3G6E1

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g6e100
1W2BY 1VQPZ 1JJ2Z 2OTLZ 1YIJ1 1YJ9Z 1Q821 1VQMZ 1KD11 3CCE1 1W2BZ 3CCQZ 3CCSZ 3CCMZ 3CCJ1 1QVFY 1YJWZ 1K8A1 1Q7Y1 1VQKZ 1VQ8Z 1Q861 1VQ4Z 3CCUZ 1QVFZ 1K732 3CCRZ 3I551 1N8R2 1YJNZ 1K8A2 1JJ2Y 1VQ71 3G6EZ 3CC4Z 1S721 3CMAZ 3CME1 1Q862 1VQOZ 3I56Z 1NJI1 1QVGY 1VQ91 1YITZ 3CCLZ 1VQM1 1M902 1QVGZ 2OTJZ 3G711 1K9M1 1KQSY 3CC71 1YHQZ 1Q822 3G4S1 1YI21 1VQ6Z 1VQNZ 1VQ51 1VQL1 1KD12 3CD61 2QA4Z 1KQSZ 1KC81 1Q7Y2 3CCVZ 3CC41 3CMA1 1VQO1 3CCEZ 1VQP1 2OTL1 1Q811 1YJ91 2QEXZ 3CXCY 1NJI2 3CCQ1 3CCS1 3CCM1 3I55Z 3CC2Z 1YJW1 1VQ7Z 1VQK1 1VQ81 1S72Z 3CXCZ 1VQ41 3CCU1 3CMEZ 3CCR1 1YJN1 1VQ9Z 1YIJZ 1K9M2 3CPWY 3G6E1 3CCV1 1M1K1 3I561 1K731 3CPWZ 3CCJZ 1N8R1 1YIT1 3G71Z 1KC82 3CCL1 3CC7Z 3G4SZ 1YI2Z 1VQLZ 1VQ5Z 2OTJ1 2QEX1 1M1K2 3CD6Z 3OW2Y 3CC21 1Q812 1YHQ1 1VQ61 1VQN1 1M901 3OW2Z 2QA41
chains in the Genus database with same CATH superfamily
3K7AI 1W2BY 1VQPZ 3U50C 1YJ9Z 2HU9A 2KPIA 3CCE1 1SIWA 1W2BZ 3CCQZ 3CCSZ 2IV2X 4NBBA 3IX0A 1VQKZ 1VQ8Z 4NB9A 1Q861 1VQ4Z 1X0TA 3GTLI 1K732 1RLYA 2F4MA 5IT9b 2YU9I 3PO2I 5T67A 1S721 3CMAZ 3H0GI 1VQOZ 3I56Z 2JA8I 1YITZ 4A3DI 2W03A 3PO3I 3MZKB 1K9M1 2F4OA 3S16I 1LQLA 3CC71 4RVHA 3RZDI 5FLMI 1VQL1 3HOVI 1KD12 3M4OI 2QA4Z 3S1NI 3NH8A 4NBGA 1Q16A 3F3PC 1Z02A 1QF8A 2JA5I 5D1OB 4A3EI 3JAMb 5LL6f 3EERA 3S2HI 1VQP1 1Q811 1RO4A 1YJ91 2R6MA 1RO2A 5C4XI 2ZAEB 2VPXA 1NJI2 3CCQ1 3CCS1 3I55Z 2JA6I 1VQK1 1VQ81 1VQ41 3M3YI 4Y52I 3I4NI 2RPRA 3S1RI 3TE5B 1USPB 4A3II 2E9HA 5IT9f 1M1K1 2IZ4A 3I561 2NVTI 1N8R1 1YIT1 1NP6A 1FDIA 3VMHA 1TFIA 3S17I 1Y1VI 4MH4A 2RT9A 4AYBA 2QEX1 3Q87A 3CC21 3D6WA 4RVDA 4A3MI 2QA41 3I4MI 1WJ2A 4HH4A 2JIMA 2AKLA 1Q821 1L1OC 4E2YA 1Z03A 4A3BI 2PK7A 4RVFA 5C3EI 3IF8A 1RNIA 3CCJ1 1YJWZ 1K8A1 1K83I 1AA6A 4BY1I 1Q7Y1 2VUGA 3JAMf 3KIHA 3NH5A 3CCUZ 1I6HI 4NBFA 3VMIA 3I551 2JIQA 5C4JI 1DL6A 2VPWA 1ZH1A 1Q862 5A2Qb 3RZOI 4E2ZA 5T6BA 2JMOA 2K5RA 3D9XA 3IFUA 1VQM1 2IZ3A 1M902 2WAQA 2OTJZ 2R93I 4MONA 3VB9A 4NBEA 3FQMA 4HGYA 1VQNZ 2J6AA 3VTNA 3D2LA 1QYPA 2G2KA 4E30A 2WB1A 4BBSI 3BG0B 3CC41 5IP7I 3LUSA 3GCFA 1VLAA 1TWGI 1KRLA 4BXXI 2JIPA 4Y7NI 1TWFI 2P28A 4NB8A 2QEXZ 3T4NB 4E2XA 1RQFA 1YJW1 3CC2Z 4NBDA 3CCU1 2RBLA 1X3ZA 4CL1A 3CPWY 3GTOI 4QTUA 1RO0A 1N2FA 2QR1B 3GTPI 4E33A 4BBRI 1K731 4E32A 3CPWZ 3CCJZ 1ZB9A 3G71Z 2QREB 1KC82 1NUIA 5A2Qf 2VUMI 4NBCA 3G4SZ 1YUAA 1VQ5Z 2OTJ1 2V8IA 4E2WA 1M1K2 5CM2M 3IR7A 1YUKA 4QTTA 4DQYB 1VQN1 4DGLA 3F3FC 1JJ2Z 2Q4ZA 1YIJ1 1USPA 1VQMZ 1KD11 4MD9A 1QXFA 3CCMZ 4MD8A 2OZKA 4TNUA 3VMGA 4A3LI 3H3VJ 5T64A 3J80b 4X6AI 1K8A2 3CC4Z 3S2DI 2I3CA 1NJI1 3NDJA 3ESWA 2GU2A 2JA7I 2BJOA 3GKQA 3G711 3HOXI 4RV9A 1KQSY 1P9NA 1VQ6Z 3G4S1 3S14I 4NBHA 1VQ51 4RVGA 1TWCI 2EGTA 1KQSZ 2QKDA 2Y0SA 2RIQA 2QLVB 3J81b 2O4HA 4A3KI 4A3JI 2LFUA 3GTMS 3CCM1 2JS4A 1WW9A 2JIOA 1VQ7Z 2R7ZI 2JUBA 1WZNA 2PM9A 2YADA 2V8JA 3CMEZ 1TWHI 2DE7A 4EWCA 5AN9F 1VQ9Z 1YIJZ 1K9M2 2JR6A 2P3YA 3J80f 4MD7A 3CCV1 3GTJI 2KI7B 4MXUA 4S1TA 3MONA 3HOUI 1YI2Z 2NAPA 4BY7I 1X3WA 3MZLB 4E31A 2JNYA 1I50I 3I07A 3CD6Z 3OW2Y 3S1QI 1Q812 2E7ZA 5C44I 1VQ61 3NFZA 1M901 3OW2Z 2W04A 3EEDA 4RS4A 3TDHB 2QRDB 2M6NA 2AYDA 1Y1WI 2OTLZ 2Q51A 2DE6A 4XX2A 5D1OA 2QRCB 5D1PA 1SFOI 4NH1C 1TWAI 1QVFY 3HOWI 3PO3S 2M48A 2O53A 2V3VA 3J81f 2OOYB 3GTQI 3P5JB 1QVFZ 2OOXB 3CCRZ 3HKZA 1N8R2 1YJNZ 1PFTA 2GTIA 1VQ71 1JJ2Y 2V8KA 3G6EZ 3CME1 4NFRA 3FQQA 1QVGY 3GTGI 1VQ91 4HGZA 3CCLZ 5FLXb 1QVGZ 2E2II 1JWHC 1YHQZ 2NVYI 1Q822 1YI21 1R9TI 4A93I 3BG1B 3CD61 1Z01A 2NVXI 1KC81 1Q7Y2 3NDIA 2R92I 3CCVZ 3CMA1 2RHBA 1VQO1 3S15I 3CCEZ 1WCMI 2PMZA 2OTL1 2V45A 3HOYI 3CQZI 2DE5A 3QWUA 1FDOA 3S1MI 1Y1VS 3CXCY 2HF1A 4DK1A 2JIRA 4A3CI 4A3GI 1ZB8A 2H85A 4MRIA 4NBAA 1S72Z 3CXCZ 2GTHA 3FKII 3GTKI 3CCR1 1YJN1 1S7MA 3KIFA 2LEXA 1WIIA 3G6E1 3J7A4 3CCL1 5IP9I 3GTMI 1ML8A 3CC7Z 2VPYA 1VQLZ 2E2HI 2E2JI 3HOZI 2VPZA 1Y8CA 2NVQI 5FLXf 1I3QI 4A3FI 1YHQ1 2LIYA 4NOZA 3NH4A 2K3RA 2VF1A 2B63I
chains in the Genus database with same CATH topology
3K7AI 1W2BY 1VQPZ 3U50C 1YJ9Z 2HU9A 2KPIA 3CCE1 1W2BZ 3CCQZ 3CCSZ 4NBBA 3IX0A 1VQKZ 1VQ8Z 4NB9A 1Q861 1VQ4Z 1X0TA 3GTLI 1K732 1RLYA 2F4MA 5IT9b 2YU9I 3PO2I 5T67A 1S721 3CMAZ 3H0GI 1VQOZ 3I56Z 2JA8I 1YITZ 4A3DI 2W03A 3PO3I 3MZKB 1K9M1 2F4OA 3S16I 1LQLA 3CC71 4RVHA 3RZDI 5FLMI 1VQL1 3HOVI 1KD12 3M4OI 2QA4Z 3S1NI 3NH8A 4NBGA 3F3PC 1Z02A 1QF8A 2JA5I 5D1OB 4A3EI 3JAMb 5LL6f 3EERA 3S2HI 1VQP1 1Q811 1RO4A 1YJ91 2R6MA 1RO2A 5C4XI 2ZAEB 1NJI2 3CCQ1 3CCS1 3I55Z 2JA6I 1VQK1 1VQ81 1VQ41 3M3YI 4Y52I 3I4NI 2RPRA 3S1RI 3TE5B 1USPB 4A3II 2E9HA 5IT9f 1M1K1 2IZ4A 3I561 2NVTI 1N8R1 1YIT1 1NP6A 3VMHA 1TFIA 3S17I 1Y1VI 4MH4A 2RT9A 4AYBA 2QEX1 3Q87A 3CC21 3D6WA 4RVDA 4A3MI 2QA41 3I4MI 4HH4A 2AKLA 1Q821 1L1OC 4E2YA 1Z03A 4A3BI 2PK7A 4RVFA 5C3EI 3IF8A 1RNIA 3CCJ1 1YJWZ 1K8A1 1K83I 4BY1I 1Q7Y1 2VUGA 3JAMf 3KIHA 3NH5A 3CCUZ 1I6HI 4NBFA 3VMIA 3I551 5C4JI 1DL6A 1ZH1A 1Q862 5A2Qb 3RZOI 4E2ZA 5T6BA 2JMOA 2K5RA 3D9XA 3IFUA 1VQM1 2IZ3A 1M902 2WAQA 2OTJZ 2R93I 4MONA 3VB9A 4NBEA 3FQMA 4HGYA 1VQNZ 2J6AA 3VTNA 1QYPA 2G2KA 4E30A 2WB1A 4BBSI 3BG0B 3CC41 5IP7I 3LUSA 3GCFA 1VLAA 1TWGI 1KRLA 4BXXI 4Y7NI 1TWFI 2P28A 4NB8A 3T4NB 4E2XA 2QEXZ 1RQFA 1YJW1 3CC2Z 4NBDA 3CCU1 2RBLA 1X3ZA 4CL1A 3CPWY 3GTOI 4QTUA 1RO0A 1N2FA 2QR1B 3GTPI 4E33A 4BBRI 1K731 4E32A 3CPWZ 3CCJZ 1ZB9A 3G71Z 2QREB 1KC82 1NUIA 5A2Qf 2VUMI 4NBCA 3G4SZ 1YUAA 1VQ5Z 2OTJ1 2V8IA 4E2WA 1M1K2 5CM2M 1YUKA 4QTTA 4DQYB 1VQN1 4DGLA 3F3FC 1JJ2Z 2Q4ZA 1YIJ1 1USPA 1VQMZ 1KD11 4MD9A 3CCMZ 4MD8A 2OZKA 4TNUA 3VMGA 4A3LI 3H3VJ 5T64A 3J80b 4X6AI 1K8A2 3CC4Z 3S2DI 2I3CA 1NJI1 3NDJA 3ESWA 2GU2A 2JA7I 2BJOA 3GKQA 3G711 3HOXI 4RV9A 1KQSY 1P9NA 1VQ6Z 3G4S1 3S14I 4NBHA 1VQ51 4RVGA 1TWCI 2EGTA 1KQSZ 2QKDA 2Y0SA 2RIQA 2QLVB 3J81b 2O4HA 4A3KI 4A3JI 2LFUA 3GTMS 3CCM1 2JS4A 1WW9A 1VQ7Z 2R7ZI 2JUBA 2PM9A 2YADA 2V8JA 3CMEZ 1TWHI 2DE7A 4EWCA 5AN9F 1VQ9Z 1YIJZ 1K9M2 2JR6A 2P3YA 3J80f 4MD7A 3CCV1 3GTJI 2KI7B 4MXUA 4S1TA 3MONA 3HOUI 1YI2Z 4BY7I 1X3WA 3MZLB 4E31A 2JNYA 1I50I 3I07A 3CD6Z 3OW2Y 3S1QI 1Q812 5C44I 1VQ61 3NFZA 1M901 3OW2Z 2W04A 3EEDA 4RS4A 3TDHB 2QRDB 2M6NA 1Y1WI 2OTLZ 2Q51A 2DE6A 4XX2A 5D1OA 2QRCB 5D1PA 1SFOI 4NH1C 1TWAI 1QVFY 3HOWI 3PO3S 2M48A 2O53A 3J81f 2OOYB 3GTQI 3P5JB 1QVFZ 2OOXB 3CCRZ 3HKZA 1N8R2 1YJNZ 1PFTA 2GTIA 1VQ71 1JJ2Y 2V8KA 3G6EZ 3CME1 4NFRA 3FQQA 1QVGY 3GTGI 1VQ91 4HGZA 3CCLZ 5FLXb 1QVGZ 2E2II 1JWHC 1YHQZ 2NVYI 1Q822 1YI21 1R9TI 4A93I 3BG1B 3CD61 1Z01A 2NVXI 1KC81 1Q7Y2 3NDIA 2R92I 3CCVZ 3CMA1 2RHBA 1VQO1 3S15I 3CCEZ 1WCMI 2PMZA 2OTL1 2K3RA 3HOYI 3CQZI 2DE5A 3QWUA 3S1MI 1Y1VS 3CXCY 2HF1A 4DK1A 4A3CI 4A3GI 1ZB8A 2H85A 4MRIA 4NBAA 1S72Z 3CXCZ 2GTHA 3FKII 3GTKI 3CCR1 1YJN1 1S7MA 3KIFA 1WIIA 3G6E1 3J7A4 3CCL1 5IP9I 3GTMI 1ML8A 3CC7Z 1VQLZ 2E2HI 2E2JI 3HOZI 2NVQI 5FLXf 1I3QI 1YHQ1 2LIYA 4NOZA 3NH4A 4A3FI 2VF1A 2B63I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B Y;  1VQP Z;  1JJ2 Z;  2OTL Z;  1YIJ 1;  1YJ9 Z;  1Q82 1;  1VQM Z;  1KD1 1;  3CCE 1;  1W2B Z;  3CCQ Z;  3CCS Z;  3CCM Z;  3CCJ 1;  1QVF Y;  1YJW Z;  1K8A 1;  1Q7Y 1;  1VQK Z;  1VQ8 Z;  1Q86 1;  1VQ4 Z;  3CCU Z;  1QVF Z;  1K73 2;  3CCR Z;  3I55 1;  1N8R 2;  1YJN Z;  1K8A 2;  1JJ2 Y;  1VQ7 1;  3G6E Z;  3CC4 Z;  1S72 1;  3CMA Z;  3CME 1;  1Q86 2;  1VQO Z;  3I56 Z;  1NJI 1;  1QVG Y;  1VQ9 1;  1YIT Z;  3CCL Z;  1VQM 1;  1M90 2;  1QVG Z;  2OTJ Z;  3G71 1;  1K9M 1;  1KQS Y;  3CC7 1;  1YHQ Z;  1Q82 2;  3G4S 1;  1YI2 1;  1VQ6 Z;  1VQN Z;  1VQ5 1;  1VQL 1;  1KD1 2;  3CD6 1;  2QA4 Z;  1KQS Z;  1KC8 1;  1Q7Y 2;  3CCV Z;  3CC4 1;  3CMA 1;  1VQO 1;  3CCE Z;  1VQP 1;  2OTL 1;  1Q81 1;  1YJ9 1;  2QEX Z;  3CXC Y;  1NJI 2;  3CCQ 1;  3CCS 1;  3CCM 1;  3I55 Z;  3CC2 Z;  1YJW 1;  1VQ7 Z;  1VQK 1;  1VQ8 1;  1S72 Z;  3CXC Z;  1VQ4 1;  3CCU 1;  3CME Z;  3CCR 1;  1YJN 1;  1VQ9 Z;  1YIJ Z;  1K9M 2;  3CPW Y;  3G6E 1;  3CCV 1;  1M1K 1;  3I56 1;  1K73 1;  3CPW Z;  3CCJ Z;  1N8R 1;  1YIT 1;  3G71 Z;  1KC8 2;  3CCL 1;  3CC7 Z;  3G4S Z;  1YI2 Z;  1VQL Z;  1VQ5 Z;  2OTJ 1;  2QEX 1;  1M1K 2;  3CD6 Z;  3OW2 Y;  3CC2 1;  1Q81 2;  1YHQ 1;  1VQ6 1;  1VQN 1;  1M90 1;  3OW2 Z;  2QA4 1; 
#chains in the Genus database with same CATH topology
 3K7A I;  1W2B Y;  1VQP Z;  3U50 C;  1YJ9 Z;  2HU9 A;  2KPI A;  3CCE 1;  1SIW A;  1W2B Z;  3CCQ Z;  3CCS Z;  2IV2 X;  4NBB A;  3IX0 A;  1VQK Z;  1VQ8 Z;  4NB9 A;  1Q86 1;  1VQ4 Z;  1X0T A;  3GTL I;  1K73 2;  1RLY A;  2F4M A;  5IT9 b;  2YU9 I;  3PO2 I;  5T67 A;  1S72 1;  3CMA Z;  3H0G I;  1VQO Z;  3I56 Z;  2JA8 I;  1YIT Z;  4A3D I;  2W03 A;  3PO3 I;  3MZK B;  1K9M 1;  2F4O A;  3S16 I;  1LQL A;  3CC7 1;  4RVH A;  3RZD I;  5FLM I;  1VQL 1;  3HOV I;  1KD1 2;  3M4O I;  2QA4 Z;  3S1N I;  3NH8 A;  4NBG A;  1Q16 A;  3F3P C;  1Z02 A;  1QF8 A;  2JA5 I;  5D1O B;  4A3E I;  3JAM b;  5LL6 f;  3EER A;  3S2H I;  1VQP 1;  1Q81 1;  1RO4 A;  1YJ9 1;  2R6M A;  1RO2 A;  5C4X I;  2ZAE B;  2VPX A;  1NJI 2;  3CCQ 1;  3CCS 1;  3I55 Z;  2JA6 I;  1VQK 1;  1VQ8 1;  1VQ4 1;  3M3Y I;  4Y52 I;  3I4N I;  2RPR A;  3S1R I;  3TE5 B;  1USP B;  4A3I I;  2E9H A;  5IT9 f;  1M1K 1;  2IZ4 A;  3I56 1;  2NVT I;  1N8R 1;  1YIT 1;  1NP6 A;  1FDI A;  3VMH A;  1TFI A;  3S17 I;  1Y1V I;  4MH4 A;  2RT9 A;  4AYB A;  2QEX 1;  3Q87 A;  3CC2 1;  3D6W A;  4RVD A;  4A3M I;  2QA4 1;  3I4M I;  1WJ2 A;  4HH4 A;  2JIM A;  2AKL A;  1Q82 1;  1L1O C;  4E2Y A;  1Z03 A;  4A3B I;  2PK7 A;  4RVF A;  5C3E I;  3IF8 A;  1RNI A;  3CCJ 1;  1YJW Z;  1K8A 1;  1K83 I;  1AA6 A;  4BY1 I;  1Q7Y 1;  2VUG A;  3JAM f;  3KIH A;  3NH5 A;  3CCU Z;  1I6H I;  4NBF A;  3VMI A;  3I55 1;  2JIQ A;  5C4J I;  1DL6 A;  2VPW A;  1ZH1 A;  1Q86 2;  5A2Q b;  3RZO I;  4E2Z A;  5T6B A;  2JMO A;  2K5R A;  3D9X A;  3IFU A;  1VQM 1;  2IZ3 A;  1M90 2;  2WAQ A;  2OTJ Z;  2R93 I;  4MON A;  3VB9 A;  4NBE A;  3FQM A;  4HGY A;  1VQN Z;  2J6A A;  3VTN A;  3D2L A;  1QYP A;  2G2K A;  4E30 A;  2WB1 A;  4BBS I;  3BG0 B;  3CC4 1;  5IP7 I;  3LUS A;  3GCF A;  1VLA A;  1TWG I;  1KRL A;  4BXX I;  2JIP A;  4Y7N I;  1TWF I;  2P28 A;  4NB8 A;  2QEX Z;  3T4N B;  4E2X A;  1RQF A;  1YJW 1;  3CC2 Z;  4NBD A;  3CCU 1;  2RBL A;  1X3Z A;  4CL1 A;  3CPW Y;  3GTO I;  4QTU A;  1RO0 A;  1N2F A;  2QR1 B;  3GTP I;  4E33 A;  4BBR I;  1K73 1;  4E32 A;  3CPW Z;  3CCJ Z;  1ZB9 A;  3G71 Z;  2QRE B;  1KC8 2;  1NUI A;  5A2Q f;  2VUM I;  4NBC A;  3G4S Z;  1YUA A;  1VQ5 Z;  2OTJ 1;  2V8I A;  4E2W A;  1M1K 2;  5CM2 M;  3IR7 A;  1YUK A;  4QTT A;  4DQY B;  1VQN 1;  4DGL A;  3F3F C;  1JJ2 Z;  2Q4Z A;  1YIJ 1;  1USP A;  1VQM Z;  1KD1 1;  4MD9 A;  1QXF A;  3CCM Z;  4MD8 A;  2OZK A;  4TNU A;  3VMG A;  4A3L I;  3H3V J;  5T64 A;  3J80 b;  4X6A I;  1K8A 2;  3CC4 Z;  3S2D I;  2I3C A;  1NJI 1;  3NDJ A;  3ESW A;  2GU2 A;  2JA7 I;  2BJO A;  3GKQ A;  3G71 1;  3HOX I;  4RV9 A;  1KQS Y;  1P9N A;  1VQ6 Z;  3G4S 1;  3S14 I;  4NBH A;  1VQ5 1;  4RVG A;  1TWC I;  2EGT A;  1KQS Z;  2QKD A;  2Y0S A;  2RIQ A;  2QLV B;  3J81 b;  2O4H A;  4A3K I;  4A3J I;  2LFU A;  3GTM S;  3CCM 1;  2JS4 A;  1WW9 A;  2JIO A;  1VQ7 Z;  2R7Z I;  2JUB A;  1WZN A;  2PM9 A;  2YAD A;  2V8J A;  3CME Z;  1TWH I;  2DE7 A;  4EWC A;  5AN9 F;  1VQ9 Z;  1YIJ Z;  1K9M 2;  2JR6 A;  2P3Y A;  3J80 f;  4MD7 A;  3CCV 1;  3GTJ I;  2KI7 B;  4MXU A;  4S1T A;  3MON A;  3HOU I;  1YI2 Z;  2NAP A;  4BY7 I;  1X3W A;  3MZL B;  4E31 A;  2JNY A;  1I50 I;  3I07 A;  3CD6 Z;  3OW2 Y;  3S1Q I;  1Q81 2;  2E7Z A;  5C44 I;  1VQ6 1;  3NFZ A;  1M90 1;  3OW2 Z;  2W04 A;  3EED A;  4RS4 A;  3TDH B;  2QRD B;  2M6N A;  2AYD A;  1Y1W I;  2OTL Z;  2Q51 A;  2DE6 A;  4XX2 A;  5D1O A;  2QRC B;  5D1P A;  1SFO I;  4NH1 C;  1TWA I;  1QVF Y;  3HOW I;  3PO3 S;  2M48 A;  2O53 A;  2V3V A;  3J81 f;  2OOY B;  3GTQ I;  3P5J B;  1QVF Z;  2OOX B;  3CCR Z;  3HKZ A;  1N8R 2;  1YJN Z;  1PFT A;  2GTI A;  1VQ7 1;  1JJ2 Y;  2V8K A;  3G6E Z;  3CME 1;  4NFR A;  3FQQ A;  1QVG Y;  3GTG I;  1VQ9 1;  4HGZ A;  3CCL Z;  5FLX b;  1QVG Z;  2E2I I;  1JWH C;  1YHQ Z;  2NVY I;  1Q82 2;  1YI2 1;  1R9T I;  4A93 I;  3BG1 B;  3CD6 1;  1Z01 A;  2NVX I;  1KC8 1;  1Q7Y 2;  3NDI A;  2R92 I;  3CCV Z;  3CMA 1;  2RHB A;  1VQO 1;  3S15 I;  3CCE Z;  1WCM I;  2PMZ A;  2OTL 1;  2V45 A;  3HOY I;  3CQZ I;  2DE5 A;  3QWU A;  1FDO A;  3S1M I;  1Y1V S;  3CXC Y;  2HF1 A;  4DK1 A;  2JIR A;  4A3C I;  4A3G I;  1ZB8 A;  2H85 A;  4MRI A;  4NBA A;  1S72 Z;  3CXC Z;  2GTH A;  3FKI I;  3GTK I;  3CCR 1;  1YJN 1;  1S7M A;  3KIF A;  2LEX A;  1WII A;  3G6E 1;  3J7A 4;  3CCL 1;  5IP9 I;  3GTM I;  1ML8 A;  3CC7 Z;  2VPY A;  1VQL Z;  2E2H I;  2E2J I;  3HOZ I;  2VPZ A;  1Y8C A;  2NVQ I;  5FLX f;  1I3Q I;  4A3F I;  1YHQ 1;  2LIY A;  4NOZ A;  3NH4 A;  2K3R A;  2VF1 A;  2B63 I; 
#chains in the Genus database with same CATH homology
 3K7A I;  1W2B Y;  1VQP Z;  3U50 C;  1YJ9 Z;  2HU9 A;  2KPI A;  3CCE 1;  1W2B Z;  3CCQ Z;  3CCS Z;  4NBB A;  3IX0 A;  1VQK Z;  1VQ8 Z;  4NB9 A;  1Q86 1;  1VQ4 Z;  1X0T A;  3GTL I;  1K73 2;  1RLY A;  2F4M A;  5IT9 b;  2YU9 I;  3PO2 I;  5T67 A;  1S72 1;  3CMA Z;  3H0G I;  1VQO Z;  3I56 Z;  2JA8 I;  1YIT Z;  4A3D I;  2W03 A;  3PO3 I;  3MZK B;  1K9M 1;  2F4O A;  3S16 I;  1LQL A;  3CC7 1;  4RVH A;  3RZD I;  5FLM I;  1VQL 1;  3HOV I;  1KD1 2;  3M4O I;  2QA4 Z;  3S1N I;  3NH8 A;  4NBG A;  3F3P C;  1Z02 A;  1QF8 A;  2JA5 I;  5D1O B;  4A3E I;  3JAM b;  5LL6 f;  3EER A;  3S2H I;  1VQP 1;  1Q81 1;  1RO4 A;  1YJ9 1;  2R6M A;  1RO2 A;  5C4X I;  2ZAE B;  1NJI 2;  3CCQ 1;  3CCS 1;  3I55 Z;  2JA6 I;  1VQK 1;  1VQ8 1;  1VQ4 1;  3M3Y I;  4Y52 I;  3I4N I;  2RPR A;  3S1R I;  3TE5 B;  1USP B;  4A3I I;  2E9H A;  5IT9 f;  1M1K 1;  2IZ4 A;  3I56 1;  2NVT I;  1N8R 1;  1YIT 1;  1NP6 A;  3VMH A;  1TFI A;  3S17 I;  1Y1V I;  4MH4 A;  2RT9 A;  4AYB A;  2QEX 1;  3Q87 A;  3CC2 1;  3D6W A;  4RVD A;  4A3M I;  2QA4 1;  3I4M I;  4HH4 A;  2AKL A;  1Q82 1;  1L1O C;  4E2Y A;  1Z03 A;  4A3B I;  2PK7 A;  4RVF A;  5C3E I;  3IF8 A;  1RNI A;  3CCJ 1;  1YJW Z;  1K8A 1;  1K83 I;  4BY1 I;  1Q7Y 1;  2VUG A;  3JAM f;  3KIH A;  3NH5 A;  3CCU Z;  1I6H I;  4NBF A;  3VMI A;  3I55 1;  5C4J I;  1DL6 A;  1ZH1 A;  1Q86 2;  5A2Q b;  3RZO I;  4E2Z A;  5T6B A;  2JMO A;  2K5R A;  3D9X A;  3IFU A;  1VQM 1;  2IZ3 A;  1M90 2;  2WAQ A;  2OTJ Z;  2R93 I;  4MON A;  3VB9 A;  4NBE A;  3FQM A;  4HGY A;  1VQN Z;  2J6A A;  3VTN A;  1QYP A;  2G2K A;  4E30 A;  2WB1 A;  4BBS I;  3BG0 B;  3CC4 1;  5IP7 I;  3LUS A;  3GCF A;  1VLA A;  1TWG I;  1KRL A;  4BXX I;  4Y7N I;  1TWF I;  2P28 A;  4NB8 A;  3T4N B;  4E2X A;  2QEX Z;  1RQF A;  1YJW 1;  3CC2 Z;  4NBD A;  3CCU 1;  2RBL A;  1X3Z A;  4CL1 A;  3CPW Y;  3GTO I;  4QTU A;  1RO0 A;  1N2F A;  2QR1 B;  3GTP I;  4E33 A;  4BBR I;  1K73 1;  4E32 A;  3CPW Z;  3CCJ Z;  1ZB9 A;  3G71 Z;  2QRE B;  1KC8 2;  1NUI A;  5A2Q f;  2VUM I;  4NBC A;  3G4S Z;  1YUA A;  1VQ5 Z;  2OTJ 1;  2V8I A;  4E2W A;  1M1K 2;  5CM2 M;  1YUK A;  4QTT A;  4DQY B;  1VQN 1;  4DGL A;  3F3F C;  1JJ2 Z;  2Q4Z A;  1YIJ 1;  1USP A;  1VQM Z;  1KD1 1;  4MD9 A;  3CCM Z;  4MD8 A;  2OZK A;  4TNU A;  3VMG A;  4A3L I;  3H3V J;  5T64 A;  3J80 b;  4X6A I;  1K8A 2;  3CC4 Z;  3S2D I;  2I3C A;  1NJI 1;  3NDJ A;  3ESW A;  2GU2 A;  2JA7 I;  2BJO A;  3GKQ A;  3G71 1;  3HOX I;  4RV9 A;  1KQS Y;  1P9N A;  1VQ6 Z;  3G4S 1;  3S14 I;  4NBH A;  1VQ5 1;  4RVG A;  1TWC I;  2EGT A;  1KQS Z;  2QKD A;  2Y0S A;  2RIQ A;  2QLV B;  3J81 b;  2O4H A;  4A3K I;  4A3J I;  2LFU A;  3GTM S;  3CCM 1;  2JS4 A;  1WW9 A;  1VQ7 Z;  2R7Z I;  2JUB A;  2PM9 A;  2YAD A;  2V8J A;  3CME Z;  1TWH I;  2DE7 A;  4EWC A;  5AN9 F;  1VQ9 Z;  1YIJ Z;  1K9M 2;  2JR6 A;  2P3Y A;  3J80 f;  4MD7 A;  3CCV 1;  3GTJ I;  2KI7 B;  4MXU A;  4S1T A;  3MON A;  3HOU I;  1YI2 Z;  4BY7 I;  1X3W A;  3MZL B;  4E31 A;  2JNY A;  1I50 I;  3I07 A;  3CD6 Z;  3OW2 Y;  3S1Q I;  1Q81 2;  5C44 I;  1VQ6 1;  3NFZ A;  1M90 1;  3OW2 Z;  2W04 A;  3EED A;  4RS4 A;  3TDH B;  2QRD B;  2M6N A;  1Y1W I;  2OTL Z;  2Q51 A;  2DE6 A;  4XX2 A;  5D1O A;  2QRC B;  5D1P A;  1SFO I;  4NH1 C;  1TWA I;  1QVF Y;  3HOW I;  3PO3 S;  2M48 A;  2O53 A;  3J81 f;  2OOY B;  3GTQ I;  3P5J B;  1QVF Z;  2OOX B;  3CCR Z;  3HKZ A;  1N8R 2;  1YJN Z;  1PFT A;  2GTI A;  1VQ7 1;  1JJ2 Y;  2V8K A;  3G6E Z;  3CME 1;  4NFR A;  3FQQ A;  1QVG Y;  3GTG I;  1VQ9 1;  4HGZ A;  3CCL Z;  5FLX b;  1QVG Z;  2E2I I;  1JWH C;  1YHQ Z;  2NVY I;  1Q82 2;  1YI2 1;  1R9T I;  4A93 I;  3BG1 B;  3CD6 1;  1Z01 A;  2NVX I;  1KC8 1;  1Q7Y 2;  3NDI A;  2R92 I;  3CCV Z;  3CMA 1;  2RHB A;  1VQO 1;  3S15 I;  3CCE Z;  1WCM I;  2PMZ A;  2OTL 1;  2K3R A;  3HOY I;  3CQZ I;  2DE5 A;  3QWU A;  3S1M I;  1Y1V S;  3CXC Y;  2HF1 A;  4DK1 A;  4A3C I;  4A3G I;  1ZB8 A;  2H85 A;  4MRI A;  4NBA A;  1S72 Z;  3CXC Z;  2GTH A;  3FKI I;  3GTK I;  3CCR 1;  1YJN 1;  1S7M A;  3KIF A;  1WII A;  3G6E 1;  3J7A 4;  3CCL 1;  5IP9 I;  3GTM I;  1ML8 A;  3CC7 Z;  1VQL Z;  2E2H I;  2E2J I;  3HOZ I;  2NVQ I;  5FLX f;  1I3Q I;  1YHQ 1;  2LIY A;  4NOZ A;  3NH4 A;  4A3F I;  2VF1 A;  2B63 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...