I;  2E2I I;  3S2H I;  1DL6 A;  3GTM I;  4MRI A;  3U50 C;  2BJO A;  1YIJ Z;  5D1O B;  3CME 1;  1RQF A;  1VQ5 Z;  3D6W A;  3J80 b;  3CCL Z;  1KC8 2;  3KIH A;  1M1K 1;  1Q86 1;  3QWU A;  1VQM Z;  4A93 I;  3CPW Y;  3VMI A;  1ZB9 A;  2J6A A;  1YIJ 1;  4A3C I;  1QVG Y;  1VQ5 1;  3I4M I;  2DE6 A;  3CCL 1;  4RV9 A;  5D1O A;  3CCQ Z;  3NDJ A;  1VQM 1;  2RIQ A;  4E30 A;  4BY1 I;  2Q51 A;  3GTK I;  3CXC Y;  5A2Q f;  3VMH A;  1TWC I;  1X3W A;  1TWA I;  4A3E I;  1VQL Z;  2R7Z I;  3CCQ 1;  4E2Y A;  2NVX I;  2VUM I;  3K7A I;  3OW2 Z;  5IP7 I;  2QEX Z;  3H0G I;  2R92 I;  2NVY I;  2OZK A;  3CCR 1;  2OTJ 1;  3VB9 A;  3CD6 Z;  4Y52 I;  1VQL 1;  4MD9 A;  3GKQ A;  3J7A 4;  2QEX 1;  3MZK B;  1RNI A;  3KIF A;  3LUS A;  5IP9 I;  1I3Q I;  4A3F I;  1RO2 A;  1Z03 A;  3CD6 1;  4MD8 A;  5T67 A;  1Q82 1;  1TWG I;  4A3B I;  3HOV I;  1N8R 2;  4DK1 A;  3J81 f;  3IX0 A;  2E9H A;  3CQZ I;  4NFR A;  1I50 I;  3NDI A;  1QF8 A;  4MD7 A;  2P3Y A;  4HGZ A;  2E2H I;  3FKI I;  2AKL A;  4BXX I;  4BBS I;  1TWF I;  1YUK A;  2KPI A;  2RPR A;  3HKZ A;  2K5R A;  3M4O I;  1K73 1;  3GTM S;  3NH4 A;  2JA8 I;  4BBR I;  3CC7 1;  3S1M I;  2JS4 A;  4NB8 A;  3CCU 1;  3HOW I;  3HOU I;  3S17 I;  5C4X I;  1ZB8 A;  4E2X A;  3GTQ I;  2VUG A;  5T64 A;  2QA4 Z;  1K8A 2;  2GU2 A;  1Z01 A;  1KD1 2;  4MH4 A;  3CCJ Z;  2JUB A;  4NBD A;  5FLX f;  5A2Q b;  1I6H I;  4BY7 I;  3CPW Z;  4S1T A;  2QA4 1;  1QVG Z;  5CM2 M;  3M3Y I;  3PO2 I;  4NOZ A;  1Y1V S;  2JMO A;  2LIY A;  3CCJ 1;  1NJI 2;  3S1Q I;  1W2B Y;  3CXC Z;  4HGY A;  4RVD A;  1P9N A;  2M6N A;  4EWC A;  1KC8 1;  3TE5 B;  1M90 2;  2JA5 I;  1K9M 2;  1USP B;  3JAM f;  1LQL A;  1N2F A;  1WW9 A;  3GCF A;  3GTL I;  2R6M A;  1VQ6 Z;  2QRC B;  1VQN Z;  2QKD A;  3MON A;  2G2K A;  3IFU A;  3J81 b;  1TWH I;  4TNU A;  1VLA A;  3BG0 B;  3VTN A;  2NVT I;  2IZ3 A;  2YU9 I;  4A3D I;  2JA7 I;  1VQ6 1;  1VQN 1;  3G71 Z;  3F3F C;  2EGT A;  2WAQ A;  2IZ4 A;  1YI2 Z;  2GTI A;  3I07 A;  1X3Z A;  5C3E I;  3HOZ I;  4RVF A;  3NH5 A;  1ZH1 A;  3T4N B;  3G71 1;  4HH4 A;  3I56 Z;  2DE5 A;  5T6B A;  4AYB A;  3ESW A;  1YI2 1;  1QVF Z;  3S15 I;  2QRE B;  3J80 f;  1S7M A;  3CMA Z;  2RT9 A;  1WII A;  1YJ9 Z;  1JJ2 Z;  1TFI A;  2OOY B;  4E31 A;  3I56 1;  2RHB A;  4MON A;  3S1N I;  2K3R A;  2JR6 A;  3EER A;  4RS4 A;  3OW2 Y;  3S2D I;  5FLX b;  1YJ9 1;  1VQ7 Z;  3CMA 1;  1N8R 1;  1Q7Y 2;  3H3V J;  1ML8 A;  2HU9 A;  2B63 I;  2VF1 A;  3CC4 Z;  4NB9 A;  4E32 A;  1VQ7 1;  1X0T A;  4Y7N I;  3D9X A;  4XX2 A;  2Y0S A;  4CL1 A;  3CC4 1;  4A3L I;  2ZAE B;  2I3C A;  3GTO I;  3PO3 I;  3TDH B;  1Q81 2;  3GTP I;  3JAM b;  3HOX I;  2V8I A;  2O4H A;  2O53 A;  3GTJ I;  2RBL A;  1K8A 1;  1Y1W I;  4RVG A;  3VMG A;  3FQQ A;  1KQS Y;  3GTG I;  1KD1 1;  2F4O A;  3IF8 A;  3CCV Z;  2QLV B;  4QTT A;  2HF1 A;  3S16 I;  4NBE A;  2PMZ A;  5C44 I;  1VQP Z;  1NJI 1;  1JWH C;  4NBA A;  3CC2 Z;  4DQY B;  1KRL A;  1M1K 2;  2E2J I;  2OTL Z;  1Q86 2;  3CCV 1;  4E33 A;  5IT9 f;  4QTU A;  4X6A I;  2YAD A;  1S72 Z;  5D1P A;  4NBH A;  1VQP 1;  1RO0 A;  3Q87 A;  3CC2 1;  3P5J B;  3CCS Z;  4NH1 C;  2OTL 1;  3NH8 A;  1M90 1;  1VQ4 Z;  4RVH A;  3I4N I;  2R93 I;  1K9M 1;  1S72 1;  4MXU A;  4A3G I;  1USP A;  1YJW Z;  3CCS 1;  5LL6 f;  1R9T I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...