3CCE1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cce100
1YITZ 1QVFY 3CC4Z 3CMA1 1YIJ1 1YHQ1 3CC71 1VQPZ 3CCE1 3OW2Y 1Q822 3CCUZ 1Q862 1K731 1VQ5Z 1JJ2Y 1VQMZ 3CCEZ 1QVGY 3CME1 2OTJZ 1YIT1 1VQLZ 3G6EZ 3OW2Z 3CC41 1KQSY 1VQ7Z 1K9M1 1VQ81 1S72Z 3CMEZ 1YJ9Z 1K732 3G4SZ 1M901 3CCU1 1JJ2Z 1N8R1 1QVGZ 3CCJZ 1VQ51 1YJNZ 1VQM1 1KQSZ 1VQ8Z 3CXCY 3CCSZ 2OTJ1 3CCVZ 1K9M2 3I56Z 3G6E1 1VQL1 1VQ71 1VQN1 3CD6Z 1Q811 1M902 2OTL1 1N8R2 3CCMZ 1S721 1YJ91 3G4S1 1VQ4Z 1NJI1 3CXCZ 3CCJ1 1VQNZ 1VQ6Z 3CCL1 1YJN1 2OTLZ 1Q7Y1 3CCS1 3G711 1YJWZ 2QA4Z 1YI2Z 3CCV1 1Q812 3I561 3CD61 3CCLZ 1NJI2 3CCM1 3G71Z 1VQ41 3CPWZ 2QEX1 3I55Z 1Q7Y2 1VQ61 1W2BY 1M1K1 1YJW1 1K8A1 2QA41 1VQOZ 1YI21 3CC2Z 1VQKZ 2QEXZ 1VQ9Z 3CCQZ 3CPWY 1KC81 3CCR1 1KD11 1W2BZ 3I551 1M1K2 1K8A2 1QVFZ 3CMAZ 1YIJZ 3CCRZ 1YHQZ 1VQO1 3CC7Z 3CC21 1VQK1 1KC82 1VQ91 3CCQ1 1Q821 1Q861 1KD12 1VQP1
chains in the Genus database with same CATH superfamily
2JUBA 5T67A 1QVFY 3J7A4 5C44I 1YIJ1 2V8JA 2LIYA 1VQPZ 3CCE1 4RVHA 3CCUZ 5LL6f 4E31A 3HOXI 3S15I 3I07A 2V8KA 3Q87A 4MXUA 2PMZA 2H85A 3GCFA 3IX0A 2OTJZ 2R92I 4E30A 3G6EZ 1JWHC 2GU2A 3CMEZ 1K732 1QVGZ 4NH1C 3CCJZ 3GTPI 4AYBA 1YJNZ 1KQSZ 3BG1B 2B63I 1SIWA 3CCVZ 5IT9f 1VQ71 2OTL1 2RBLA 4A3LI 2AKLA 3F3FC 1VQ6Z 3JAMf 3CCS1 4BXXI 1YJWZ 3HOUI 3I561 5D1PA 1ML8A 3KIHA 3CD61 5A2Qf 2JIPA 1Z03A 3CCM1 4HGYA 3G71Z 3CPWZ 3NH4A 4E33A 1YUKA 1Z01A 4RVDA 3HOZI 1Q7Y2 4MH4A 3GTLI 1K8A1 3CC2Z 5FLXf 1RO2A 1Z02A 4EWCA 1NP6A 1VLAA 2YU9I 4NBGA 3GTQI 1KD11 3IF8A 3GKQA 2YADA 3U50C 2JIMA 1YIJZ 3CCRZ 1VQO1 3FKII 2G2KA 2JIOA 1USPA 2R6MA 4MD7A 2E2HI 3CCQ1 1RO4A 2IZ3A 1Q861 3M3YI 4Y52I 1I50I 2KPIA 5IP7I 1QF8A 4DGLA 3HOYI 3GTKI 2PM9A 3VMIA 3CMA1 1FDOA 1RLYA 1YHQ1 4BY1I 3GTOI 1Q822 2O4HA 4NBFA 2RT9A 2R7ZI 4E32A 3S17I 4A3CI 2M6NA 4MRIA 1Y8CA 1QVGY 1TWGI 2M48A 1YIT1 2F4MA 3OW2Z 1X3ZA 1KQSY 3CC41 2VPYA 4BBSI 1VQ7Z 1K9M1 2JR6A 2QRCB 3TDHB 1QXFA 2V8IA 2DE7A 1M901 2JMOA 1JJ2Z 1N8R1 2E7ZA 1LQLA 1VQ51 1TWAI 2VPZA 4NB8A 2V45A 2F4OA 2QREB 1VQ8Z 3CCSZ 3TE5B 3I56Z 1VQL1 1Q16A 4RV9A 1VQN1 3CD6Z 1Q811 3S1RI 2DE6A 3S16I 1WJ2A 3CCMZ 1S721 1YJ91 3H3VJ 3G4S1 2JA7I 1NJI1 1TWHI 3CXCZ 5C3EI 4A3JI 2WB1A 2LFUA 2GTIA 4HH4A 3I4MI 4RS4A 3D2LA 3J80f 3D6WA 4XX2A 4A3GI 4DQYB 3CCLZ 1Y1WI 1ZH1A 4DK1A 1VQ41 2P28A 4HGZA 3HOWI 5FLMI 3RZOI 2RHBA 3NDIA 2QA41 1RQFA 2OOXB 1X0TA 1VQOZ 2QEXZ 2LEXA 4A3II 2IV2X 2JS4A 3CCQZ 3MZLB 3MONA 2O53A 2V3VA 1W2BZ 1P9NA 4A3EI 2K3RA 3FQQA 1M1K2 4NBAA 2BJOA 1QVFZ 3CMAZ 3S1MI 1YHQZ 3LUSA 1NUIA 3P5JB 4A3MI 1KC82 1VQ91 2AYDA 3GTGI 1RO0A 2RIQA 1X3WA 3S2HI 4A3BI 1ZB8A 1VQP1 2OOYB 1YITZ 3CC4Z 2HF1A 3HKZA 1AA6A 3VMHA 3CC71 3OW2Y 4A3KI 1K731 3D9XA 1VQ5Z 3BG0B 1JJ2Y 3CCEZ 1ZB9A 1TFIA 3CME1 4NBDA 3T4NB 1PFTA 1VQLZ 5C4XI 2GTHA 2E2JI 1S72Z 1YJ9Z 4QTUA 5C4JI 3G4SZ 5CM2M 3S1NI 1TWFI 1FDIA 2JA8I 5IP9I 1VQM1 3VMGA 4TNUA 3CXCY 4BBRI 3J81b 5IT9b 3GTJI 5D1OB 1VQ4Z 1N2FA 1WIIA 1WZNA 3IR7A 4MD9A 3S2DI 2OTLZ 1Q7Y1 2WAQA 2Y0SA 3ESWA 3G711 2QA4Z 4A93I 2NVQI 4A3FI 2NVXI 4A3DI 2PK7A 2KI7B 3QWUA 2QR1B 1W2BY 1RNIA 2JA6I 1R9TI 1DL6A 2JIQA 2NAPA 1YI21 3CQZI 2P3YA 1VQ9Z 2Q51A 2VUGA 3CPWY 1TWCI 5AN9F 3PO2I 2Q4ZA 2HU9A 3CCR1 3RZDI 2VUMI 3I551 2JNYA 1K8A2 4E2ZA 3VTNA 3M4OI 4X6AI 3S1QI 3CC7Z 1VQK1 1QYPA 5T6BA 4BY7I 3H0GI 1Q821 3I4NI 1KD12 4RVFA 1WW9A 2E9HA 4S1TA 3S14I 2QKDA 4NBBA 4E2XA 1Q862 2NVYI 3J81f 2JIRA 2EGTA 3F3PC 4MONA 1VQMZ 3KIFA 2R93I 4NBEA 3PO3I 2NVTI 4MD8A 4QTTA 3GTMI 3FQMA 3PO3S 1VQ81 2W03A 3CCU1 3GTMS 3VB9A 1YUAA 1USPB 2RPRA 2OTJ1 4RVGA 4NBCA 2I3CA 1K9M2 3G6E1 1M902 4E2WA 1N8R2 2W04A 3EERA 3NH8A 3CCJ1 1VQNZ 2OZKA 3CCL1 4NOZA 1YJN1 2E2II 4NB9A 1YI2Z 1SFOI 3J80b 4Y7NI 3CCV1 1Q812 1KRLA 1NJI2 4NFRA 1WCMI 3NH5A 2QEX1 2J6AA 3I55Z 1L1OC 1S7MA 1VQ61 2VF1A 1M1K1 1YJW1 1VQKZ 3HOVI 2QRDB 2JA5I 4NBHA 3JAMb 1I6HI 1KC81 2IZ4A 4CL1A 2K5RA 3K7AI 5A2Qb 2DE5A 4E2YA 1Y1VI 3NFZA 5T64A 3NDJA 3EEDA 1Y1VS 3CC21 3MZKB 2VPXA 1K83I 1I3QI 5FLXb 3IFUA 5D1OA 2QLVB 2VPWA 2ZAEB
chains in the Genus database with same CATH topology
2JUBA 5T67A 1QVFY 3J7A4 5C44I 1YIJ1 2V8JA 2LIYA 1VQPZ 3CCE1 4RVHA 3CCUZ 5LL6f 4E31A 3HOXI 3S15I 3I07A 2V8KA 3Q87A 4MXUA 2PMZA 2H85A 3GCFA 3IX0A 2OTJZ 2R92I 4E30A 3G6EZ 1JWHC 2GU2A 3CMEZ 1K732 1QVGZ 4NH1C 3CCJZ 3GTPI 4AYBA 1YJNZ 1KQSZ 3BG1B 2B63I 3CCVZ 5IT9f 1VQ71 2OTL1 2RBLA 4A3LI 2AKLA 3F3FC 1VQ6Z 3JAMf 3CCS1 4BXXI 1YJWZ 3HOUI 3I561 5D1PA 1ML8A 3KIHA 3CD61 5A2Qf 1Z03A 3CCM1 4HGYA 3G71Z 3CPWZ 3NH4A 4E33A 1YUKA 1Z01A 4RVDA 3HOZI 1Q7Y2 4MH4A 3GTLI 1K8A1 3CC2Z 5FLXf 1RO2A 1Z02A 4EWCA 1NP6A 1VLAA 2YU9I 4NBGA 3GTQI 1KD11 3IF8A 3GKQA 2YADA 3U50C 1YIJZ 3CCRZ 1VQO1 3FKII 2G2KA 1USPA 2R6MA 4MD7A 2E2HI 3CCQ1 1RO4A 2IZ3A 1Q861 3M3YI 4Y52I 1I50I 2KPIA 5IP7I 1QF8A 4DGLA 3HOYI 3GTKI 2PM9A 3VMIA 3CMA1 1YHQ1 1RLYA 4BY1I 3GTOI 1Q822 2O4HA 4NBFA 2RT9A 2R7ZI 4E32A 3S17I 4A3CI 2M6NA 4MRIA 1QVGY 1TWGI 2M48A 1YIT1 2F4MA 3OW2Z 1X3ZA 1KQSY 3CC41 4BBSI 1VQ7Z 1K9M1 2JR6A 2QRCB 3TDHB 2V8IA 2DE7A 1M901 2JMOA 1JJ2Z 1N8R1 1LQLA 1VQ51 1TWAI 4NB8A 2F4OA 2QREB 1VQ8Z 3CCSZ 3TE5B 3I56Z 1VQL1 4RV9A 1VQN1 3CD6Z 1Q811 3S1RI 2DE6A 3S16I 3CCMZ 1S721 1YJ91 3H3VJ 3G4S1 2JA7I 1NJI1 1TWHI 3CXCZ 5C3EI 4A3JI 2WB1A 2LFUA 2GTIA 4HH4A 3I4MI 4RS4A 3J80f 3D6WA 4XX2A 4A3GI 4DQYB 3CCLZ 1Y1WI 1ZH1A 4DK1A 1VQ41 2P28A 4HGZA 3HOWI 5FLMI 3RZOI 2RHBA 3NDIA 2QA41 1RQFA 2OOXB 1X0TA 1VQOZ 2QEXZ 4A3II 2JS4A 3CCQZ 3MZLB 3MONA 2O53A 1W2BZ 1P9NA 4A3EI 2K3RA 3FQQA 1M1K2 4NBAA 2BJOA 1QVFZ 3CMAZ 3S1MI 1YHQZ 3LUSA 1NUIA 3P5JB 4A3MI 1KC82 1VQ91 3GTGI 1RO0A 2RIQA 1X3WA 3S2HI 4A3BI 1ZB8A 1VQP1 2OOYB 1YITZ 3CC4Z 2HF1A 3HKZA 3VMHA 3CC71 3OW2Y 4A3KI 1K731 3D9XA 1VQ5Z 3BG0B 1JJ2Y 3CCEZ 1ZB9A 1TFIA 3CME1 4NBDA 3T4NB 1PFTA 1VQLZ 5C4XI 2GTHA 2E2JI 1S72Z 1YJ9Z 4QTUA 5C4JI 3G4SZ 5CM2M 3S1NI 1TWFI 2JA8I 5IP9I 1VQM1 3VMGA 4TNUA 3CXCY 4BBRI 3J81b 5IT9b 3GTJI 5D1OB 1VQ4Z 1N2FA 1WIIA 4MD9A 3S2DI 2OTLZ 1Q7Y1 2WAQA 2Y0SA 3ESWA 3G711 2QA4Z 4A93I 2NVQI 4A3FI 2NVXI 4A3DI 2PK7A 2KI7B 3QWUA 2QR1B 1W2BY 1RNIA 2JA6I 1R9TI 1DL6A 1YI21 3CQZI 2P3YA 1VQ9Z 2Q51A 2VUGA 3CPWY 1TWCI 5AN9F 3PO2I 2Q4ZA 2HU9A 3CCR1 3RZDI 2VUMI 3I551 2JNYA 1K8A2 4E2ZA 3VTNA 3M4OI 4X6AI 3S1QI 3CC7Z 1VQK1 1QYPA 5T6BA 4BY7I 3H0GI 1Q821 3I4NI 1KD12 4RVFA 1WW9A 2E9HA 4S1TA 3S14I 2QKDA 4NBBA 4E2XA 1Q862 2NVYI 3J81f 2EGTA 3F3PC 4MONA 1VQMZ 3KIFA 2R93I 4NBEA 3PO3I 2NVTI 4MD8A 4QTTA 3GTMI 3FQMA 3PO3S 1VQ81 2W03A 3CCU1 3GTMS 3VB9A 1YUAA 1USPB 2RPRA 2OTJ1 4RVGA 4NBCA 2I3CA 1K9M2 3G6E1 1M902 4E2WA 1N8R2 2W04A 3EERA 3NH8A 3CCJ1 1VQNZ 2OZKA 3CCL1 4NOZA 1YJN1 2E2II 4NB9A 1YI2Z 1SFOI 3J80b 4Y7NI 3CCV1 1Q812 1KRLA 1NJI2 4NFRA 1WCMI 3NH5A 2QEX1 2J6AA 3I55Z 1L1OC 1S7MA 1VQ61 2VF1A 1M1K1 1YJW1 1VQKZ 3HOVI 2QRDB 2JA5I 4NBHA 3JAMb 1I6HI 1KC81 2IZ4A 4CL1A 2K5RA 3K7AI 5A2Qb 2DE5A 4E2YA 1Y1VI 3NFZA 5T64A 3NDJA 3EEDA 1Y1VS 3CC21 3MZKB 1K83I 1I3QI 5FLXb 3IFUA 5D1OA 2QLVB 2ZAEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT Z;  1QVF Y;  3CC4 Z;  3CMA 1;  1YIJ 1;  1YHQ 1;  3CC7 1;  1VQP Z;  3CCE 1;  3OW2 Y;  1Q82 2;  3CCU Z;  1Q86 2;  1K73 1;  1VQ5 Z;  1JJ2 Y;  1VQM Z;  3CCE Z;  1QVG Y;  3CME 1;  2OTJ Z;  1YIT 1;  1VQL Z;  3G6E Z;  3OW2 Z;  3CC4 1;  1KQS Y;  1VQ7 Z;  1K9M 1;  1VQ8 1;  1S72 Z;  3CME Z;  1YJ9 Z;  1K73 2;  3G4S Z;  1M90 1;  3CCU 1;  1JJ2 Z;  1N8R 1;  1QVG Z;  3CCJ Z;  1VQ5 1;  1YJN Z;  1VQM 1;  1KQS Z;  1VQ8 Z;  3CXC Y;  3CCS Z;  2OTJ 1;  3CCV Z;  1K9M 2;  3I56 Z;  3G6E 1;  1VQL 1;  1VQ7 1;  1VQN 1;  3CD6 Z;  1Q81 1;  1M90 2;  2OTL 1;  1N8R 2;  3CCM Z;  1S72 1;  1YJ9 1;  3G4S 1;  1VQ4 Z;  1NJI 1;  3CXC Z;  3CCJ 1;  1VQN Z;  1VQ6 Z;  3CCL 1;  1YJN 1;  2OTL Z;  1Q7Y 1;  3CCS 1;  3G71 1;  1YJW Z;  2QA4 Z;  1YI2 Z;  3CCV 1;  1Q81 2;  3I56 1;  3CD6 1;  3CCL Z;  1NJI 2;  3CCM 1;  3G71 Z;  1VQ4 1;  3CPW Z;  2QEX 1;  3I55 Z;  1Q7Y 2;  1VQ6 1;  1W2B Y;  1M1K 1;  1YJW 1;  1K8A 1;  2QA4 1;  1VQO Z;  1YI2 1;  3CC2 Z;  1VQK Z;  2QEX Z;  1VQ9 Z;  3CCQ Z;  3CPW Y;  1KC8 1;  3CCR 1;  1KD1 1;  1W2B Z;  3I55 1;  1M1K 2;  1K8A 2;  1QVF Z;  3CMA Z;  1YIJ Z;  3CCR Z;  1YHQ Z;  1VQO 1;  3CC7 Z;  3CC2 1;  1VQK 1;  1KC8 2;  1VQ9 1;  3CCQ 1;  1Q82 1;  1Q86 1;  1KD1 2;  1VQP 1; 
#chains in the Genus database with same CATH topology
 2JUB A;  5T67 A;  1QVF Y;  3J7A 4;  5C44 I;  1YIJ 1;  2V8J A;  2LIY A;  1VQP Z;  3CCE 1;  4RVH A;  3CCU Z;  5LL6 f;  4E31 A;  3HOX I;  3S15 I;  3I07 A;  2V8K A;  3Q87 A;  4MXU A;  2PMZ A;  2H85 A;  3GCF A;  3IX0 A;  2OTJ Z;  2R92 I;  4E30 A;  3G6E Z;  1JWH C;  2GU2 A;  3CME Z;  1K73 2;  1QVG Z;  4NH1 C;  3CCJ Z;  3GTP I;  4AYB A;  1YJN Z;  1KQS Z;  3BG1 B;  2B63 I;  1SIW A;  3CCV Z;  5IT9 f;  1VQ7 1;  2OTL 1;  2RBL A;  4A3L I;  2AKL A;  3F3F C;  1VQ6 Z;  3JAM f;  3CCS 1;  4BXX I;  1YJW Z;  3HOU I;  3I56 1;  5D1P A;  1ML8 A;  3KIH A;  3CD6 1;  5A2Q f;  2JIP A;  1Z03 A;  3CCM 1;  4HGY A;  3G71 Z;  3CPW Z;  3NH4 A;  4E33 A;  1YUK A;  1Z01 A;  4RVD A;  3HOZ I;  1Q7Y 2;  4MH4 A;  3GTL I;  1K8A 1;  3CC2 Z;  5FLX f;  1RO2 A;  1Z02 A;  4EWC A;  1NP6 A;  1VLA A;  2YU9 I;  4NBG A;  3GTQ I;  1KD1 1;  3IF8 A;  3GKQ A;  2YAD A;  3U50 C;  2JIM A;  1YIJ Z;  3CCR Z;  1VQO 1;  3FKI I;  2G2K A;  2JIO A;  1USP A;  2R6M A;  4MD7 A;  2E2H I;  3CCQ 1;  1RO4 A;  2IZ3 A;  1Q86 1;  3M3Y I;  4Y52 I;  1I50 I;  2KPI A;  5IP7 I;  1QF8 A;  4DGL A;  3HOY I;  3GTK I;  2PM9 A;  3VMI A;  3CMA 1;  1FDO A;  1RLY A;  1YHQ 1;  4BY1 I;  3GTO I;  1Q82 2;  2O4H A;  4NBF A;  2RT9 A;  2R7Z I;  4E32 A;  3S17 I;  4A3C I;  2M6N A;  4MRI A;  1Y8C A;  1QVG Y;  1TWG I;  2M48 A;  1YIT 1;  2F4M A;  3OW2 Z;  1X3Z A;  1KQS Y;  3CC4 1;  2VPY A;  4BBS I;  1VQ7 Z;  1K9M 1;  2JR6 A;  2QRC B;  3TDH B;  1QXF A;  2V8I A;  2DE7 A;  1M90 1;  2JMO A;  1JJ2 Z;  1N8R 1;  2E7Z A;  1LQL A;  1VQ5 1;  1TWA I;  2VPZ A;  4NB8 A;  2V45 A;  2F4O A;  2QRE B;  1VQ8 Z;  3CCS Z;  3TE5 B;  3I56 Z;  1VQL 1;  1Q16 A;  4RV9 A;  1VQN 1;  3CD6 Z;  1Q81 1;  3S1R I;  2DE6 A;  3S16 I;  1WJ2 A;  3CCM Z;  1S72 1;  1YJ9 1;  3H3V J;  3G4S 1;  2JA7 I;  1NJI 1;  1TWH I;  3CXC Z;  5C3E I;  4A3J I;  2WB1 A;  2LFU A;  2GTI A;  4HH4 A;  3I4M I;  4RS4 A;  3D2L A;  3J80 f;  3D6W A;  4XX2 A;  4A3G I;  4DQY B;  3CCL Z;  1Y1W I;  1ZH1 A;  4DK1 A;  1VQ4 1;  2P28 A;  4HGZ A;  3HOW I;  5FLM I;  3RZO I;  2RHB A;  3NDI A;  2QA4 1;  1RQF A;  2OOX B;  1X0T A;  1VQO Z;  2QEX Z;  2LEX A;  4A3I I;  2IV2 X;  2JS4 A;  3CCQ Z;  3MZL B;  3MON A;  2O53 A;  2V3V A;  1W2B Z;  1P9N A;  4A3E I;  2K3R A;  3FQQ A;  1M1K 2;  4NBA A;  2BJO A;  1QVF Z;  3CMA Z;  3S1M I;  1YHQ Z;  3LUS A;  1NUI A;  3P5J B;  4A3M I;  1KC8 2;  1VQ9 1;  2AYD A;  3GTG I;  1RO0 A;  2RIQ A;  1X3W A;  3S2H I;  4A3B I;  1ZB8 A;  1VQP 1;  2OOY B;  1YIT Z;  3CC4 Z;  2HF1 A;  3HKZ A;  1AA6 A;  3VMH A;  3CC7 1;  3OW2 Y;  4A3K I;  1K73 1;  3D9X A;  1VQ5 Z;  3BG0 B;  1JJ2 Y;  3CCE Z;  1ZB9 A;  1TFI A;  3CME 1;  4NBD A;  3T4N B;  1PFT A;  1VQL Z;  5C4X I;  2GTH A;  2E2J I;  1S72 Z;  1YJ9 Z;  4QTU A;  5C4J I;  3G4S Z;  5CM2 M;  3S1N I;  1TWF I;  1FDI A;  2JA8 I;  5IP9 I;  1VQM 1;  3VMG A;  4TNU A;  3CXC Y;  4BBR I;  3J81 b;  5IT9 b;  3GTJ I;  5D1O B;  1VQ4 Z;  1N2F A;  1WII A;  1WZN A;  3IR7 A;  4MD9 A;  3S2D I;  2OTL Z;  1Q7Y 1;  2WAQ A;  2Y0S A;  3ESW A;  3G71 1;  2QA4 Z;  4A93 I;  2NVQ I;  4A3F I;  2NVX I;  4A3D I;  2PK7 A;  2KI7 B;  3QWU A;  2QR1 B;  1W2B Y;  1RNI A;  2JA6 I;  1R9T I;  1DL6 A;  2JIQ A;  2NAP A;  1YI2 1;  3CQZ I;  2P3Y A;  1VQ9 Z;  2Q51 A;  2VUG A;  3CPW Y;  1TWC I;  5AN9 F;  3PO2 I;  2Q4Z A;  2HU9 A;  3CCR 1;  3RZD I;  2VUM I;  3I55 1;  2JNY A;  1K8A 2;  4E2Z A;  3VTN A;  3M4O I;  4X6A I;  3S1Q I;  3CC7 Z;  1VQK 1;  1QYP A;  5T6B A;  4BY7 I;  3H0G I;  1Q82 1;  3I4N I;  1KD1 2;  4RVF A;  1WW9 A;  2E9H A;  4S1T A;  3S14 I;  2QKD A;  4NBB A;  4E2X A;  1Q86 2;  2NVY I;  3J81 f;  2JIR A;  2EGT A;  3F3P C;  4MON A;  1VQM Z;  3KIF A;  2R93 I;  4NBE A;  3PO3 I;  2NVT I;  4MD8 A;  4QTT A;  3GTM I;  3FQM A;  3PO3 S;  1VQ8 1;  2W03 A;  3CCU 1;  3GTM S;  3VB9 A;  1YUA A;  1USP B;  2RPR A;  2OTJ 1;  4RVG A;  4NBC A;  2I3C A;  1K9M 2;  3G6E 1;  1M90 2;  4E2W A;  1N8R 2;  2W04 A;  3EER A;  3NH8 A;  3CCJ 1;  1VQN Z;  2OZK A;  3CCL 1;  4NOZ A;  1YJN 1;  2E2I I;  4NB9 A;  1YI2 Z;  1SFO I;  3J80 b;  4Y7N I;  3CCV 1;  1Q81 2;  1KRL A;  1NJI 2;  4NFR A;  1WCM I;  3NH5 A;  2QEX 1;  2J6A A;  3I55 Z;  1L1O C;  1S7M A;  1VQ6 1;  2VF1 A;  1M1K 1;  1YJW 1;  1VQK Z;  3HOV I;  2QRD B;  2JA5 I;  4NBH A;  3JAM b;  1I6H I;  1KC8 1;  2IZ4 A;  4CL1 A;  2K5R A;  3K7A I;  5A2Q b;  2DE5 A;  4E2Y A;  1Y1V I;  3NFZ A;  5T64 A;  3NDJ A;  3EED A;  1Y1V S;  3CC2 1;  3MZK B;  2VPX A;  1K83 I;  1I3Q I;  5FLX b;  3IFU A;  5D1O A;  2QLV B;  2VPW A;  2ZAE B; 
#chains in the Genus database with same CATH homology
 2JUB A;  5T67 A;  1QVF Y;  3J7A 4;  5C44 I;  1YIJ 1;  2V8J A;  2LIY A;  1VQP Z;  3CCE 1;  4RVH A;  3CCU Z;  5LL6 f;  4E31 A;  3HOX I;  3S15 I;  3I07 A;  2V8K A;  3Q87 A;  4MXU A;  2PMZ A;  2H85 A;  3GCF A;  3IX0 A;  2OTJ Z;  2R92 I;  4E30 A;  3G6E Z;  1JWH C;  2GU2 A;  3CME Z;  1K73 2;  1QVG Z;  4NH1 C;  3CCJ Z;  3GTP I;  4AYB A;  1YJN Z;  1KQS Z;  3BG1 B;  2B63 I;  3CCV Z;  5IT9 f;  1VQ7 1;  2OTL 1;  2RBL A;  4A3L I;  2AKL A;  3F3F C;  1VQ6 Z;  3JAM f;  3CCS 1;  4BXX I;  1YJW Z;  3HOU I;  3I56 1;  5D1P A;  1ML8 A;  3KIH A;  3CD6 1;  5A2Q f;  1Z03 A;  3CCM 1;  4HGY A;  3G71 Z;  3CPW Z;  3NH4 A;  4E33 A;  1YUK A;  1Z01 A;  4RVD A;  3HOZ I;  1Q7Y 2;  4MH4 A;  3GTL I;  1K8A 1;  3CC2 Z;  5FLX f;  1RO2 A;  1Z02 A;  4EWC A;  1NP6 A;  1VLA A;  2YU9 I;  4NBG A;  3GTQ I;  1KD1 1;  3IF8 A;  3GKQ A;  2YAD A;  3U50 C;  1YIJ Z;  3CCR Z;  1VQO 1;  3FKI I;  2G2K A;  1USP A;  2R6M A;  4MD7 A;  2E2H I;  3CCQ 1;  1RO4 A;  2IZ3 A;  1Q86 1;  3M3Y I;  4Y52 I;  1I50 I;  2KPI A;  5IP7 I;  1QF8 A;  4DGL A;  3HOY I;  3GTK I;  2PM9 A;  3VMI A;  3CMA 1;  1YHQ 1;  1RLY A;  4BY1 I;  3GTO I;  1Q82 2;  2O4H A;  4NBF A;  2RT9 A;  2R7Z I;  4E32 A;  3S17 I;  4A3C I;  2M6N A;  4MRI A;  1QVG Y;  1TWG I;  2M48 A;  1YIT 1;  2F4M A;  3OW2 Z;  1X3Z A;  1KQS Y;  3CC4 1;  4BBS I;  1VQ7 Z;  1K9M 1;  2JR6 A;  2QRC B;  3TDH B;  2V8I A;  2DE7 A;  1M90 1;  2JMO A;  1JJ2 Z;  1N8R 1;  1LQL A;  1VQ5 1;  1TWA I;  4NB8 A;  2F4O A;  2QRE B;  1VQ8 Z;  3CCS Z;  3TE5 B;  3I56 Z;  1VQL 1;  4RV9 A;  1VQN 1;  3CD6 Z;  1Q81 1;  3S1R I;  2DE6 A;  3S16 I;  3CCM Z;  1S72 1;  1YJ9 1;  3H3V J;  3G4S 1;  2JA7 I;  1NJI 1;  1TWH I;  3CXC Z;  5C3E I;  4A3J I;  2WB1 A;  2LFU A;  2GTI A;  4HH4 A;  3I4M I;  4RS4 A;  3J80 f;  3D6W A;  4XX2 A;  4A3G I;  4DQY B;  3CCL Z;  1Y1W I;  1ZH1 A;  4DK1 A;  1VQ4 1;  2P28 A;  4HGZ A;  3HOW I;  5FLM I;  3RZO I;  2RHB A;  3NDI A;  2QA4 1;  1RQF A;  2OOX B;  1X0T A;  1VQO Z;  2QEX Z;  4A3I I;  2JS4 A;  3CCQ Z;  3MZL B;  3MON A;  2O53 A;  1W2B Z;  1P9N A;  4A3E I;  2K3R A;  3FQQ A;  1M1K 2;  4NBA A;  2BJO A;  1QVF Z;  3CMA Z;  3S1M I;  1YHQ Z;  3LUS A;  1NUI A;  3P5J B;  4A3M I;  1KC8 2;  1VQ9 1;  3GTG I;  1RO0 A;  2RIQ A;  1X3W A;  3S2H I;  4A3B I;  1ZB8 A;  1VQP 1;  2OOY B;  1YIT Z;  3CC4 Z;  2HF1 A;  3HKZ A;  3VMH A;  3CC7 1;  3OW2 Y;  4A3K I;  1K73 1;  3D9X A;  1VQ5 Z;  3BG0 B;  1JJ2 Y;  3CCE Z;  1ZB9 A;  1TFI A;  3CME 1;  4NBD A;  3T4N B;  1PFT A;  1VQL Z;  5C4X I;  2GTH A;  2E2J I;  1S72 Z;  1YJ9 Z;  4QTU A;  5C4J I;  3G4S Z;  5CM2 M;  3S1N I;  1TWF I;  2JA8 I;  5IP9 I;  1VQM 1;  3VMG A;  4TNU A;  3CXC Y;  4BBR I;  3J81 b;  5IT9 b;  3GTJ I;  5D1O B;  1VQ4 Z;  1N2F A;  1WII A;  4MD9 A;  3S2D I;  2OTL Z;  1Q7Y 1;  2WAQ A;  2Y0S A;  3ESW A;  3G71 1;  2QA4 Z;  4A93 I;  2NVQ I;  4A3F I;  2NVX I;  4A3D I;  2PK7 A;  2KI7 B;  3QWU A;  2QR1 B;  1W2B Y;  1RNI A;  2JA6 I;  1R9T I;  1DL6 A;  1YI2 1;  3CQZ I;  2P3Y A;  1VQ9 Z;  2Q51 A;  2VUG A;  3CPW Y;  1TWC I;  5AN9 F;  3PO2 I;  2Q4Z A;  2HU9 A;  3CCR 1;  3RZD I;  2VUM I;  3I55 1;  2JNY A;  1K8A 2;  4E2Z A;  3VTN A;  3M4O I;  4X6A I;  3S1Q I;  3CC7 Z;  1VQK 1;  1QYP A;  5T6B A;  4BY7 I;  3H0G I;  1Q82 1;  3I4N I;  1KD1 2;  4RVF A;  1WW9 A;  2E9H A;  4S1T A;  3S14 I;  2QKD A;  4NBB A;  4E2X A;  1Q86 2;  2NVY I;  3J81 f;  2EGT A;  3F3P C;  4MON A;  1VQM Z;  3KIF A;  2R93 I;  4NBE A;  3PO3 I;  2NVT I;  4MD8 A;  4QTT A;  3GTM I;  3FQM A;  3PO3 S;  1VQ8 1;  2W03 A;  3CCU 1;  3GTM S;  3VB9 A;  1YUA A;  1USP B;  2RPR A;  2OTJ 1;  4RVG A;  4NBC A;  2I3C A;  1K9M 2;  3G6E 1;  1M90 2;  4E2W A;  1N8R 2;  2W04 A;  3EER A;  3NH8 A;  3CCJ 1;  1VQN Z;  2OZK A;  3CCL 1;  4NOZ A;  1YJN 1;  2E2I I;  4NB9 A;  1YI2 Z;  1SFO I;  3J80 b;  4Y7N I;  3CCV 1;  1Q81 2;  1KRL A;  1NJI 2;  4NFR A;  1WCM I;  3NH5 A;  2QEX 1;  2J6A A;  3I55 Z;  1L1O C;  1S7M A;  1VQ6 1;  2VF1 A;  1M1K 1;  1YJW 1;  1VQK Z;  3HOV I;  2QRD B;  2JA5 I;  4NBH A;  3JAM b;  1I6H I;  1KC8 1;  2IZ4 A;  4CL1 A;  2K5R A;  3K7A I;  5A2Q b;  2DE5 A;  4E2Y A;  1Y1V I;  3NFZ A;  5T64 A;  3NDJ A;  3EED A;  1Y1V S;  3CC2 1;  3MZK B;  1K83 I;  1I3Q I;  5FLX b;  3IFU A;  5D1O A;  2QLV B;  2ZAE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...