3CCE1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cce100
1K9M2 1S72Z 1YIT1 1YI21 1KC81 1VQ7Z 2OTJ1 3G4SZ 1VQN1 3I55Z 2QA41 1YIJZ 1NJI2 3CCR1 3CCVZ 1YJ9Z 1YJW1 3CCS1 3CC7Z 1Q812 3CME1 3CCL1 1M1K2 1Q822 3CC41 3CCE1 3CD61 1VQO1 1M901 1N8R2 1W2BY 1KD12 1Q861 1W2BZ 3G6EZ 2QEXZ 1VQLZ 1YJNZ 3CC21 1VQ4Z 1YHQ1 1VQPZ 3I56Z 1VQ5Z 1VQ91 1VQM1 1QVGY 1QVGZ 1K732 1K8A1 1YITZ 1YI2Z 2OTJZ 1VQNZ 2QA4Z 1Q7Y2 3G4S1 3CCM1 3CCRZ 1YJWZ 1K9M1 3CCSZ 1VQ81 1JJ2Y 3CC71 3CMA1 3CMEZ 3CCLZ 1JJ2Z 2OTL1 1NJI1 3CCQ1 3CCEZ 3CPWY 1VQ61 1VQKZ 1VQOZ 1Q811 1KC82 1KQSY 3CXCY 3CXCZ 3G711 1M1K1 1Q821 3CCU1 3CCJ1 3CC2Z 1QVFY 1S721 1YHQZ 1YJN1 1VQ71 1N8R1 1VQ9Z 3I551 1VQMZ 1KD11 1VQ51 1YIJ1 3CCV1 1YJ91 1M902 3CCMZ 3CC4Z 1Q862 3CD6Z 1VQ8Z 1K731 3CPWZ 3CMAZ 1KQSZ 1Q7Y1 2OTLZ 3CCQZ 1VQ6Z 1K8A2 2QEX1 3G6E1 3OW2Y 1VQL1 1QVFZ 3OW2Z 1VQ41 1VQK1 1VQP1 3G71Z 3I561 3CCUZ 3CCJZ
chains in the Genus database with same CATH superfamily
1K9M2 2E7ZA 1Q16A 1YIT1 2JA5I 3G4SZ 2QA41 4TNUA 1NUIA 1NJI2 1YJ9Z 3CC7Z 2IZ4A 1Q812 3I4NI 3K7AI 2YU9I 2YADA 1M1K2 1S7MA 1Q822 2VPZA 5AN9F 3D9XA 2QRDB 3M4OI 3J80b 5IT9b 1Z01A 1M901 1N8R2 3JAMb 1W2BY 1KD12 2W04A 4E2ZA 4E31A 3VMGA 3Q87A 4MRIA 1L1OC 4E2XA 4A93I 3VMHA 3GTMI 1ZH1A 4A3FI 3NH8A 2PM9A 2RIQA 1QVGZ 1K732 1RLYA 2HF1A 2DE6A 4E32A 1YI2Z 2AKLA 3S1MI 3J81f 4A3MI 2AYDA 2V8KA 3CCRZ 3IFUA 2GTHA 2VUMI 2JR6A 2JNYA 4RVFA 2JIQA 2V8IA 3CMEZ 1RO2A 2OTL1 3MONA 3D2LA 4RVHA 3CCQ1 3CPWY 2O4HA 3HOYI 2LEXA 1VQKZ 1KC82 4NOZA 1KQSY 3U50C 3IX0A 3CXCY 1WIIA 1YJN1 3S2HI 1VQ9Z 2PK7A 2OOXB 1YJ91 3TE5B 3S1QI 2JS4A 1RQFA 4MONA 1Q862 4NBHA 2I3CA 1VQ8Z 1X3WA 2NVYI 2GU2A 3IF8A 4RV9A 3EERA 1VQ6Z 3OW2Y 4HGYA 2VUGA 1P9NA 5D1PA 3KIFA 3S17I 1YI21 4EWCA 2QR1B 2IZ3A 4NBEA 4NB8A 4NBGA 1YIJZ 3CCR1 3VMIA 3CCVZ 1QYPA 4E2YA 3PO3S 3BG0B 4E33A 2R93I 2LFUA 3GTPI 2W03A 5C4JI 1WZNA 3CME1 2VF1A 3MZLB 1I50I 4E30A 3FQMA 2KI7B 3CD61 1PFTA 2HU9A 1KRLA 4MXUA 4A3CI 1Y1WI 3PO2I 1W2BZ 2QEXZ 1TFIA 1YJNZ 2QREB 1VQ4Z 3T4NB 4A3DI 3ESWA 1VQ91 1VLAA 1K8A1 2BJOA 2R6MA 2RPRA 2NVXI 3HOWI 4A3JI 3S15I 1RO0A 1YUAA 1YJWZ 2RT9A 4AYBA 4HH4A 1JWHC 1VQ81 2R92I 4NBCA 4E2WA 3CCLZ 2WAQA 5IP7I 3PO3I 3CCEZ 1VQ61 1QF8A 4BXXI 3CQZI 3CXCZ 3MZKB 1FDIA 4BY1I 2IV2X 2ZAEB 4XX2A 1WJ2A 2GTIA 3HOZI 4NBAA 3S14I 1VQ51 1YIJ1 1YUKA 2F4OA 2V45A 3NDIA 3CCV1 3HOXI 2M48A 3QWUA 1M902 2VPYA 2JA7I 4Y7NI 3CD6Z 5FLMI 4QTUA 3HOVI 2K3RA 5FLXf 1Q7Y1 3F3FC 2B63I 2G2KA 2DE7A 2QEX1 3GTLI 3I4MI 1QVFZ 3OW2Z 1VQ41 5T67A 2M6NA 4A3II 1TWAI 1S72Z 1R9TI 2WB1A 3S1RI 1VQ7Z 2E2II 3I07A 3I55Z 2DE5A 1YJW1 4DGLA 1TWGI 3J81b 1QXFA 3CCL1 3J7A4 1N2FA 2EGTA 2KPIA 4A3KI 3CCE1 1X3ZA 5C4XI 3RZDI 5D1OB 4S1TA 3G6EZ 3NH4A 2O53A 1VQLZ 4MD9A 3GTOI 1LQLA 2V3VA 4CL1A 1VQPZ 1VQ5Z 4RS4A 3KIHA 3GTQI 2P28A 5T64A 2OTJZ 4RVDA 1VQNZ 3FKII 2OZKA 4RVGA 1WW9A 2E9HA 1K9M1 3CCSZ 3J80f 5C3EI 1JJ2Y 1DL6A 3JAMf 3HOUI 3TDHB 1NJI1 3GCFA 4NB9A 3VB9A 1VQOZ 1Q811 3S16I 2JIMA 2QRCB 2VPWA 1M1K1 4A3GI 1Q821 4A3BI 3NFZA 3CC2Z 2R7ZI 1S721 1RO4A 1USPA 1YHQZ 5D1OA 1VQ71 2NAPA 1N8R1 3I551 2JIPA 1VQMZ 1KD11 5A2Qf 1NP6A 2PMZA 3CCMZ 4A3EI 2NVQI 1K731 4DQYB 3CPWZ 3CMAZ 1KQSZ 3F3PC 1K83I 3EEDA 1K8A2 4MH4A 3G6E1 1VQL1 2F4MA 4NFRA 2Q4ZA 1VQP1 3G71Z 2J6AA 3CCUZ 5IP9I 2VPXA 3CCJZ 2H85A 1X0TA 1TWHI 2JA8I 1KC81 2OTJ1 1VQN1 4NH1C 4A3LI 4MD8A 3HKZA 3CCS1 5C44I 2NVTI 1TWFI 4HGZA 3CC41 3H3VJ 4BBSI 1SIWA 5A2Qb 4NBFA 1VQO1 2JMOA 3H0GI 1RNIA 2V8JA 4X6AI 1Q861 3GTKI 3LUSA 4DK1A 3P5JB 2JIOA 3CC21 1YHQ1 3I56Z 3FQQA 3NDJA 1VQM1 1QVGY 3NH5A 3S2DI 1YITZ 2RHBA 1I6HI 2K5RA 2QA4Z 1Q7Y2 2OOYB 3VTNA 3G4S1 4MD7A 3CCM1 2QKDA 2JUBA 1Z02A 1USPB 3IR7A 3CC71 1Y1VS 3GKQA 3CMA1 1JJ2Z 1ZB8A 4QTTA 1WCMI 1SFOI 5FLXb 2P3YA 3G711 3CCU1 3D6WA 2Q51A 3CCJ1 4Y52I 1QVFY 1ML8A 2Y0SA 2JA6I 5LL6f 2LIYA 1Y8CA 1TWCI 3RZOI 2E2JI 3BG1B 1ZB9A 2RBLA 5IT9f 5CM2M 1AA6A 1Z03A 4BBRI 3CC4Z 2QLVB 1FDOA 3GTJI 3GTGI 3S1NI 5T6BA 2OTLZ 4NBBA 4BY7I 2JIRA 2E2HI 4NBDA 3CCQZ 3GTMS 3M3YI 1Y1VI 1VQK1 1I3QI 3I561
chains in the Genus database with same CATH topology
1K9M2 1YIT1 2JA5I 3G4SZ 2QA41 4TNUA 1NUIA 1NJI2 1YJ9Z 3CC7Z 2IZ4A 1Q812 3I4NI 3K7AI 2YU9I 2YADA 1M1K2 1S7MA 1Q822 5AN9F 3D9XA 2QRDB 3M4OI 3J80b 5IT9b 1Z01A 1M901 1N8R2 3JAMb 1W2BY 1KD12 2W04A 4E2ZA 4E31A 3VMGA 3Q87A 4MRIA 1L1OC 4E2XA 4A93I 3VMHA 3GTMI 1ZH1A 4A3FI 3NH8A 2PM9A 2RIQA 1QVGZ 1K732 1RLYA 2HF1A 2DE6A 4E32A 1YI2Z 2AKLA 3S1MI 3J81f 4A3MI 2V8KA 3CCRZ 3IFUA 2GTHA 2VUMI 2JR6A 2JNYA 4RVFA 2V8IA 3CMEZ 1RO2A 2OTL1 3MONA 4RVHA 3CCQ1 3CPWY 2O4HA 3HOYI 1VQKZ 1KC82 4NOZA 1KQSY 3U50C 3IX0A 3CXCY 1WIIA 1YJN1 3S2HI 1VQ9Z 2PK7A 2OOXB 1YJ91 3TE5B 3S1QI 2JS4A 1RQFA 4MONA 1Q862 4NBHA 2I3CA 1VQ8Z 1X3WA 2NVYI 2GU2A 3IF8A 4RV9A 3EERA 1VQ6Z 3OW2Y 4HGYA 2VUGA 1P9NA 5D1PA 3KIFA 3S17I 1YI21 4EWCA 2QR1B 2IZ3A 4NBEA 4NB8A 4NBGA 1YIJZ 3CCR1 3VMIA 3CCVZ 1QYPA 4E2YA 3PO3S 3BG0B 4E33A 2R93I 2LFUA 3GTPI 2W03A 5C4JI 3CME1 2VF1A 3MZLB 1I50I 4E30A 3FQMA 2KI7B 3CD61 1PFTA 2HU9A 1KRLA 4MXUA 4A3CI 1Y1WI 3PO2I 1W2BZ 2QEXZ 1TFIA 1YJNZ 2QREB 1VQ4Z 3T4NB 4A3DI 3ESWA 1VQ91 1VLAA 1K8A1 2BJOA 2R6MA 2RPRA 2NVXI 3HOWI 4A3JI 3S15I 1RO0A 1YUAA 1YJWZ 2RT9A 4AYBA 4HH4A 1JWHC 1VQ81 2R92I 4NBCA 4E2WA 3CCLZ 2WAQA 5IP7I 3PO3I 3CCEZ 1VQ61 1QF8A 4BXXI 3CQZI 3CXCZ 3MZKB 4BY1I 2ZAEB 4XX2A 2GTIA 3HOZI 4NBAA 3S14I 1VQ51 1YIJ1 1YUKA 2F4OA 3NDIA 3CCV1 3HOXI 2M48A 3QWUA 1M902 2JA7I 4Y7NI 3CD6Z 5FLMI 4QTUA 3HOVI 2K3RA 5FLXf 1Q7Y1 3F3FC 2B63I 2G2KA 2DE7A 2QEX1 3GTLI 3I4MI 1QVFZ 3OW2Z 1VQ41 5T67A 2M6NA 4A3II 1TWAI 1S72Z 1R9TI 2WB1A 3S1RI 1VQ7Z 2E2II 3I07A 3I55Z 2DE5A 1YJW1 4DGLA 1TWGI 3J81b 3CCL1 3J7A4 1N2FA 2EGTA 2KPIA 4A3KI 3CCE1 1X3ZA 5C4XI 3RZDI 5D1OB 4S1TA 3G6EZ 3NH4A 2O53A 1VQLZ 4MD9A 3GTOI 1LQLA 4CL1A 1VQPZ 1VQ5Z 4RS4A 3KIHA 3GTQI 2P28A 5T64A 2OTJZ 4RVDA 1VQNZ 3FKII 2OZKA 4RVGA 1WW9A 2E9HA 1K9M1 3CCSZ 3J80f 5C3EI 1JJ2Y 1DL6A 3JAMf 3HOUI 3TDHB 1NJI1 3GCFA 4NB9A 3VB9A 1VQOZ 1Q811 3S16I 2QRCB 1M1K1 4A3GI 1Q821 4A3BI 3NFZA 3CC2Z 2R7ZI 1S721 1RO4A 1USPA 1YHQZ 5D1OA 1VQ71 1N8R1 3I551 1VQMZ 1KD11 5A2Qf 1NP6A 2PMZA 3CCMZ 4A3EI 2NVQI 1K731 4DQYB 3CPWZ 3CMAZ 1KQSZ 3F3PC 1K83I 3EEDA 1K8A2 4MH4A 3G6E1 1VQL1 2F4MA 4NFRA 2Q4ZA 1VQP1 3G71Z 2J6AA 3CCUZ 5IP9I 3CCJZ 2H85A 1X0TA 1TWHI 2JA8I 1KC81 2OTJ1 1VQN1 4NH1C 4A3LI 4MD8A 3HKZA 3CCS1 5C44I 2NVTI 1TWFI 4HGZA 3CC41 3H3VJ 4BBSI 5A2Qb 4NBFA 1VQO1 2JMOA 3H0GI 1RNIA 2V8JA 4X6AI 1Q861 3GTKI 3LUSA 4DK1A 3P5JB 3CC21 1YHQ1 3I56Z 3FQQA 3NDJA 1VQM1 1QVGY 3NH5A 3S2DI 1YITZ 2RHBA 1I6HI 2K5RA 2QA4Z 1Q7Y2 2OOYB 3VTNA 3G4S1 4MD7A 3CCM1 2QKDA 2JUBA 1Z02A 1USPB 3CC71 1Y1VS 3GKQA 3CMA1 1JJ2Z 1ZB8A 4QTTA 1WCMI 1SFOI 5FLXb 2P3YA 3G711 3CCU1 3D6WA 2Q51A 3CCJ1 4Y52I 1QVFY 1ML8A 2Y0SA 2JA6I 5LL6f 2LIYA 1TWCI 3RZOI 2E2JI 3BG1B 1ZB9A 2RBLA 5IT9f 5CM2M 1Z03A 4BBRI 3CC4Z 2QLVB 3GTJI 3GTGI 3S1NI 5T6BA 2OTLZ 4NBBA 4BY7I 2E2HI 4NBDA 3CCQZ 3GTMS 3M3YI 1Y1VI 1VQK1 1I3QI 3I561
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 2;  1S72 Z;  1YIT 1;  1YI2 1;  1KC8 1;  1VQ7 Z;  2OTJ 1;  3G4S Z;  1VQN 1;  3I55 Z;  2QA4 1;  1YIJ Z;  1NJI 2;  3CCR 1;  3CCV Z;  1YJ9 Z;  1YJW 1;  3CCS 1;  3CC7 Z;  1Q81 2;  3CME 1;  3CCL 1;  1M1K 2;  1Q82 2;  3CC4 1;  3CCE 1;  3CD6 1;  1VQO 1;  1M90 1;  1N8R 2;  1W2B Y;  1KD1 2;  1Q86 1;  1W2B Z;  3G6E Z;  2QEX Z;  1VQL Z;  1YJN Z;  3CC2 1;  1VQ4 Z;  1YHQ 1;  1VQP Z;  3I56 Z;  1VQ5 Z;  1VQ9 1;  1VQM 1;  1QVG Y;  1QVG Z;  1K73 2;  1K8A 1;  1YIT Z;  1YI2 Z;  2OTJ Z;  1VQN Z;  2QA4 Z;  1Q7Y 2;  3G4S 1;  3CCM 1;  3CCR Z;  1YJW Z;  1K9M 1;  3CCS Z;  1VQ8 1;  1JJ2 Y;  3CC7 1;  3CMA 1;  3CME Z;  3CCL Z;  1JJ2 Z;  2OTL 1;  1NJI 1;  3CCQ 1;  3CCE Z;  3CPW Y;  1VQ6 1;  1VQK Z;  1VQO Z;  1Q81 1;  1KC8 2;  1KQS Y;  3CXC Y;  3CXC Z;  3G71 1;  1M1K 1;  1Q82 1;  3CCU 1;  3CCJ 1;  3CC2 Z;  1QVF Y;  1S72 1;  1YHQ Z;  1YJN 1;  1VQ7 1;  1N8R 1;  1VQ9 Z;  3I55 1;  1VQM Z;  1KD1 1;  1VQ5 1;  1YIJ 1;  3CCV 1;  1YJ9 1;  1M90 2;  3CCM Z;  3CC4 Z;  1Q86 2;  3CD6 Z;  1VQ8 Z;  1K73 1;  3CPW Z;  3CMA Z;  1KQS Z;  1Q7Y 1;  2OTL Z;  3CCQ Z;  1VQ6 Z;  1K8A 2;  2QEX 1;  3G6E 1;  3OW2 Y;  1VQL 1;  1QVF Z;  3OW2 Z;  1VQ4 1;  1VQK 1;  1VQP 1;  3G71 Z;  3I56 1;  3CCU Z;  3CCJ Z; 
#chains in the Genus database with same CATH topology
 1K9M 2;  2E7Z A;  1Q16 A;  1YIT 1;  2JA5 I;  3G4S Z;  2QA4 1;  4TNU A;  1NUI A;  1NJI 2;  1YJ9 Z;  3CC7 Z;  2IZ4 A;  1Q81 2;  3I4N I;  3K7A I;  2YU9 I;  2YAD A;  1M1K 2;  1S7M A;  1Q82 2;  2VPZ A;  5AN9 F;  3D9X A;  2QRD B;  3M4O I;  3J80 b;  5IT9 b;  1Z01 A;  1M90 1;  1N8R 2;  3JAM b;  1W2B Y;  1KD1 2;  2W04 A;  4E2Z A;  4E31 A;  3VMG A;  3Q87 A;  4MRI A;  1L1O C;  4E2X A;  4A93 I;  3VMH A;  3GTM I;  1ZH1 A;  4A3F I;  3NH8 A;  2PM9 A;  2RIQ A;  1QVG Z;  1K73 2;  1RLY A;  2HF1 A;  2DE6 A;  4E32 A;  1YI2 Z;  2AKL A;  3S1M I;  3J81 f;  4A3M I;  2AYD A;  2V8K A;  3CCR Z;  3IFU A;  2GTH A;  2VUM I;  2JR6 A;  2JNY A;  4RVF A;  2JIQ A;  2V8I A;  3CME Z;  1RO2 A;  2OTL 1;  3MON A;  3D2L A;  4RVH A;  3CCQ 1;  3CPW Y;  2O4H A;  3HOY I;  2LEX A;  1VQK Z;  1KC8 2;  4NOZ A;  1KQS Y;  3U50 C;  3IX0 A;  3CXC Y;  1WII A;  1YJN 1;  3S2H I;  1VQ9 Z;  2PK7 A;  2OOX B;  1YJ9 1;  3TE5 B;  3S1Q I;  2JS4 A;  1RQF A;  4MON A;  1Q86 2;  4NBH A;  2I3C A;  1VQ8 Z;  1X3W A;  2NVY I;  2GU2 A;  3IF8 A;  4RV9 A;  3EER A;  1VQ6 Z;  3OW2 Y;  4HGY A;  2VUG A;  1P9N A;  5D1P A;  3KIF A;  3S17 I;  1YI2 1;  4EWC A;  2QR1 B;  2IZ3 A;  4NBE A;  4NB8 A;  4NBG A;  1YIJ Z;  3CCR 1;  3VMI A;  3CCV Z;  1QYP A;  4E2Y A;  3PO3 S;  3BG0 B;  4E33 A;  2R93 I;  2LFU A;  3GTP I;  2W03 A;  5C4J I;  1WZN A;  3CME 1;  2VF1 A;  3MZL B;  1I50 I;  4E30 A;  3FQM A;  2KI7 B;  3CD6 1;  1PFT A;  2HU9 A;  1KRL A;  4MXU A;  4A3C I;  1Y1W I;  3PO2 I;  1W2B Z;  2QEX Z;  1TFI A;  1YJN Z;  2QRE B;  1VQ4 Z;  3T4N B;  4A3D I;  3ESW A;  1VQ9 1;  1VLA A;  1K8A 1;  2BJO A;  2R6M A;  2RPR A;  2NVX I;  3HOW I;  4A3J I;  3S15 I;  1RO0 A;  1YUA A;  1YJW Z;  2RT9 A;  4AYB A;  4HH4 A;  1JWH C;  1VQ8 1;  2R92 I;  4NBC A;  4E2W A;  3CCL Z;  2WAQ A;  5IP7 I;  3PO3 I;  3CCE Z;  1VQ6 1;  1QF8 A;  4BXX I;  3CQZ I;  3CXC Z;  3MZK B;  1FDI A;  4BY1 I;  2IV2 X;  2ZAE B;  4XX2 A;  1WJ2 A;  2GTI A;  3HOZ I;  4NBA A;  3S14 I;  1VQ5 1;  1YIJ 1;  1YUK A;  2F4O A;  2V45 A;  3NDI A;  3CCV 1;  3HOX I;  2M48 A;  3QWU A;  1M90 2;  2VPY A;  2JA7 I;  4Y7N I;  3CD6 Z;  5FLM I;  4QTU A;  3HOV I;  2K3R A;  5FLX f;  1Q7Y 1;  3F3F C;  2B63 I;  2G2K A;  2DE7 A;  2QEX 1;  3GTL I;  3I4M I;  1QVF Z;  3OW2 Z;  1VQ4 1;  5T67 A;  2M6N A;  4A3I I;  1TWA I;  1S72 Z;  1R9T I;  2WB1 A;  3S1R I;  1VQ7 Z;  2E2I I;  3I07 A;  3I55 Z;  2DE5 A;  1YJW 1;  4DGL A;  1TWG I;  3J81 b;  1QXF A;  3CCL 1;  3J7A 4;  1N2F A;  2EGT A;  2KPI A;  4A3K I;  3CCE 1;  1X3Z A;  5C4X I;  3RZD I;  5D1O B;  4S1T A;  3G6E Z;  3NH4 A;  2O53 A;  1VQL Z;  4MD9 A;  3GTO I;  1LQL A;  2V3V A;  4CL1 A;  1VQP Z;  1VQ5 Z;  4RS4 A;  3KIH A;  3GTQ I;  2P28 A;  5T64 A;  2OTJ Z;  4RVD A;  1VQN Z;  3FKI I;  2OZK A;  4RVG A;  1WW9 A;  2E9H A;  1K9M 1;  3CCS Z;  3J80 f;  5C3E I;  1JJ2 Y;  1DL6 A;  3JAM f;  3HOU I;  3TDH B;  1NJI 1;  3GCF A;  4NB9 A;  3VB9 A;  1VQO Z;  1Q81 1;  3S16 I;  2JIM A;  2QRC B;  2VPW A;  1M1K 1;  4A3G I;  1Q82 1;  4A3B I;  3NFZ A;  3CC2 Z;  2R7Z I;  1S72 1;  1RO4 A;  1USP A;  1YHQ Z;  5D1O A;  1VQ7 1;  2NAP A;  1N8R 1;  3I55 1;  2JIP A;  1VQM Z;  1KD1 1;  5A2Q f;  1NP6 A;  2PMZ A;  3CCM Z;  4A3E I;  2NVQ I;  1K73 1;  4DQY B;  3CPW Z;  3CMA Z;  1KQS Z;  3F3P C;  1K83 I;  3EED A;  1K8A 2;  4MH4 A;  3G6E 1;  1VQL 1;  2F4M A;  4NFR A;  2Q4Z A;  1VQP 1;  3G71 Z;  2J6A A;  3CCU Z;  5IP9 I;  2VPX A;  3CCJ Z;  2H85 A;  1X0T A;  1TWH I;  2JA8 I;  1KC8 1;  2OTJ 1;  1VQN 1;  4NH1 C;  4A3L I;  4MD8 A;  3HKZ A;  3CCS 1;  5C44 I;  2NVT I;  1TWF I;  4HGZ A;  3CC4 1;  3H3V J;  4BBS I;  1SIW A;  5A2Q b;  4NBF A;  1VQO 1;  2JMO A;  3H0G I;  1RNI A;  2V8J A;  4X6A I;  1Q86 1;  3GTK I;  3LUS A;  4DK1 A;  3P5J B;  2JIO A;  3CC2 1;  1YHQ 1;  3I56 Z;  3FQQ A;  3NDJ A;  1VQM 1;  1QVG Y;  3NH5 A;  3S2D I;  1YIT Z;  2RHB A;  1I6H I;  2K5R A;  2QA4 Z;  1Q7Y 2;  2OOY B;  3VTN A;  3G4S 1;  4MD7 A;  3CCM 1;  2QKD A;  2JUB A;  1Z02 A;  1USP B;  3IR7 A;  3CC7 1;  1Y1V S;  3GKQ A;  3CMA 1;  1JJ2 Z;  1ZB8 A;  4QTT A;  1WCM I;  1SFO I;  5FLX b;  2P3Y A;  3G71 1;  3CCU 1;  3D6W A;  2Q51 A;  3CCJ 1;  4Y52 I;  1QVF Y;  1ML8 A;  2Y0S A;  2JA6 I;  5LL6 f;  2LIY A;  1Y8C A;  1TWC I;  3RZO I;  2E2J I;  3BG1 B;  1ZB9 A;  2RBL A;  5IT9 f;  5CM2 M;  1AA6 A;  1Z03 A;  4BBR I;  3CC4 Z;  2QLV B;  1FDO A;  3GTJ I;  3GTG I;  3S1N I;  5T6B A;  2OTL Z;  4NBB A;  4BY7 I;  2JIR A;  2E2H I;  4NBD A;  3CCQ Z;  3GTM S;  3M3Y I;  1Y1V I;  1VQK 1;  1I3Q I;  3I56 1; 
#chains in the Genus database with same CATH homology
 1K9M 2;  1YIT 1;  2JA5 I;  3G4S Z;  2QA4 1;  4TNU A;  1NUI A;  1NJI 2;  1YJ9 Z;  3CC7 Z;  2IZ4 A;  1Q81 2;  3I4N I;  3K7A I;  2YU9 I;  2YAD A;  1M1K 2;  1S7M A;  1Q82 2;  5AN9 F;  3D9X A;  2QRD B;  3M4O I;  3J80 b;  5IT9 b;  1Z01 A;  1M90 1;  1N8R 2;  3JAM b;  1W2B Y;  1KD1 2;  2W04 A;  4E2Z A;  4E31 A;  3VMG A;  3Q87 A;  4MRI A;  1L1O C;  4E2X A;  4A93 I;  3VMH A;  3GTM I;  1ZH1 A;  4A3F I;  3NH8 A;  2PM9 A;  2RIQ A;  1QVG Z;  1K73 2;  1RLY A;  2HF1 A;  2DE6 A;  4E32 A;  1YI2 Z;  2AKL A;  3S1M I;  3J81 f;  4A3M I;  2V8K A;  3CCR Z;  3IFU A;  2GTH A;  2VUM I;  2JR6 A;  2JNY A;  4RVF A;  2V8I A;  3CME Z;  1RO2 A;  2OTL 1;  3MON A;  4RVH A;  3CCQ 1;  3CPW Y;  2O4H A;  3HOY I;  1VQK Z;  1KC8 2;  4NOZ A;  1KQS Y;  3U50 C;  3IX0 A;  3CXC Y;  1WII A;  1YJN 1;  3S2H I;  1VQ9 Z;  2PK7 A;  2OOX B;  1YJ9 1;  3TE5 B;  3S1Q I;  2JS4 A;  1RQF A;  4MON A;  1Q86 2;  4NBH A;  2I3C A;  1VQ8 Z;  1X3W A;  2NVY I;  2GU2 A;  3IF8 A;  4RV9 A;  3EER A;  1VQ6 Z;  3OW2 Y;  4HGY A;  2VUG A;  1P9N A;  5D1P A;  3KIF A;  3S17 I;  1YI2 1;  4EWC A;  2QR1 B;  2IZ3 A;  4NBE A;  4NB8 A;  4NBG A;  1YIJ Z;  3CCR 1;  3VMI A;  3CCV Z;  1QYP A;  4E2Y A;  3PO3 S;  3BG0 B;  4E33 A;  2R93 I;  2LFU A;  3GTP I;  2W03 A;  5C4J I;  3CME 1;  2VF1 A;  3MZL B;  1I50 I;  4E30 A;  3FQM A;  2KI7 B;  3CD6 1;  1PFT A;  2HU9 A;  1KRL A;  4MXU A;  4A3C I;  1Y1W I;  3PO2 I;  1W2B Z;  2QEX Z;  1TFI A;  1YJN Z;  2QRE B;  1VQ4 Z;  3T4N B;  4A3D I;  3ESW A;  1VQ9 1;  1VLA A;  1K8A 1;  2BJO A;  2R6M A;  2RPR A;  2NVX I;  3HOW I;  4A3J I;  3S15 I;  1RO0 A;  1YUA A;  1YJW Z;  2RT9 A;  4AYB A;  4HH4 A;  1JWH C;  1VQ8 1;  2R92 I;  4NBC A;  4E2W A;  3CCL Z;  2WAQ A;  5IP7 I;  3PO3 I;  3CCE Z;  1VQ6 1;  1QF8 A;  4BXX I;  3CQZ I;  3CXC Z;  3MZK B;  4BY1 I;  2ZAE B;  4XX2 A;  2GTI A;  3HOZ I;  4NBA A;  3S14 I;  1VQ5 1;  1YIJ 1;  1YUK A;  2F4O A;  3NDI A;  3CCV 1;  3HOX I;  2M48 A;  3QWU A;  1M90 2;  2JA7 I;  4Y7N I;  3CD6 Z;  5FLM I;  4QTU A;  3HOV I;  2K3R A;  5FLX f;  1Q7Y 1;  3F3F C;  2B63 I;  2G2K A;  2DE7 A;  2QEX 1;  3GTL I;  3I4M I;  1QVF Z;  3OW2 Z;  1VQ4 1;  5T67 A;  2M6N A;  4A3I I;  1TWA I;  1S72 Z;  1R9T I;  2WB1 A;  3S1R I;  1VQ7 Z;  2E2I I;  3I07 A;  3I55 Z;  2DE5 A;  1YJW 1;  4DGL A;  1TWG I;  3J81 b;  3CCL 1;  3J7A 4;  1N2F A;  2EGT A;  2KPI A;  4A3K I;  3CCE 1;  1X3Z A;  5C4X I;  3RZD I;  5D1O B;  4S1T A;  3G6E Z;  3NH4 A;  2O53 A;  1VQL Z;  4MD9 A;  3GTO I;  1LQL A;  4CL1 A;  1VQP Z;  1VQ5 Z;  4RS4 A;  3KIH A;  3GTQ I;  2P28 A;  5T64 A;  2OTJ Z;  4RVD A;  1VQN Z;  3FKI I;  2OZK A;  4RVG A;  1WW9 A;  2E9H A;  1K9M 1;  3CCS Z;  3J80 f;  5C3E I;  1JJ2 Y;  1DL6 A;  3JAM f;  3HOU I;  3TDH B;  1NJI 1;  3GCF A;  4NB9 A;  3VB9 A;  1VQO Z;  1Q81 1;  3S16 I;  2QRC B;  1M1K 1;  4A3G I;  1Q82 1;  4A3B I;  3NFZ A;  3CC2 Z;  2R7Z I;  1S72 1;  1RO4 A;  1USP A;  1YHQ Z;  5D1O A;  1VQ7 1;  1N8R 1;  3I55 1;  1VQM Z;  1KD1 1;  5A2Q f;  1NP6 A;  2PMZ A;  3CCM Z;  4A3E I;  2NVQ I;  1K73 1;  4DQY B;  3CPW Z;  3CMA Z;  1KQS Z;  3F3P C;  1K83 I;  3EED A;  1K8A 2;  4MH4 A;  3G6E 1;  1VQL 1;  2F4M A;  4NFR A;  2Q4Z A;  1VQP 1;  3G71 Z;  2J6A A;  3CCU Z;  5IP9 I;  3CCJ Z;  2H85 A;  1X0T A;  1TWH I;  2JA8 I;  1KC8 1;  2OTJ 1;  1VQN 1;  4NH1 C;  4A3L I;  4MD8 A;  3HKZ A;  3CCS 1;  5C44 I;  2NVT I;  1TWF I;  4HGZ A;  3CC4 1;  3H3V J;  4BBS I;  5A2Q b;  4NBF A;  1VQO 1;  2JMO A;  3H0G I;  1RNI A;  2V8J A;  4X6A I;  1Q86 1;  3GTK I;  3LUS A;  4DK1 A;  3P5J B;  3CC2 1;  1YHQ 1;  3I56 Z;  3FQQ A;  3NDJ A;  1VQM 1;  1QVG Y;  3NH5 A;  3S2D I;  1YIT Z;  2RHB A;  1I6H I;  2K5R A;  2QA4 Z;  1Q7Y 2;  2OOY B;  3VTN A;  3G4S 1;  4MD7 A;  3CCM 1;  2QKD A;  2JUB A;  1Z02 A;  1USP B;  3CC7 1;  1Y1V S;  3GKQ A;  3CMA 1;  1JJ2 Z;  1ZB8 A;  4QTT A;  1WCM I;  1SFO I;  5FLX b;  2P3Y A;  3G71 1;  3CCU 1;  3D6W A;  2Q51 A;  3CCJ 1;  4Y52 I;  1QVF Y;  1ML8 A;  2Y0S A;  2JA6 I;  5LL6 f;  2LIY A;  1TWC I;  3RZO I;  2E2J I;  3BG1 B;  1ZB9 A;  2RBL A;  5IT9 f;  5CM2 M;  1Z03 A;  4BBR I;  3CC4 Z;  2QLV B;  3GTJ I;  3GTG I;  3S1N I;  5T6B A;  2OTL Z;  4NBB A;  4BY7 I;  2E2H I;  4NBD A;  3CCQ Z;  3GTM S;  3M3Y I;  1Y1V I;  1VQK 1;  1I3Q I;  3I56 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...