3G6E1

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g6e100
3OW2Y 1M1K2 1Q862 1M1K1 3CCRZ 1VQN1 3CCR1 1VQOZ 1NJI1 1K8A2 3I56Z 1VQ41 1KQSY 3G711 1VQ51 3G6EZ 3CCQ1 3G6E1 3CC7Z 1JJ2Z 3CCV1 1QVGY 2QEXZ 2QEX1 1K9M2 3CC2Z 3CC21 3I551 1M902 3CCJ1 1M901 3CCLZ 1VQ7Z 1JJ2Y 3CMEZ 3CME1 1VQ9Z 1S72Z 1VQL1 1YJN1 1YI21 2QA41 1N8R2 1KC82 1VQ81 1Q861 1VQNZ 1N8R1 1YIJZ 1KC81 1YIJ1 1VQ4Z 1VQ61 3G71Z 1VQ5Z 3CCE1 3CCQZ 3CCVZ 1K8A1 1Q812 3I55Z 1Q811 1K9M1 3CMA1 1YJW1 3CCJZ 1W2BZ 1VQLZ 3CCS1 3CC41 1YJNZ 1YI2Z 2QA4Z 1K732 1VQ8Z 2OTL1 3CPWZ 1VQP1 3CXCZ 1VQ6Z 1Q7Y2 1K731 3CCEZ 1YITZ 1YIT1 1Q822 1VQK1 1KD12 1W2BY 1Q7Y1 3CD61 1Q821 1KD11 1YHQ1 3CCU1 3G4S1 3CPWY 3CXCY 3CMAZ 1VQM1 1YJWZ 3CCMZ 3CCM1 1YJ9Z 1YJ91 1NJI2 3CCSZ 3CC4Z 1VQO1 3I561 3CC71 1VQPZ 2OTLZ 1QVFZ 3OW2Z 2OTJZ 2OTJ1 1VQKZ 3CD6Z 1YHQZ 3CCUZ 3G4SZ 1KQSZ 1QVFY 3CCL1 1VQ71 1VQMZ 1QVGZ 1VQ91 1S721
chains in the Genus database with same CATH superfamily
1M1K2 3GTMS 2R93I 2R7ZI 3IX0A 2RPRA 2NVTI 1X0TA 4XX2A 1VQ41 4NOZA 2R92I 2VUMI 1JJ2Z 3U50C 2VUGA 5A2Qb 3CCV1 1TFIA 1Y1VS 1Z02A 3EERA 3CC2Z 2E7ZA 4AYBA 2I3CA 5A2Qf 3S15I 1VQ7Z 1I6HI 3CME1 4RVGA 5IP7I 1YI21 2QA41 1FDOA 2BJOA 1WJ2A 2JA7I 3GTGI 2IV2X 1YIJZ 2KI7B 3JAMf 1QF8A 1RNIA 2VPZA 3I07A 3HOVI 3CCE1 3CCQZ 4E2YA 2OZKA 1JWHC 2H85A 3NDIA 3I55Z 1YUAA 5FLMI 1USPB 4NBDA 2QKDA 1YJW1 1Y1WI 3S1RI 2R6MA 3H0GI 4MONA 3D6WA 1W2BZ 3GTPI 3J80b 3CC41 1NP6A 2O53A 4A3EI 1AA6A 4Y7NI 2EGTA 1LQLA 3J80f 3S17I 4E2WA 1KD12 2LIYA 1TWFI 3CD61 2PK7A 2VF1A 2V8IA 3RZDI 4MD8A 4BBSI 3PO2I 4EWCA 4A3II 4BXXI 3TDHB 1QVFZ 3GTMI 1L1OC 2OTJ1 1VQKZ 2QR1B 3HKZA 2AKLA 4DGLA 2AYDA 4NFRA 1YHQZ 4E30A 2QRCB 3M4OI 1K83I 4DQYB 1VQ71 3NFZA 1RO0A 1Y1VI 3D9XA 4RVFA 1VQMZ 3KIHA 3OW2Y 3BG1B 3CCR1 3BG0B 4A3CI 3CCQ1 3G6E1 4NBBA 1QVGY 2LFUA 2QEX1 4MH4A 3MZLB 3I551 1WW9A 3GTQI 1YUKA 4E33A 1M902 3Q87A 2KPIA 4MD7A 1SIWA 1VQ9Z 3J81f 2JMOA 2WB1A 4QTTA 1R9TI 5C44I 1I3QI 1N8R2 2DE5A 1Q861 1I50I 1KC81 1VQ5Z 4RV9A 3HOZI 3I4MI 2G2KA 3S2DI 1SFOI 1Q811 1USPA 2M6NA 2VPXA 4A3LI 3CCJZ 1TWCI 1VQLZ 4A3JI 3JAMb 3FQQA 2F4OA 2JA8I 1RLYA 2WAQA 3GTJI 1RQFA 1Q7Y2 1K731 3HOYI 1YIT1 1Q822 1VQK1 2RHBA 4DK1A 5IT9f 1YHQ1 3F3PC 1P9NA 2JA5I 3CPWY 4MRIA 3GCFA 3CXCY 3CMAZ 1VQM1 1TWHI 4A3DI 3RZOI 3CCMZ 2F4MA 1YJ91 3CCSZ 2RT9A 3MONA 2P3YA 1VQPZ 1KRLA 2IZ3A 3OW2Z 3GTLI 2JIMA 4NBEA 3S16I 4QTUA 3NH8A 1RO2A 3NH4A 1QVGZ 1VQ91 2JS4A 1Q862 1WIIA 1M1K1 1WZNA 1VQOZ 5T67A 5FLXf 1NJI1 2DE7A 3I56Z 5IP9I 1ZH1A 1KQSY 1VQ51 3CC7Z 3ESWA 4A3KI 2IZ4A 4CL1A 3CC21 2NVXI 4A93I 2Q51A 4TNUA 2E2II 2E2HI 2E2JI 3CCJ1 4RVDA 3CCLZ 3CMEZ 1S72Z 1VQL1 4BY7I 4NB9A 5T6BA 2JIOA 1VQNZ 3FKII 3I4NI 1YIJ1 3P5JB 3G71Z 2LEXA 1K8A1 5C4JI 2YADA 4BY1I 3J81b 2OOXB 1K9M1 3CMA1 3S1MI 1QYPA 1Q16A 3CCS1 1YJNZ 1RO4A 2RBLA 4RVHA 1VQ8Z 3F3FC 3CPWZ 1VQP1 3CXCZ 1VQ6Z 4NBHA 3S14I 2JA6I 1KD11 2JIRA 2E9HA 3PO3S 4NB8A 2QREB 4NBFA 1NJI2 2YU9I 2B63I 3CQZI 4E31A 4NH1C 2NVQI 1VQO1 2J6AA 3I561 1NUIA 3CC71 2OTLZ 5IT9b 2JR6A 2QRDB 3IFUA 2OTJZ 3GTOI 3HOWI 4A3MI 2O4HA 2HU9A 1ML8A 5T64A 3CCUZ 3G4SZ 1PFTA 1KQSZ 3CCL1 3S1QI 2V8KA 4BBRI 2GTHA 1S721 3TE5B 1ZB9A 3CCRZ 1VQN1 1VLAA 3FQMA 1K8A2 2JNYA 5C3EI 2Q4ZA 1FDIA 3G711 1S7MA 3G6EZ 2Y0SA 2V8JA 2QEXZ 3VTNA 4MXUA 2VPYA 1K9M2 4A3FI 5LL6f 2QLVB 5CM2M 4E32A 3S2HI 1M901 2OOYB 1ZB8A 1JJ2Y 5FLXb 2W04A 2V3VA 1YJN1 3J7A4 3H3VJ 1KC82 3S1NI 1VQ81 4HH4A 4S1TA 3VB9A 1N8R1 1VQ61 2JIPA 1VQ4Z 5D1PA 3CCVZ 3LUSA 3MZKB 1Q812 3VMIA 2GTIA 4NBAA 3T4NB 3GKQA 2RIQA 3EEDA 3VMGA 4Y52I 1YI2Z 2QA4Z 3PO3I 1K732 1X3ZA 2OTL1 1WCMI 4A3GI 1N2FA 2JIQA 3CCEZ 1YITZ 2V45A 1W2BY 1Q7Y1 2VPWA 1Q821 3VMHA 3GTKI 3HOXI 3CCU1 1TWAI 3G4S1 5D1OA 4HGYA 3K7AI 3QWUA 2NVYI 1YJWZ 4RS4A 2W03A 1DL6A 2PM9A 1Z03A 2ZAEB 3CCM1 1YJ9Z 2HF1A 2GU2A 5AN9F 4X6AI 3IF8A 3CC4Z 3NDJA 2M48A 4A3BI 3KIFA 2DE6A 2PMZA 3NH5A 2JUBA 2P28A 3M3YI 2NAPA 5C4XI 2K3RA 4HGZA 1Y8CA 4E2ZA 3D2LA 2K5RA 4MD9A 4NBCA 3IR7A 4E2XA 3CD6Z 1TWGI 1X3WA 4NBGA 1Z01A 1QXFA 1QVFY 5D1OB 3HOUI
chains in the Genus database with same CATH topology
1M1K2 3GTMS 2R93I 2R7ZI 3IX0A 2RPRA 2NVTI 1X0TA 4XX2A 1VQ41 4NOZA 2R92I 2VUMI 1JJ2Z 3U50C 2VUGA 5A2Qb 3CCV1 1TFIA 1Y1VS 1Z02A 3EERA 3CC2Z 4AYBA 2I3CA 5A2Qf 3S15I 1VQ7Z 1I6HI 3CME1 4RVGA 5IP7I 1YI21 2QA41 2BJOA 2JA7I 3GTGI 1YIJZ 2KI7B 3JAMf 1QF8A 1RNIA 3I07A 3HOVI 3CCE1 3CCQZ 4E2YA 2OZKA 1JWHC 2H85A 3NDIA 3I55Z 1YUAA 5FLMI 1USPB 4NBDA 2QKDA 1YJW1 1Y1WI 3S1RI 2R6MA 3H0GI 4MONA 3D6WA 1W2BZ 3GTPI 3J80b 3CC41 1NP6A 2O53A 4A3EI 4Y7NI 2EGTA 1LQLA 3J80f 3S17I 4E2WA 1KD12 2LIYA 1TWFI 3CD61 2PK7A 2VF1A 2V8IA 3RZDI 4MD8A 4BBSI 3PO2I 4EWCA 4A3II 4BXXI 3TDHB 1QVFZ 3GTMI 1L1OC 2OTJ1 1VQKZ 2QR1B 3HKZA 2AKLA 4DGLA 4NFRA 1YHQZ 4E30A 2QRCB 3M4OI 1K83I 4DQYB 1VQ71 3NFZA 1VQMZ 1Y1VI 3D9XA 1RO0A 4RVFA 3KIHA 3OW2Y 3BG1B 3CCR1 3BG0B 4A3CI 3CCQ1 3G6E1 4NBBA 1QVGY 2LFUA 2QEX1 4MH4A 3MZLB 3I551 1WW9A 3GTQI 1YUKA 4E33A 1M902 3Q87A 2KPIA 4MD7A 1VQ9Z 3J81f 2JMOA 2WB1A 4QTTA 1R9TI 5C44I 1I3QI 1N8R2 2DE5A 1Q861 1I50I 1KC81 1VQ5Z 4RV9A 3HOZI 3I4MI 2G2KA 3S2DI 1SFOI 1Q811 1USPA 2M6NA 4A3LI 3CCJZ 1TWCI 1VQLZ 4A3JI 3JAMb 3FQQA 2F4OA 2JA8I 1RLYA 2WAQA 3GTJI 1RQFA 1Q7Y2 1K731 3HOYI 1YIT1 1Q822 1VQK1 2RHBA 4DK1A 5IT9f 1YHQ1 3F3PC 1P9NA 2JA5I 3CPWY 4MRIA 3GCFA 3CXCY 3CMAZ 1VQM1 1TWHI 4A3DI 3RZOI 3CCMZ 2F4MA 1YJ91 3CCSZ 2RT9A 3MONA 2P3YA 1VQPZ 1KRLA 2IZ3A 3OW2Z 3GTLI 4NBEA 3S16I 4QTUA 3NH8A 1RO2A 3NH4A 1QVGZ 1VQ91 2JS4A 1Q862 1WIIA 1M1K1 1VQOZ 5T67A 5FLXf 1NJI1 2DE7A 3I56Z 5IP9I 1ZH1A 1KQSY 1VQ51 3CC7Z 3ESWA 4A3KI 2IZ4A 4CL1A 3CC21 2NVXI 4A93I 2Q51A 4TNUA 2E2II 2E2HI 2E2JI 3CCJ1 4RVDA 3CCLZ 3CMEZ 1S72Z 1VQL1 4BY7I 4NB9A 5T6BA 1VQNZ 3FKII 3I4NI 1YIJ1 3P5JB 3G71Z 1K8A1 5C4JI 2YADA 4BY1I 3J81b 2OOXB 1K9M1 3CMA1 3S1MI 1QYPA 3CCS1 1YJNZ 1RO4A 2RBLA 4RVHA 1VQ8Z 3F3FC 3CPWZ 1VQP1 3CXCZ 1VQ6Z 4NBHA 3S14I 2JA6I 1KD11 2E9HA 3PO3S 4NB8A 2QREB 4NBFA 1NJI2 2YU9I 2B63I 3CQZI 4E31A 4NH1C 2NVQI 1VQO1 2J6AA 3I561 1NUIA 3CC71 2OTLZ 5IT9b 2JR6A 2QRDB 3IFUA 2OTJZ 3GTOI 3HOWI 4A3MI 2O4HA 2HU9A 1ML8A 5T64A 3CCUZ 3G4SZ 1PFTA 1KQSZ 3CCL1 3S1QI 2V8KA 4BBRI 2GTHA 1S721 3TE5B 1ZB9A 3CCRZ 1VQN1 1VLAA 3FQMA 1K8A2 2JNYA 5C3EI 2Q4ZA 3G711 1S7MA 3G6EZ 2Y0SA 2V8JA 2QEXZ 3VTNA 4MXUA 1K9M2 4A3FI 5LL6f 2QLVB 5CM2M 4E32A 3S2HI 1M901 2OOYB 1ZB8A 1JJ2Y 5FLXb 2W04A 1YJN1 3J7A4 3H3VJ 1KC82 3S1NI 1VQ81 4HH4A 4S1TA 3VB9A 1N8R1 1VQ61 1VQ4Z 5D1PA 3CCVZ 3LUSA 3MZKB 1Q812 3VMIA 2GTIA 4NBAA 3T4NB 3GKQA 2RIQA 3EEDA 3VMGA 4Y52I 1YI2Z 2QA4Z 3PO3I 1K732 1X3ZA 2OTL1 1WCMI 4A3GI 1N2FA 3CCEZ 1YITZ 1W2BY 1Q7Y1 1Q821 3VMHA 3GTKI 3HOXI 3CCU1 1TWAI 3G4S1 5D1OA 4HGYA 3K7AI 3QWUA 2NVYI 1YJWZ 4RS4A 2W03A 1DL6A 2PM9A 1Z03A 2ZAEB 3CCM1 1YJ9Z 2HF1A 2GU2A 5AN9F 4X6AI 3IF8A 3CC4Z 3NDJA 2M48A 4A3BI 3KIFA 2DE6A 2PMZA 3NH5A 2JUBA 2P28A 3M3YI 5C4XI 2K3RA 4HGZA 4E2ZA 2K5RA 4MD9A 4NBCA 4E2XA 3CD6Z 1TWGI 1X3WA 4NBGA 1Z01A 1QVFY 5D1OB 3HOUI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Y;  1M1K 2;  1Q86 2;  1M1K 1;  3CCR Z;  1VQN 1;  3CCR 1;  1VQO Z;  1NJI 1;  1K8A 2;  3I56 Z;  1VQ4 1;  1KQS Y;  3G71 1;  1VQ5 1;  3G6E Z;  3CCQ 1;  3G6E 1;  3CC7 Z;  1JJ2 Z;  3CCV 1;  1QVG Y;  2QEX Z;  2QEX 1;  1K9M 2;  3CC2 Z;  3CC2 1;  3I55 1;  1M90 2;  3CCJ 1;  1M90 1;  3CCL Z;  1VQ7 Z;  1JJ2 Y;  3CME Z;  3CME 1;  1VQ9 Z;  1S72 Z;  1VQL 1;  1YJN 1;  1YI2 1;  2QA4 1;  1N8R 2;  1KC8 2;  1VQ8 1;  1Q86 1;  1VQN Z;  1N8R 1;  1YIJ Z;  1KC8 1;  1YIJ 1;  1VQ4 Z;  1VQ6 1;  3G71 Z;  1VQ5 Z;  3CCE 1;  3CCQ Z;  3CCV Z;  1K8A 1;  1Q81 2;  3I55 Z;  1Q81 1;  1K9M 1;  3CMA 1;  1YJW 1;  3CCJ Z;  1W2B Z;  1VQL Z;  3CCS 1;  3CC4 1;  1YJN Z;  1YI2 Z;  2QA4 Z;  1K73 2;  1VQ8 Z;  2OTL 1;  3CPW Z;  1VQP 1;  3CXC Z;  1VQ6 Z;  1Q7Y 2;  1K73 1;  3CCE Z;  1YIT Z;  1YIT 1;  1Q82 2;  1VQK 1;  1KD1 2;  1W2B Y;  1Q7Y 1;  3CD6 1;  1Q82 1;  1KD1 1;  1YHQ 1;  3CCU 1;  3G4S 1;  3CPW Y;  3CXC Y;  3CMA Z;  1VQM 1;  1YJW Z;  3CCM Z;  3CCM 1;  1YJ9 Z;  1YJ9 1;  1NJI 2;  3CCS Z;  3CC4 Z;  1VQO 1;  3I56 1;  3CC7 1;  1VQP Z;  2OTL Z;  1QVF Z;  3OW2 Z;  2OTJ Z;  2OTJ 1;  1VQK Z;  3CD6 Z;  1YHQ Z;  3CCU Z;  3G4S Z;  1KQS Z;  1QVF Y;  3CCL 1;  1VQ7 1;  1VQM Z;  1QVG Z;  1VQ9 1;  1S72 1; 
#chains in the Genus database with same CATH topology
 1M1K 2;  3GTM S;  2R93 I;  2R7Z I;  3IX0 A;  2RPR A;  2NVT I;  1X0T A;  4XX2 A;  1VQ4 1;  4NOZ A;  2R92 I;  2VUM I;  1JJ2 Z;  3U50 C;  2VUG A;  5A2Q b;  3CCV 1;  1TFI A;  1Y1V S;  1Z02 A;  3EER A;  3CC2 Z;  2E7Z A;  4AYB A;  2I3C A;  5A2Q f;  3S15 I;  1VQ7 Z;  1I6H I;  3CME 1;  4RVG A;  5IP7 I;  1YI2 1;  2QA4 1;  1FDO A;  2BJO A;  1WJ2 A;  2JA7 I;  3GTG I;  2IV2 X;  1YIJ Z;  2KI7 B;  3JAM f;  1QF8 A;  1RNI A;  2VPZ A;  3I07 A;  3HOV I;  3CCE 1;  3CCQ Z;  4E2Y A;  2OZK A;  1JWH C;  2H85 A;  3NDI A;  3I55 Z;  1YUA A;  5FLM I;  1USP B;  4NBD A;  2QKD A;  1YJW 1;  1Y1W I;  3S1R I;  2R6M A;  3H0G I;  4MON A;  3D6W A;  1W2B Z;  3GTP I;  3J80 b;  3CC4 1;  1NP6 A;  2O53 A;  4A3E I;  1AA6 A;  4Y7N I;  2EGT A;  1LQL A;  3J80 f;  3S17 I;  4E2W A;  1KD1 2;  2LIY A;  1TWF I;  3CD6 1;  2PK7 A;  2VF1 A;  2V8I A;  3RZD I;  4MD8 A;  4BBS I;  3PO2 I;  4EWC A;  4A3I I;  4BXX I;  3TDH B;  1QVF Z;  3GTM I;  1L1O C;  2OTJ 1;  1VQK Z;  2QR1 B;  3HKZ A;  2AKL A;  4DGL A;  2AYD A;  4NFR A;  1YHQ Z;  4E30 A;  2QRC B;  3M4O I;  1K83 I;  4DQY B;  1VQ7 1;  3NFZ A;  1RO0 A;  1Y1V I;  3D9X A;  4RVF A;  1VQM Z;  3KIH A;  3OW2 Y;  3BG1 B;  3CCR 1;  3BG0 B;  4A3C I;  3CCQ 1;  3G6E 1;  4NBB A;  1QVG Y;  2LFU A;  2QEX 1;  4MH4 A;  3MZL B;  3I55 1;  1WW9 A;  3GTQ I;  1YUK A;  4E33 A;  1M90 2;  3Q87 A;  2KPI A;  4MD7 A;  1SIW A;  1VQ9 Z;  3J81 f;  2JMO A;  2WB1 A;  4QTT A;  1R9T I;  5C44 I;  1I3Q I;  1N8R 2;  2DE5 A;  1Q86 1;  1I50 I;  1KC8 1;  1VQ5 Z;  4RV9 A;  3HOZ I;  3I4M I;  2G2K A;  3S2D I;  1SFO I;  1Q81 1;  1USP A;  2M6N A;  2VPX A;  4A3L I;  3CCJ Z;  1TWC I;  1VQL Z;  4A3J I;  3JAM b;  3FQQ A;  2F4O A;  2JA8 I;  1RLY A;  2WAQ A;  3GTJ I;  1RQF A;  1Q7Y 2;  1K73 1;  3HOY I;  1YIT 1;  1Q82 2;  1VQK 1;  2RHB A;  4DK1 A;  5IT9 f;  1YHQ 1;  3F3P C;  1P9N A;  2JA5 I;  3CPW Y;  4MRI A;  3GCF A;  3CXC Y;  3CMA Z;  1VQM 1;  1TWH I;  4A3D I;  3RZO I;  3CCM Z;  2F4M A;  1YJ9 1;  3CCS Z;  2RT9 A;  3MON A;  2P3Y A;  1VQP Z;  1KRL A;  2IZ3 A;  3OW2 Z;  3GTL I;  2JIM A;  4NBE A;  3S16 I;  4QTU A;  3NH8 A;  1RO2 A;  3NH4 A;  1QVG Z;  1VQ9 1;  2JS4 A;  1Q86 2;  1WII A;  1M1K 1;  1WZN A;  1VQO Z;  5T67 A;  5FLX f;  1NJI 1;  2DE7 A;  3I56 Z;  5IP9 I;  1ZH1 A;  1KQS Y;  1VQ5 1;  3CC7 Z;  3ESW A;  4A3K I;  2IZ4 A;  4CL1 A;  3CC2 1;  2NVX I;  4A93 I;  2Q51 A;  4TNU A;  2E2I I;  2E2H I;  2E2J I;  3CCJ 1;  4RVD A;  3CCL Z;  3CME Z;  1S72 Z;  1VQL 1;  4BY7 I;  4NB9 A;  5T6B A;  2JIO A;  1VQN Z;  3FKI I;  3I4N I;  1YIJ 1;  3P5J B;  3G71 Z;  2LEX A;  1K8A 1;  5C4J I;  2YAD A;  4BY1 I;  3J81 b;  2OOX B;  1K9M 1;  3CMA 1;  3S1M I;  1QYP A;  1Q16 A;  3CCS 1;  1YJN Z;  1RO4 A;  2RBL A;  4RVH A;  1VQ8 Z;  3F3F C;  3CPW Z;  1VQP 1;  3CXC Z;  1VQ6 Z;  4NBH A;  3S14 I;  2JA6 I;  1KD1 1;  2JIR A;  2E9H A;  3PO3 S;  4NB8 A;  2QRE B;  4NBF A;  1NJI 2;  2YU9 I;  2B63 I;  3CQZ I;  4E31 A;  4NH1 C;  2NVQ I;  1VQO 1;  2J6A A;  3I56 1;  1NUI A;  3CC7 1;  2OTL Z;  5IT9 b;  2JR6 A;  2QRD B;  3IFU A;  2OTJ Z;  3GTO I;  3HOW I;  4A3M I;  2O4H A;  2HU9 A;  1ML8 A;  5T64 A;  3CCU Z;  3G4S Z;  1PFT A;  1KQS Z;  3CCL 1;  3S1Q I;  2V8K A;  4BBR I;  2GTH A;  1S72 1;  3TE5 B;  1ZB9 A;  3CCR Z;  1VQN 1;  1VLA A;  3FQM A;  1K8A 2;  2JNY A;  5C3E I;  2Q4Z A;  1FDI A;  3G71 1;  1S7M A;  3G6E Z;  2Y0S A;  2V8J A;  2QEX Z;  3VTN A;  4MXU A;  2VPY A;  1K9M 2;  4A3F I;  5LL6 f;  2QLV B;  5CM2 M;  4E32 A;  3S2H I;  1M90 1;  2OOY B;  1ZB8 A;  1JJ2 Y;  5FLX b;  2W04 A;  2V3V A;  1YJN 1;  3J7A 4;  3H3V J;  1KC8 2;  3S1N I;  1VQ8 1;  4HH4 A;  4S1T A;  3VB9 A;  1N8R 1;  1VQ6 1;  2JIP A;  1VQ4 Z;  5D1P A;  3CCV Z;  3LUS A;  3MZK B;  1Q81 2;  3VMI A;  2GTI A;  4NBA A;  3T4N B;  3GKQ A;  2RIQ A;  3EED A;  3VMG A;  4Y52 I;  1YI2 Z;  2QA4 Z;  3PO3 I;  1K73 2;  1X3Z A;  2OTL 1;  1WCM I;  4A3G I;  1N2F A;  2JIQ A;  3CCE Z;  1YIT Z;  2V45 A;  1W2B Y;  1Q7Y 1;  2VPW A;  1Q82 1;  3VMH A;  3GTK I;  3HOX I;  3CCU 1;  1TWA I;  3G4S 1;  5D1O A;  4HGY A;  3K7A I;  3QWU A;  2NVY I;  1YJW Z;  4RS4 A;  2W03 A;  1DL6 A;  2PM9 A;  1Z03 A;  2ZAE B;  3CCM 1;  1YJ9 Z;  2HF1 A;  2GU2 A;  5AN9 F;  4X6A I;  3IF8 A;  3CC4 Z;  3NDJ A;  2M48 A;  4A3B I;  3KIF A;  2DE6 A;  2PMZ A;  3NH5 A;  2JUB A;  2P28 A;  3M3Y I;  2NAP A;  5C4X I;  2K3R A;  4HGZ A;  1Y8C A;  4E2Z A;  3D2L A;  2K5R A;  4MD9 A;  4NBC A;  3IR7 A;  4E2X A;  3CD6 Z;  1TWG I;  1X3W A;  4NBG A;  1Z01 A;  1QXF A;  1QVF Y;  5D1O B;  3HOU I; 
#chains in the Genus database with same CATH homology
 1M1K 2;  3GTM S;  2R93 I;  2R7Z I;  3IX0 A;  2RPR A;  2NVT I;  1X0T A;  4XX2 A;  1VQ4 1;  4NOZ A;  2R92 I;  2VUM I;  1JJ2 Z;  3U50 C;  2VUG A;  5A2Q b;  3CCV 1;  1TFI A;  1Y1V S;  1Z02 A;  3EER A;  3CC2 Z;  4AYB A;  2I3C A;  5A2Q f;  3S15 I;  1VQ7 Z;  1I6H I;  3CME 1;  4RVG A;  5IP7 I;  1YI2 1;  2QA4 1;  2BJO A;  2JA7 I;  3GTG I;  1YIJ Z;  2KI7 B;  3JAM f;  1QF8 A;  1RNI A;  3I07 A;  3HOV I;  3CCE 1;  3CCQ Z;  4E2Y A;  2OZK A;  1JWH C;  2H85 A;  3NDI A;  3I55 Z;  1YUA A;  5FLM I;  1USP B;  4NBD A;  2QKD A;  1YJW 1;  1Y1W I;  3S1R I;  2R6M A;  3H0G I;  4MON A;  3D6W A;  1W2B Z;  3GTP I;  3J80 b;  3CC4 1;  1NP6 A;  2O53 A;  4A3E I;  4Y7N I;  2EGT A;  1LQL A;  3J80 f;  3S17 I;  4E2W A;  1KD1 2;  2LIY A;  1TWF I;  3CD6 1;  2PK7 A;  2VF1 A;  2V8I A;  3RZD I;  4MD8 A;  4BBS I;  3PO2 I;  4EWC A;  4A3I I;  4BXX I;  3TDH B;  1QVF Z;  3GTM I;  1L1O C;  2OTJ 1;  1VQK Z;  2QR1 B;  3HKZ A;  2AKL A;  4DGL A;  4NFR A;  1YHQ Z;  4E30 A;  2QRC B;  3M4O I;  1K83 I;  4DQY B;  1VQ7 1;  3NFZ A;  1VQM Z;  1Y1V I;  3D9X A;  1RO0 A;  4RVF A;  3KIH A;  3OW2 Y;  3BG1 B;  3CCR 1;  3BG0 B;  4A3C I;  3CCQ 1;  3G6E 1;  4NBB A;  1QVG Y;  2LFU A;  2QEX 1;  4MH4 A;  3MZL B;  3I55 1;  1WW9 A;  3GTQ I;  1YUK A;  4E33 A;  1M90 2;  3Q87 A;  2KPI A;  4MD7 A;  1VQ9 Z;  3J81 f;  2JMO A;  2WB1 A;  4QTT A;  1R9T I;  5C44 I;  1I3Q I;  1N8R 2;  2DE5 A;  1Q86 1;  1I50 I;  1KC8 1;  1VQ5 Z;  4RV9 A;  3HOZ I;  3I4M I;  2G2K A;  3S2D I;  1SFO I;  1Q81 1;  1USP A;  2M6N A;  4A3L I;  3CCJ Z;  1TWC I;  1VQL Z;  4A3J I;  3JAM b;  3FQQ A;  2F4O A;  2JA8 I;  1RLY A;  2WAQ A;  3GTJ I;  1RQF A;  1Q7Y 2;  1K73 1;  3HOY I;  1YIT 1;  1Q82 2;  1VQK 1;  2RHB A;  4DK1 A;  5IT9 f;  1YHQ 1;  3F3P C;  1P9N A;  2JA5 I;  3CPW Y;  4MRI A;  3GCF A;  3CXC Y;  3CMA Z;  1VQM 1;  1TWH I;  4A3D I;  3RZO I;  3CCM Z;  2F4M A;  1YJ9 1;  3CCS Z;  2RT9 A;  3MON A;  2P3Y A;  1VQP Z;  1KRL A;  2IZ3 A;  3OW2 Z;  3GTL I;  4NBE A;  3S16 I;  4QTU A;  3NH8 A;  1RO2 A;  3NH4 A;  1QVG Z;  1VQ9 1;  2JS4 A;  1Q86 2;  1WII A;  1M1K 1;  1VQO Z;  5T67 A;  5FLX f;  1NJI 1;  2DE7 A;  3I56 Z;  5IP9 I;  1ZH1 A;  1KQS Y;  1VQ5 1;  3CC7 Z;  3ESW A;  4A3K I;  2IZ4 A;  4CL1 A;  3CC2 1;  2NVX I;  4A93 I;  2Q51 A;  4TNU A;  2E2I I;  2E2H I;  2E2J I;  3CCJ 1;  4RVD A;  3CCL Z;  3CME Z;  1S72 Z;  1VQL 1;  4BY7 I;  4NB9 A;  5T6B A;  1VQN Z;  3FKI I;  3I4N I;  1YIJ 1;  3P5J B;  3G71 Z;  1K8A 1;  5C4J I;  2YAD A;  4BY1 I;  3J81 b;  2OOX B;  1K9M 1;  3CMA 1;  3S1M I;  1QYP A;  3CCS 1;  1YJN Z;  1RO4 A;  2RBL A;  4RVH A;  1VQ8 Z;  3F3F C;  3CPW Z;  1VQP 1;  3CXC Z;  1VQ6 Z;  4NBH A;  3S14 I;  2JA6 I;  1KD1 1;  2E9H A;  3PO3 S;  4NB8 A;  2QRE B;  4NBF A;  1NJI 2;  2YU9 I;  2B63 I;  3CQZ I;  4E31 A;  4NH1 C;  2NVQ I;  1VQO 1;  2J6A A;  3I56 1;  1NUI A;  3CC7 1;  2OTL Z;  5IT9 b;  2JR6 A;  2QRD B;  3IFU A;  2OTJ Z;  3GTO I;  3HOW I;  4A3M I;  2O4H A;  2HU9 A;  1ML8 A;  5T64 A;  3CCU Z;  3G4S Z;  1PFT A;  1KQS Z;  3CCL 1;  3S1Q I;  2V8K A;  4BBR I;  2GTH A;  1S72 1;  3TE5 B;  1ZB9 A;  3CCR Z;  1VQN 1;  1VLA A;  3FQM A;  1K8A 2;  2JNY A;  5C3E I;  2Q4Z A;  3G71 1;  1S7M A;  3G6E Z;  2Y0S A;  2V8J A;  2QEX Z;  3VTN A;  4MXU A;  1K9M 2;  4A3F I;  5LL6 f;  2QLV B;  5CM2 M;  4E32 A;  3S2H I;  1M90 1;  2OOY B;  1ZB8 A;  1JJ2 Y;  5FLX b;  2W04 A;  1YJN 1;  3J7A 4;  3H3V J;  1KC8 2;  3S1N I;  1VQ8 1;  4HH4 A;  4S1T A;  3VB9 A;  1N8R 1;  1VQ6 1;  1VQ4 Z;  5D1P A;  3CCV Z;  3LUS A;  3MZK B;  1Q81 2;  3VMI A;  2GTI A;  4NBA A;  3T4N B;  3GKQ A;  2RIQ A;  3EED A;  3VMG A;  4Y52 I;  1YI2 Z;  2QA4 Z;  3PO3 I;  1K73 2;  1X3Z A;  2OTL 1;  1WCM I;  4A3G I;  1N2F A;  3CCE Z;  1YIT Z;  1W2B Y;  1Q7Y 1;  1Q82 1;  3VMH A;  3GTK I;  3HOX I;  3CCU 1;  1TWA I;  3G4S 1;  5D1O A;  4HGY A;  3K7A I;  3QWU A;  2NVY I;  1YJW Z;  4RS4 A;  2W03 A;  1DL6 A;  2PM9 A;  1Z03 A;  2ZAE B;  3CCM 1;  1YJ9 Z;  2HF1 A;  2GU2 A;  5AN9 F;  4X6A I;  3IF8 A;  3CC4 Z;  3NDJ A;  2M48 A;  4A3B I;  3KIF A;  2DE6 A;  2PMZ A;  3NH5 A;  2JUB A;  2P28 A;  3M3Y I;  5C4X I;  2K3R A;  4HGZ A;  4E2Z A;  2K5R A;  4MD9 A;  4NBC A;  4E2X A;  3CD6 Z;  1TWG I;  1X3W A;  4NBG A;  1Z01 A;  1QVF Y;  5D1O B;  3HOU I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...