2M48A

Solution structure of ibr-ring2 tandem domain from parkin
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
141
structure length
141
Chain Sequence
EEYVLQAGGVLCPQPGCGMGLLVEPDCRKVTCQNGCGYVFCRNCLQGYHIGECLPEGTGASATNSCEYTVDPNRAAEARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEWTRDCMGAHWFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE PARKIN
publication title A molecular explanation for the recessive nature of parkin-linked Parkinson's disease.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 7
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01485 IBR IBR domain, a half RING-finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2m48A01
4MD8A 4MD9A 4MD7A 4NH1C 2JMOA 2R6MA 2M48A 4DGLA 3EEDA 2M6NA 1JWHC 2RT9A 1RQFA 1QF8A
chains in the Genus database with same CATH superfamily
1YJNZ 3S1NI 2DE6A 3U50C 5T64A 3CMEZ 1RO4A 1VQ41 1Q16A 2VUGA 3CC4Z 2LFUA 3TDHB 3I561 3G4SZ 3NFZA 3PO2I 2VPWA 1I50I 2WAQA 2AYDA 2RIQA 1YIJZ 2O53A 2V3VA 1WCMI 3CXCY 1ZH1A 3NH5A 1YITZ 1TWCI 2E2JI 2NAPA 5LL6f 3LUSA 4E2WA 2GU2A 1K83I 3HOVI 5C4XI 3G6EZ 4E2YA 5FLMI 3GTPI 2YU9I 1RQFA 2PK7A 1M1K1 2JIMA 3KIHA 4TNUA 1TWGI 1VQO1 3CCVZ 4E2ZA 1ML8A 2JIOA 3GTLI 1QVGY 3I07A 2HF1A 3CME1 4DGLA 1Y1WI 1Q822 3CC41 2QREB 3FQMA 1VQ5Z 2V8IA 3F3PC 3BG0B 1VQ8Z 4A3DI 2IZ4A 4BBSI 3MONA 3ESWA 3IR7A 3S16I 1Z02A 2JNYA 1NP6A 1YIT1 2R6MA 1ZB9A 3KIFA 4AYBA 2R92I 1QVFZ 3FKII 1YJWZ 4RS4A 4MXUA 1X3ZA 2WB1A 3J7A4 1Y1VS 4NH1C 3S17I 3IFUA 5C4JI 5IT9b 3CPWZ 1YUAA 3CC7Z 1KD11 3T4NB 1Q821 4Y7NI 3CCV1 1FDOA 3EERA 1W2BZ 3CQZI 2DE7A 3CMA1 1I3QI 3BG1B 4S1TA 1VQ81 3CCUZ 1QF8A 2LEXA 1RO0A 4BXXI 2OZKA 4NFRA 3PO3S 4A93I 4DK1A 2JMOA 1YHQZ 3HOYI 2P3YA 2OTJZ 3S1MI 2OOYB 4A3FI 3HKZA 2K5RA 1I6HI 2QEXZ 1VQOZ 1TWFI 1QVFY 1X3WA 2EGTA 1FDIA 3F3FC 4A3LI 2M6NA 3CC71 2O4HA 4NB9A 2IZ3A 2NVYI 2QKDA 5IT9f 1VQ9Z 1K8A2 2QLVB 3H0GI 3I4MI 3D6WA 3CPWY 3GTQI 4NBGA 4CL1A 3CCU1 1W2BY 2I3CA 1KC82 1KRLA 5C3EI 4MH4A 1YHQ1 2VF1A 3TE5B 2OTJ1 5D1OB 3GTGI 3NDIA 3CCL1 2RHBA 2RBLA 4A3II 1VQP1 1VLAA 2JIQA 3PO3I 3RZDI 2QEX1 4NBFA 4NB8A 2VPYA 1JJ2Y 1RNIA 3S1RI 4RVGA 3CMAZ 2DE5A 1YI2Z 2IV2X 2H85A 1VQ91 4RVHA 2QA4Z 3RZOI 4E31A 5IP7I 4RV9A 5FLXb 5T67A 1KC81 1Z03A 1WJ2A 1RLYA 1YJ9Z 2VPXA 4NOZA 1L1OC 4NBDA 2GTIA 2W04A 2R7ZI 4A3MI 2NVQI 2V8KA 1K732 2E2HI 1Q7Y2 1NJI2 3FQQA 1SIWA 1VQ6Z 3VMHA 1VQN1 5D1OA 1K9M2 2OOXB 1S7MA 1Z01A 1YUKA 3CD6Z 3CCJ1 2VUMI 3GCFA 2Y0SA 2RT9A 3Q87A 4MD9A 1YI21 3CCM1 2R93I 4QTUA 2QA41 4A3BI 4E2XA 3NH8A 3CCSZ 3S2HI 2KPIA 4X6AI 1AA6A 4A3KI 1TWAI 3JAMf 2OTL1 1YJ91 5FLXf 3CCRZ 1TFIA 2HU9A 3J80b 1NJI1 3CCLZ 3I4NI 1VQPZ 3VMGA 2AKLA 1WZNA 1QYPA 2Q4ZA 1VQKZ 1VQ61 2Q51A 5A2Qb 1K9M1 1TWHI 2G2KA 1Y8CA 2JA5I 4MONA 4NBBA 1WIIA 5D1PA 3GTKI 2JA7I 2JIPA 3IF8A 2W03A 3CD61 1Y1VI 2K3RA 3GTJI 3D2LA 1KQSZ 2B63I 3CC21 2BJOA 4A3GI 1WW9A 3I551 1M1K2 2E2II 3CCS1 2V8JA 4A3CI 3S15I 2M48A 3P5JB 4BY7I 2PMZA 2ZAEB 2QRDB 3CCR1 3S1QI 3IX0A 1M902 4E33A 2JR6A 4XX2A 1Q862 1P9NA 2J6AA 2LIYA 4RVFA 2JA6I 3J80f 1VQNZ 2JIRA 1VQK1 2PM9A 3NDJA 3CCJZ 2JUBA 3NH4A 1K8A1 1S72Z 5T6BA 5A2Qf 3CCQZ 1VQ71 4NBEA 3CCE1 1VQMZ 3CCMZ 1VQL1 1Q812 4MRIA 2F4OA 4A3JI 3JAMb 3GTMS 1N8R2 3OW2Z 2JA8I 3D9XA 2E9HA 3K7AI 1YJN1 2OTLZ 3G71Z 3GKQA 1KD12 1SFOI 1KQSY 1M901 1USPB 3VMIA 1X0TA 1Q861 3G4S1 3M3YI 3HOWI 1NUIA 2YADA 2RPRA 1LQLA 3MZLB 1RO2A 1YIJ1 5CM2M 4Y52I 5IP9I 3MZKB 4NBAA 3EEDA 2QRCB 4BBRI 4E32A 1ZB8A 4QTTA 4HH4A 3J81b 3VB9A 3VTNA 4DQYB 1Q811 1S721 3CCQ1 3G6E1 3CC2Z 1N8R1 1VQM1 3M4OI 3GTOI 3I55Z 4NBHA 2QR1B 1VQ4Z 1N2FA 2GTHA 1QXFA 3CXCZ 3I56Z 1R9TI 3S2DI 2NVXI 3G711 1K731 1Q7Y1 2KI7B 3GTMI 3OW2Y 2F4MA 1VQ51 3HOXI 1PFTA 4MD8A 4HGYA 1DL6A 2NVTI 1USPA 4MD7A 4E30A 4NBCA 4HGZA 2V45A 2E7ZA 3S14I 5C44I 2VPZA 1VQ7Z 3CCEZ 4EWCA 1JWHC 1YJW1 3QWUA 2P28A 1VQLZ 1JJ2Z 1QVGZ 3HOUI 3H3VJ 4A3EI 4BY1I 2JS4A 5AN9F 3J81f 4RVDA 3HOZI
chains in the Genus database with same CATH topology
1YJNZ 3S1NI 2DE6A 3U50C 5T64A 3CMEZ 1RO4A 1VQ41 2VUGA 3CC4Z 2LFUA 3TDHB 3I561 3G4SZ 3NFZA 3PO2I 2WAQA 1I50I 2RIQA 1YIJZ 2O53A 1WCMI 3CXCY 1ZH1A 3NH5A 1YITZ 1TWCI 2E2JI 5LL6f 3LUSA 4E2WA 2GU2A 1K83I 3HOVI 5C4XI 3G6EZ 4E2YA 5FLMI 3GTPI 2YU9I 1RQFA 2PK7A 1M1K1 3KIHA 4TNUA 1TWGI 1VQO1 3CCVZ 4E2ZA 1ML8A 3GTLI 1QVGY 3I07A 2HF1A 3CME1 4DGLA 1Y1WI 1Q822 3CC41 2QREB 3FQMA 1VQ5Z 2V8IA 3F3PC 3BG0B 1VQ8Z 4A3DI 2IZ4A 4BBSI 3MONA 3ESWA 3S16I 1Z02A 2JNYA 1NP6A 1YIT1 2R6MA 1ZB9A 3KIFA 4AYBA 2R92I 1QVFZ 3FKII 1YJWZ 4RS4A 4MXUA 1X3ZA 2WB1A 3J7A4 1Y1VS 4NH1C 3S17I 3IFUA 5C4JI 5IT9b 3CPWZ 1YUAA 3CC7Z 1KD11 3T4NB 1Q821 4Y7NI 3CCV1 3EERA 1W2BZ 3CQZI 2DE7A 3CMA1 1I3QI 3BG1B 4S1TA 1VQ81 3CCUZ 1QF8A 1RO0A 4BXXI 2OZKA 4NFRA 3PO3S 4A93I 4DK1A 2JMOA 1YHQZ 3HOYI 2P3YA 2OTJZ 3S1MI 2OOYB 4A3FI 3HKZA 2K5RA 1I6HI 2QEXZ 1VQOZ 1TWFI 1QVFY 1X3WA 2EGTA 3F3FC 4A3LI 2M6NA 3CC71 2O4HA 4NB9A 2IZ3A 2NVYI 2QKDA 5IT9f 1VQ9Z 1K8A2 2QLVB 3H0GI 3I4MI 3D6WA 3CPWY 3GTQI 4NBGA 4CL1A 3CCU1 1W2BY 2I3CA 1KC82 1KRLA 5C3EI 4MH4A 1YHQ1 2VF1A 3TE5B 2OTJ1 5D1OB 3GTGI 3NDIA 3CCL1 2RHBA 2RBLA 4A3II 1VQP1 1VLAA 3PO3I 3RZDI 2QEX1 4NBFA 4NB8A 1JJ2Y 1RNIA 3S1RI 4RVGA 3CMAZ 2DE5A 1YI2Z 2H85A 1VQ91 4RVHA 2QA4Z 3RZOI 4E31A 5IP7I 4RV9A 5FLXb 5T67A 1KC81 1Z03A 1RLYA 1YJ9Z 4NOZA 1L1OC 4NBDA 2GTIA 2W04A 2R7ZI 4A3MI 2NVQI 2V8KA 1K732 2E2HI 1Q7Y2 1NJI2 3FQQA 1VQ6Z 3VMHA 1VQN1 5D1OA 1K9M2 2OOXB 1S7MA 1Z01A 1YUKA 3CD6Z 3CCJ1 2VUMI 3GCFA 2Y0SA 2RT9A 3Q87A 4MD9A 1YI21 3CCM1 2R93I 4QTUA 2QA41 4A3BI 4E2XA 3NH8A 3CCSZ 3S2HI 2KPIA 4X6AI 4A3KI 1TWAI 3JAMf 2OTL1 1YJ91 5FLXf 3CCRZ 1TFIA 2HU9A 3J80b 1NJI1 3CCLZ 3I4NI 1VQPZ 3VMGA 2AKLA 1QYPA 2Q4ZA 1VQKZ 1VQ61 2Q51A 5A2Qb 1K9M1 1TWHI 2G2KA 2JA5I 4MONA 4NBBA 1WIIA 5D1PA 3GTKI 2JA7I 3IF8A 2W03A 3CD61 1Y1VI 2K3RA 3GTJI 1KQSZ 2B63I 3CC21 2BJOA 4A3GI 1WW9A 3I551 1M1K2 2E2II 3CCS1 2V8JA 4A3CI 3S15I 2M48A 3P5JB 4BY7I 2PMZA 2ZAEB 2QRDB 3CCR1 3S1QI 3IX0A 1M902 4E33A 2JR6A 4XX2A 1Q862 1P9NA 2J6AA 2LIYA 4RVFA 2JA6I 3J80f 1VQNZ 1VQK1 2PM9A 3NDJA 3CCJZ 2JUBA 3NH4A 1K8A1 1S72Z 5T6BA 5A2Qf 3CCQZ 1VQ71 4NBEA 3CCE1 1VQMZ 3CCMZ 1VQL1 1Q812 4MRIA 2F4OA 4A3JI 3JAMb 3GTMS 1N8R2 3OW2Z 2JA8I 3D9XA 2E9HA 3K7AI 1YJN1 2OTLZ 3G71Z 3GKQA 1KD12 1SFOI 1KQSY 1M901 1USPB 3VMIA 1X0TA 1Q861 3G4S1 3M3YI 3HOWI 1NUIA 2YADA 2RPRA 1LQLA 3MZLB 1RO2A 1YIJ1 5CM2M 4Y52I 5IP9I 3MZKB 4NBAA 3EEDA 2QRCB 4BBRI 4E32A 1ZB8A 4QTTA 4HH4A 3J81b 3VB9A 3VTNA 4DQYB 1Q811 1S721 3CCQ1 3G6E1 3CC2Z 1N8R1 1VQM1 3M4OI 3GTOI 3I55Z 4NBHA 2QR1B 1VQ4Z 1N2FA 2GTHA 3CXCZ 3I56Z 1R9TI 3S2DI 2NVXI 3G711 1K731 1Q7Y1 2KI7B 3GTMI 3OW2Y 2F4MA 1VQ51 3HOXI 1PFTA 4MD8A 4HGYA 1DL6A 2NVTI 1USPA 4MD7A 4E30A 4NBCA 4HGZA 3S14I 5C44I 1VQ7Z 3CCEZ 4EWCA 1JWHC 1YJW1 3QWUA 2P28A 1VQLZ 1JJ2Z 1QVGZ 3HOUI 3H3VJ 4A3EI 4BY1I 2JS4A 5AN9F 3J81f 4RVDA 3HOZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD8 A;  4MD9 A;  4MD7 A;  4NH1 C;  2JMO A;  2R6M A;  2M48 A;  4DGL A;  3EED A;  2M6N A;  1JWH C;  2RT9 A;  1RQF A;  1QF8 A; 
#chains in the Genus database with same CATH topology
 1YJN Z;  3S1N I;  2DE6 A;  3U50 C;  5T64 A;  3CME Z;  1RO4 A;  1VQ4 1;  1Q16 A;  2VUG A;  3CC4 Z;  2LFU A;  3TDH B;  3I56 1;  3G4S Z;  3NFZ A;  3PO2 I;  2VPW A;  1I50 I;  2WAQ A;  2AYD A;  2RIQ A;  1YIJ Z;  2O53 A;  2V3V A;  1WCM I;  3CXC Y;  1ZH1 A;  3NH5 A;  1YIT Z;  1TWC I;  2E2J I;  2NAP A;  5LL6 f;  3LUS A;  4E2W A;  2GU2 A;  1K83 I;  3HOV I;  5C4X I;  3G6E Z;  4E2Y A;  5FLM I;  3GTP I;  2YU9 I;  1RQF A;  2PK7 A;  1M1K 1;  2JIM A;  3KIH A;  4TNU A;  1TWG I;  1VQO 1;  3CCV Z;  4E2Z A;  1ML8 A;  2JIO A;  3GTL I;  1QVG Y;  3I07 A;  2HF1 A;  3CME 1;  4DGL A;  1Y1W I;  1Q82 2;  3CC4 1;  2QRE B;  3FQM A;  1VQ5 Z;  2V8I A;  3F3P C;  3BG0 B;  1VQ8 Z;  4A3D I;  2IZ4 A;  4BBS I;  3MON A;  3ESW A;  3IR7 A;  3S16 I;  1Z02 A;  2JNY A;  1NP6 A;  1YIT 1;  2R6M A;  1ZB9 A;  3KIF A;  4AYB A;  2R92 I;  1QVF Z;  3FKI I;  1YJW Z;  4RS4 A;  4MXU A;  1X3Z A;  2WB1 A;  3J7A 4;  1Y1V S;  4NH1 C;  3S17 I;  3IFU A;  5C4J I;  5IT9 b;  3CPW Z;  1YUA A;  3CC7 Z;  1KD1 1;  3T4N B;  1Q82 1;  4Y7N I;  3CCV 1;  1FDO A;  3EER A;  1W2B Z;  3CQZ I;  2DE7 A;  3CMA 1;  1I3Q I;  3BG1 B;  4S1T A;  1VQ8 1;  3CCU Z;  1QF8 A;  2LEX A;  1RO0 A;  4BXX I;  2OZK A;  4NFR A;  3PO3 S;  4A93 I;  4DK1 A;  2JMO A;  1YHQ Z;  3HOY I;  2P3Y A;  2OTJ Z;  3S1M I;  2OOY B;  4A3F I;  3HKZ A;  2K5R A;  1I6H I;  2QEX Z;  1VQO Z;  1TWF I;  1QVF Y;  1X3W A;  2EGT A;  1FDI A;  3F3F C;  4A3L I;  2M6N A;  3CC7 1;  2O4H A;  4NB9 A;  2IZ3 A;  2NVY I;  2QKD A;  5IT9 f;  1VQ9 Z;  1K8A 2;  2QLV B;  3H0G I;  3I4M I;  3D6W A;  3CPW Y;  3GTQ I;  4NBG A;  4CL1 A;  3CCU 1;  1W2B Y;  2I3C A;  1KC8 2;  1KRL A;  5C3E I;  4MH4 A;  1YHQ 1;  2VF1 A;  3TE5 B;  2OTJ 1;  5D1O B;  3GTG I;  3NDI A;  3CCL 1;  2RHB A;  2RBL A;  4A3I I;  1VQP 1;  1VLA A;  2JIQ A;  3PO3 I;  3RZD I;  2QEX 1;  4NBF A;  4NB8 A;  2VPY A;  1JJ2 Y;  1RNI A;  3S1R I;  4RVG A;  3CMA Z;  2DE5 A;  1YI2 Z;  2IV2 X;  2H85 A;  1VQ9 1;  4RVH A;  2QA4 Z;  3RZO I;  4E31 A;  5IP7 I;  4RV9 A;  5FLX b;  5T67 A;  1KC8 1;  1Z03 A;  1WJ2 A;  1RLY A;  1YJ9 Z;  2VPX A;  4NOZ A;  1L1O C;  4NBD A;  2GTI A;  2W04 A;  2R7Z I;  4A3M I;  2NVQ I;  2V8K A;  1K73 2;  2E2H I;  1Q7Y 2;  1NJI 2;  3FQQ A;  1SIW A;  1VQ6 Z;  3VMH A;  1VQN 1;  5D1O A;  1K9M 2;  2OOX B;  1S7M A;  1Z01 A;  1YUK A;  3CD6 Z;  3CCJ 1;  2VUM I;  3GCF A;  2Y0S A;  2RT9 A;  3Q87 A;  4MD9 A;  1YI2 1;  3CCM 1;  2R93 I;  4QTU A;  2QA4 1;  4A3B I;  4E2X A;  3NH8 A;  3CCS Z;  3S2H I;  2KPI A;  4X6A I;  1AA6 A;  4A3K I;  1TWA I;  3JAM f;  2OTL 1;  1YJ9 1;  5FLX f;  3CCR Z;  1TFI A;  2HU9 A;  3J80 b;  1NJI 1;  3CCL Z;  3I4N I;  1VQP Z;  3VMG A;  2AKL A;  1WZN A;  1QYP A;  2Q4Z A;  1VQK Z;  1VQ6 1;  2Q51 A;  5A2Q b;  1K9M 1;  1TWH I;  2G2K A;  1Y8C A;  2JA5 I;  4MON A;  4NBB A;  1WII A;  5D1P A;  3GTK I;  2JA7 I;  2JIP A;  3IF8 A;  2W03 A;  3CD6 1;  1Y1V I;  2K3R A;  3GTJ I;  3D2L A;  1KQS Z;  2B63 I;  3CC2 1;  2BJO A;  4A3G I;  1WW9 A;  3I55 1;  1M1K 2;  2E2I I;  3CCS 1;  2V8J A;  4A3C I;  3S15 I;  2M48 A;  3P5J B;  4BY7 I;  2PMZ A;  2ZAE B;  2QRD B;  3CCR 1;  3S1Q I;  3IX0 A;  1M90 2;  4E33 A;  2JR6 A;  4XX2 A;  1Q86 2;  1P9N A;  2J6A A;  2LIY A;  4RVF A;  2JA6 I;  3J80 f;  1VQN Z;  2JIR A;  1VQK 1;  2PM9 A;  3NDJ A;  3CCJ Z;  2JUB A;  3NH4 A;  1K8A 1;  1S72 Z;  5T6B A;  5A2Q f;  3CCQ Z;  1VQ7 1;  4NBE A;  3CCE 1;  1VQM Z;  3CCM Z;  1VQL 1;  1Q81 2;  4MRI A;  2F4O A;  4A3J I;  3JAM b;  3GTM S;  1N8R 2;  3OW2 Z;  2JA8 I;  3D9X A;  2E9H A;  3K7A I;  1YJN 1;  2OTL Z;  3G71 Z;  3GKQ A;  1KD1 2;  1SFO I;  1KQS Y;  1M90 1;  1USP B;  3VMI A;  1X0T A;  1Q86 1;  3G4S 1;  3M3Y I;  3HOW I;  1NUI A;  2YAD A;  2RPR A;  1LQL A;  3MZL B;  1RO2 A;  1YIJ 1;  5CM2 M;  4Y52 I;  5IP9 I;  3MZK B;  4NBA A;  3EED A;  2QRC B;  4BBR I;  4E32 A;  1ZB8 A;  4QTT A;  4HH4 A;  3J81 b;  3VB9 A;  3VTN A;  4DQY B;  1Q81 1;  1S72 1;  3CCQ 1;  3G6E 1;  3CC2 Z;  1N8R 1;  1VQM 1;  3M4O I;  3GTO I;  3I55 Z;  4NBH A;  2QR1 B;  1VQ4 Z;  1N2F A;  2GTH A;  1QXF A;  3CXC Z;  3I56 Z;  1R9T I;  3S2D I;  2NVX I;  3G71 1;  1K73 1;  1Q7Y 1;  2KI7 B;  3GTM I;  3OW2 Y;  2F4M A;  1VQ5 1;  3HOX I;  1PFT A;  4MD8 A;  4HGY A;  1DL6 A;  2NVT I;  1USP A;  4MD7 A;  4E30 A;  4NBC A;  4HGZ A;  2V45 A;  2E7Z A;  3S14 I;  5C44 I;  2VPZ A;  1VQ7 Z;  3CCE Z;  4EWC A;  1JWH C;  1YJW 1;  3QWU A;  2P28 A;  1VQL Z;  1JJ2 Z;  1QVG Z;  3HOU I;  3H3V J;  4A3E I;  4BY1 I;  2JS4 A;  5AN9 F;  3J81 f;  4RVD A;  3HOZ I; 
#chains in the Genus database with same CATH homology
 1YJN Z;  3S1N I;  2DE6 A;  3U50 C;  5T64 A;  3CME Z;  1RO4 A;  1VQ4 1;  2VUG A;  3CC4 Z;  2LFU A;  3TDH B;  3I56 1;  3G4S Z;  3NFZ A;  3PO2 I;  2WAQ A;  1I50 I;  2RIQ A;  1YIJ Z;  2O53 A;  1WCM I;  3CXC Y;  1ZH1 A;  3NH5 A;  1YIT Z;  1TWC I;  2E2J I;  5LL6 f;  3LUS A;  4E2W A;  2GU2 A;  1K83 I;  3HOV I;  5C4X I;  3G6E Z;  4E2Y A;  5FLM I;  3GTP I;  2YU9 I;  1RQF A;  2PK7 A;  1M1K 1;  3KIH A;  4TNU A;  1TWG I;  1VQO 1;  3CCV Z;  4E2Z A;  1ML8 A;  3GTL I;  1QVG Y;  3I07 A;  2HF1 A;  3CME 1;  4DGL A;  1Y1W I;  1Q82 2;  3CC4 1;  2QRE B;  3FQM A;  1VQ5 Z;  2V8I A;  3F3P C;  3BG0 B;  1VQ8 Z;  4A3D I;  2IZ4 A;  4BBS I;  3MON A;  3ESW A;  3S16 I;  1Z02 A;  2JNY A;  1NP6 A;  1YIT 1;  2R6M A;  1ZB9 A;  3KIF A;  4AYB A;  2R92 I;  1QVF Z;  3FKI I;  1YJW Z;  4RS4 A;  4MXU A;  1X3Z A;  2WB1 A;  3J7A 4;  1Y1V S;  4NH1 C;  3S17 I;  3IFU A;  5C4J I;  5IT9 b;  3CPW Z;  1YUA A;  3CC7 Z;  1KD1 1;  3T4N B;  1Q82 1;  4Y7N I;  3CCV 1;  3EER A;  1W2B Z;  3CQZ I;  2DE7 A;  3CMA 1;  1I3Q I;  3BG1 B;  4S1T A;  1VQ8 1;  3CCU Z;  1QF8 A;  1RO0 A;  4BXX I;  2OZK A;  4NFR A;  3PO3 S;  4A93 I;  4DK1 A;  2JMO A;  1YHQ Z;  3HOY I;  2P3Y A;  2OTJ Z;  3S1M I;  2OOY B;  4A3F I;  3HKZ A;  2K5R A;  1I6H I;  2QEX Z;  1VQO Z;  1TWF I;  1QVF Y;  1X3W A;  2EGT A;  3F3F C;  4A3L I;  2M6N A;  3CC7 1;  2O4H A;  4NB9 A;  2IZ3 A;  2NVY I;  2QKD A;  5IT9 f;  1VQ9 Z;  1K8A 2;  2QLV B;  3H0G I;  3I4M I;  3D6W A;  3CPW Y;  3GTQ I;  4NBG A;  4CL1 A;  3CCU 1;  1W2B Y;  2I3C A;  1KC8 2;  1KRL A;  5C3E I;  4MH4 A;  1YHQ 1;  2VF1 A;  3TE5 B;  2OTJ 1;  5D1O B;  3GTG I;  3NDI A;  3CCL 1;  2RHB A;  2RBL A;  4A3I I;  1VQP 1;  1VLA A;  3PO3 I;  3RZD I;  2QEX 1;  4NBF A;  4NB8 A;  1JJ2 Y;  1RNI A;  3S1R I;  4RVG A;  3CMA Z;  2DE5 A;  1YI2 Z;  2H85 A;  1VQ9 1;  4RVH A;  2QA4 Z;  3RZO I;  4E31 A;  5IP7 I;  4RV9 A;  5FLX b;  5T67 A;  1KC8 1;  1Z03 A;  1RLY A;  1YJ9 Z;  4NOZ A;  1L1O C;  4NBD A;  2GTI A;  2W04 A;  2R7Z I;  4A3M I;  2NVQ I;  2V8K A;  1K73 2;  2E2H I;  1Q7Y 2;  1NJI 2;  3FQQ A;  1VQ6 Z;  3VMH A;  1VQN 1;  5D1O A;  1K9M 2;  2OOX B;  1S7M A;  1Z01 A;  1YUK A;  3CD6 Z;  3CCJ 1;  2VUM I;  3GCF A;  2Y0S A;  2RT9 A;  3Q87 A;  4MD9 A;  1YI2 1;  3CCM 1;  2R93 I;  4QTU A;  2QA4 1;  4A3B I;  4E2X A;  3NH8 A;  3CCS Z;  3S2H I;  2KPI A;  4X6A I;  4A3K I;  1TWA I;  3JAM f;  2OTL 1;  1YJ9 1;  5FLX f;  3CCR Z;  1TFI A;  2HU9 A;  3J80 b;  1NJI 1;  3CCL Z;  3I4N I;  1VQP Z;  3VMG A;  2AKL A;  1QYP A;  2Q4Z A;  1VQK Z;  1VQ6 1;  2Q51 A;  5A2Q b;  1K9M 1;  1TWH I;  2G2K A;  2JA5 I;  4MON A;  4NBB A;  1WII A;  5D1P A;  3GTK I;  2JA7 I;  3IF8 A;  2W03 A;  3CD6 1;  1Y1V I;  2K3R A;  3GTJ I;  1KQS Z;  2B63 I;  3CC2 1;  2BJO A;  4A3G I;  1WW9 A;  3I55 1;  1M1K 2;  2E2I I;  3CCS 1;  2V8J A;  4A3C I;  3S15 I;  2M48 A;  3P5J B;  4BY7 I;  2PMZ A;  2ZAE B;  2QRD B;  3CCR 1;  3S1Q I;  3IX0 A;  1M90 2;  4E33 A;  2JR6 A;  4XX2 A;  1Q86 2;  1P9N A;  2J6A A;  2LIY A;  4RVF A;  2JA6 I;  3J80 f;  1VQN Z;  1VQK 1;  2PM9 A;  3NDJ A;  3CCJ Z;  2JUB A;  3NH4 A;  1K8A 1;  1S72 Z;  5T6B A;  5A2Q f;  3CCQ Z;  1VQ7 1;  4NBE A;  3CCE 1;  1VQM Z;  3CCM Z;  1VQL 1;  1Q81 2;  4MRI A;  2F4O A;  4A3J I;  3JAM b;  3GTM S;  1N8R 2;  3OW2 Z;  2JA8 I;  3D9X A;  2E9H A;  3K7A I;  1YJN 1;  2OTL Z;  3G71 Z;  3GKQ A;  1KD1 2;  1SFO I;  1KQS Y;  1M90 1;  1USP B;  3VMI A;  1X0T A;  1Q86 1;  3G4S 1;  3M3Y I;  3HOW I;  1NUI A;  2YAD A;  2RPR A;  1LQL A;  3MZL B;  1RO2 A;  1YIJ 1;  5CM2 M;  4Y52 I;  5IP9 I;  3MZK B;  4NBA A;  3EED A;  2QRC B;  4BBR I;  4E32 A;  1ZB8 A;  4QTT A;  4HH4 A;  3J81 b;  3VB9 A;  3VTN A;  4DQY B;  1Q81 1;  1S72 1;  3CCQ 1;  3G6E 1;  3CC2 Z;  1N8R 1;  1VQM 1;  3M4O I;  3GTO I;  3I55 Z;  4NBH A;  2QR1 B;  1VQ4 Z;  1N2F A;  2GTH A;  3CXC Z;  3I56 Z;  1R9T I;  3S2D I;  2NVX I;  3G71 1;  1K73 1;  1Q7Y 1;  2KI7 B;  3GTM I;  3OW2 Y;  2F4M A;  1VQ5 1;  3HOX I;  1PFT A;  4MD8 A;  4HGY A;  1DL6 A;  2NVT I;  1USP A;  4MD7 A;  4E30 A;  4NBC A;  4HGZ A;  3S14 I;  5C44 I;  1VQ7 Z;  3CCE Z;  4EWC A;  1JWH C;  1YJW 1;  3QWU A;  2P28 A;  1VQL Z;  1JJ2 Z;  1QVG Z;  3HOU I;  3H3V J;  4A3E I;  4BY1 I;  2JS4 A;  5AN9 F;  3J81 f;  4RVD A;  3HOZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...