3G6E1

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g6e100
3G6E1 1VQ4Z 1QVFZ 1VQO1 1YHQ1 1YJWZ 2OTLZ 1N8R1 3CCQ1 3G71Z 3CXCY 1W2BZ 1KD11 1YIJ1 3CCEZ 1Q7Y2 1VQL1 1NJI2 3CCL1 1KQSZ 1KC82 3CC7Z 1VQ5Z 1VQPZ 3CCJZ 2OTJ1 3CCVZ 1YJNZ 1VQ8Z 1Q821 3CXCZ 3I55Z 2QA41 3I56Z 3CCSZ 1YI21 3CCQZ 3CCMZ 1S72Z 1M901 1YITZ 3CMAZ 3CPWZ 3CD61 1Q812 1VQ71 1VQMZ 1YIJZ 3CCRZ 1VQ6Z 1VQKZ 1VQN1 1M1K1 1Q822 3CME1 1VQ41 3CCUZ 3CC21 3CCV1 1QVGZ 1VQOZ 1YJN1 1VQ81 1Q861 1K732 3CPWY 3G4SZ 3I551 1VQ91 1KC81 1YJW1 3I561 1K8A2 2OTL1 1YJ9Z 3G711 1YI2Z 1K9M2 1KQSY 3CCM1 3CD6Z 1VQM1 3CCE1 1VQLZ 1JJ2Y 1VQK1 3CCU1 3CC4Z 3CC71 2QEX1 1VQ51 3G6EZ 1JJ2Z 1Q811 2OTJZ 1K8A1 3CC2Z 1W2BY 1YHQZ 1M1K2 1NJI1 3G4S1 1VQ9Z 3CCS1 2QA4Z 1YIT1 1YJ91 3CMA1 1S721 1VQ7Z 1QVFY 1N8R2 1Q862 1QVGY 1K731 3CCR1 3CCLZ 1VQ61 3OW2Y 1VQNZ 1KD12 1VQP1 3CMEZ 3CC41 3CCJ1 1K9M1 1Q7Y1 2QEXZ 3OW2Z 1M902
chains in the Genus database with same CATH superfamily
2OOXB 2V8IA 3G6E1 1P9NA 3GTQI 2JMOA 4A3EI 1VQO1 4RVHA 2JA6I 4A3BI 2OTLZ 1N8R1 3GTMI 3S2DI 1ZB8A 3S2HI 3GCFA 2Q4ZA 4Y52I 1TWHI 3PO3I 1Q7Y2 1NP6A 1NJI2 1KQSZ 3I4NI 3CC7Z 2VUGA 3KIFA 3TDHB 3CCJZ 5IT9f 4NFRA 3CCVZ 4DQYB 2JS4A 3I55Z 1N2FA 4DK1A 4A3MI 2E7ZA 4A3CI 3CCMZ 1YITZ 3FQMA 4MRIA 1YIJZ 4NBEA 1VQKZ 1Q822 4A3JI 4DGLA 1Z02A 2DE5A 2JR6A 1VQ81 3BG0B 3M3YI 4RVFA 1YJW1 5C3EI 4MD9A 1K9M2 1SIWA 2JIOA 2QR1B 3TE5B 4E2WA 2E2JI 3CCE1 1WIIA 1JJ2Y 2JIQA 1VQK1 2QEX1 1RNIA 3G6EZ 1JJ2Z 4CL1A 1USPA 1WZNA 3JAMf 1QF8A 1NJI1 3D6WA 2E9HA 1VQ7Z 1QVFY 4MD7A 1RO2A 3M4OI 3EEDA 1JWHC 3OW2Y 3NFZA 5CM2M 2NVTI 4A3II 2YU9I 4A3LI 1RLYA 4E2XA 2IZ3A 1RO4A 1Y1WI 1YJWZ 1Q16A 3G71Z 3VMHA 3CXCY 1PFTA 3FKII 1YIJ1 1VQL1 3GTPI 2PMZA 3IFUA 2KPIA 3NDIA 4NBDA 3S17I 4RV9A 2W03A 2OTJ1 1YJNZ 1VQ8Z 5D1PA 1X3WA 3CXCZ 4BY1I 2DE7A 1VLAA 2P28A 2QA41 2I3CA 3I56Z 1S7MA 1I6HI 3CMAZ 1USPB 2PM9A 3CPWZ 1YUAA 4MONA 2P3YA 3RZOI 3PO2I 1VQ6Z 1VQN1 3HOUI 3CQZI 1RO0A 1RQFA 3HOVI 2VPZA 4RVDA 3S1RI 1VQOZ 1YJN1 2R6MA 1K732 3CPWY 2VPXA 3IR7A 1Y1VS 2HF1A 3I561 3G711 1YI2Z 1KQSY 2R93I 3VTNA 4HGZA 3GTKI 2VF1A 3T4NB 4EWCA 3S16I 2JA7I 2JNYA 1L1OC 2K3RA 3CC4Z 3KIHA 1VQ51 5FLXf 1Q811 2E2II 2JIMA 4NBHA 1M1K2 2JA5I 1Z03A 2W04A 1WCMI 3VMIA 1YIT1 2JUBA 3CMA1 1S721 4NBAA 4NH1C 2V45A 4E30A 1K731 2VPWA 1VQ61 1VQNZ 3PO3S 4MD8A 3Q87A 3CC41 4E32A 1Q7Y1 2ZAEB 4BBRI 5IP7I 2EGTA 3HKZA 2E2HI 1QVFZ 1FDOA 3VMGA 2NAPA 1YHQ1 4RS4A 2NVXI 3CCQ1 5C4XI 3D9XA 3I07A 2OZKA 4X6AI 3NH8A 3VB9A 1KD11 3CCEZ 2GTIA 3CCL1 1AA6A 3GKQA 3J81f 3MZKB 1VQ5Z 2RIQA 5LL6f 2J6AA 3HOZI 2G2KA 3P5JB 4AYBA 2VUMI 1NUIA 4BY7I 2AYDA 3S1QI 1WW9A 1YI21 3CCQZ 3NH5A 1M901 3GTMS 1I50I 1Q812 4NOZA 2GU2A 2LEXA 3IX0A 1M1K1 4E2ZA 1X0TA 3S14I 3CME1 3CCUZ 3CC21 1QVGZ 4NBGA 4Y7NI 4E2YA 1Q861 3G4SZ 1VQ91 1QXFA 2QRCB 1YUKA 3U50C 4NBCA 3JAMb 2IZ4A 4BBSI 1K8A2 2OTL1 2JIPA 2LFUA 2LIYA 2OOYB 2RT9A 4QTTA 2BJOA 4A3DI 2QLVB 3CD6Z 1VQM1 1QYPA 2WAQA 5T67A 1TWAI 3CC71 1DL6A 3RZDI 1I3QI 2QRDB 5FLMI 3CC2Z 4TNUA 1YHQZ 2NVYI 3EERA 4QTUA 3G4S1 1VQ9Z 1FDIA 3QWUA 2JIRA 4RVGA 2V3VA 5IP9I 1YJ91 2B63I 4NBBA 1N8R2 1K83I 1Z01A 3J81b 1Q862 1QVGY 3CCLZ 5C4JI 2RBLA 2HU9A 2GTHA 4MH4A 5A2Qf 3GTGI 2F4MA 1TFIA 3OW2Z 3CCU1 1M902 1VQ4Z 2M48A 2QREB 2R92I 1SFOI 4E31A 3HOWI 2M6NA 5FLXb 3GTLI 5T6BA 3F3PC 3ESWA 4A3KI 3HOXI 3J7A4 5D1OB 1ML8A 3NH4A 2V8JA 4E33A 1R9TI 1W2BZ 2QKDA 2KI7B 5A2Qb 2PK7A 1KC82 3K7AI 2H85A 1VQPZ 2YADA 3S1NI 2RHBA 3LUSA 4XX2A 4S1TA 3GTOI 1Q821 2NVQI 2Y0SA 1TWFI 1TWGI 3HOYI 2O53A 2K5RA 3CCSZ 3S15I 1KRLA 1S72Z 3CD61 1VQ71 3J80b 1VQMZ 3CCRZ 1ZH1A 4A3FI 2RPRA 4NB8A 3MZLB 3FQQA 1VQ41 3F3FC 3H3VJ 3BG1B 3CCV1 2DE6A 4BXXI 5C44I 4A93I 5IT9b 3I551 1KC81 3GTJI 2AKLA 3J80f 4NB9A 1YJ9Z 3CCM1 3NDJA 5AN9F 3MONA 4A3GI 1TWCI 2IV2X 1VQLZ 2JA8I 4HH4A 1WJ2A 5D1OA 2WB1A 1Y1VI 1K8A1 3IF8A 2OTJZ 1W2BY 3I4MI 2VPYA 2F4OA 4MXUA 3CCS1 2R7ZI 2QA4Z 2O4HA 2V8KA 1X3ZA 2Q51A 1LQLA 4NBFA 4HGYA 1ZB9A 3CCR1 3D2LA 3H0GI 1Y8CA 1KD12 1VQP1 3CMEZ 3S1MI 3CCJ1 1K9M1 5T64A 2QEXZ
chains in the Genus database with same CATH topology
2OOXB 2V8IA 3G6E1 1P9NA 3GTQI 2JMOA 4A3EI 1VQO1 4RVHA 2JA6I 4A3BI 2OTLZ 1N8R1 3GTMI 3S2DI 1ZB8A 3S2HI 3GCFA 2Q4ZA 4Y52I 1TWHI 3PO3I 1Q7Y2 1NP6A 1NJI2 1KQSZ 3I4NI 3CC7Z 2VUGA 3KIFA 3TDHB 3CCJZ 5IT9f 4NFRA 3CCVZ 4DQYB 2JS4A 3I55Z 1N2FA 4DK1A 4A3MI 4A3CI 3CCMZ 1YITZ 3FQMA 4MRIA 1YIJZ 4NBEA 1VQKZ 1Q822 4A3JI 4DGLA 1Z02A 2DE5A 2JR6A 1VQ81 3BG0B 3M3YI 4RVFA 1YJW1 5C3EI 4MD9A 1K9M2 2QR1B 3TE5B 4E2WA 2E2JI 3CCE1 1WIIA 1JJ2Y 1VQK1 2QEX1 1RNIA 3G6EZ 1JJ2Z 4CL1A 1USPA 3JAMf 1QF8A 1NJI1 3D6WA 2E9HA 1VQ7Z 1QVFY 4MD7A 1RO2A 3M4OI 3EEDA 1JWHC 3OW2Y 3NFZA 5CM2M 2NVTI 4A3II 2YU9I 4A3LI 1RLYA 4E2XA 2IZ3A 1RO4A 1Y1WI 1YJWZ 3G71Z 3VMHA 3CXCY 1PFTA 3FKII 1YIJ1 1VQL1 3GTPI 2PMZA 3IFUA 2KPIA 3NDIA 4NBDA 3S17I 4RV9A 2W03A 2OTJ1 1YJNZ 1VQ8Z 5D1PA 1X3WA 3CXCZ 4BY1I 2DE7A 1VLAA 2P28A 2QA41 2I3CA 3I56Z 1S7MA 1I6HI 3CMAZ 1USPB 2PM9A 3CPWZ 1YUAA 4MONA 2P3YA 3RZOI 3PO2I 1VQ6Z 1VQN1 3HOUI 3CQZI 1RO0A 1RQFA 3HOVI 4RVDA 3S1RI 1VQOZ 1YJN1 2R6MA 1K732 3CPWY 1Y1VS 2HF1A 3I561 3G711 1YI2Z 1KQSY 2R93I 3VTNA 4HGZA 3GTKI 2VF1A 3T4NB 4EWCA 3S16I 2JA7I 2JNYA 1L1OC 2K3RA 3CC4Z 3KIHA 1VQ51 5FLXf 1Q811 2E2II 4NBHA 1M1K2 2JA5I 1Z03A 2W04A 1WCMI 3VMIA 1YIT1 2JUBA 3CMA1 1S721 4NBAA 4NH1C 4E30A 1K731 1VQ61 1VQNZ 3PO3S 4MD8A 3Q87A 3CC41 4E32A 1Q7Y1 2ZAEB 4BBRI 5IP7I 2EGTA 3HKZA 2E2HI 1QVFZ 3VMGA 1YHQ1 4RS4A 2NVXI 3CCQ1 5C4XI 3D9XA 3I07A 2OZKA 4X6AI 3NH8A 3VB9A 1KD11 3CCEZ 2GTIA 3CCL1 3GKQA 3J81f 3MZKB 1VQ5Z 2RIQA 5LL6f 2J6AA 3HOZI 2G2KA 3P5JB 4AYBA 2VUMI 1NUIA 4BY7I 3S1QI 1WW9A 1YI21 3CCQZ 3NH5A 1M901 3GTMS 1I50I 1Q812 4NOZA 2GU2A 3IX0A 1M1K1 4E2ZA 1X0TA 3S14I 3CME1 3CCUZ 3CC21 1QVGZ 4NBGA 4Y7NI 4E2YA 1Q861 3G4SZ 1VQ91 2QRCB 1YUKA 3U50C 4NBCA 3JAMb 2IZ4A 4BBSI 1K8A2 2OTL1 2LFUA 2LIYA 2OOYB 2RT9A 4QTTA 2BJOA 4A3DI 2QLVB 3CD6Z 1VQM1 1QYPA 2WAQA 5T67A 1TWAI 3CC71 1DL6A 3RZDI 1I3QI 2QRDB 5FLMI 3CC2Z 4TNUA 1YHQZ 2NVYI 3EERA 4QTUA 3G4S1 1VQ9Z 3QWUA 4RVGA 5IP9I 1YJ91 2B63I 4NBBA 1N8R2 1K83I 1Q862 1Z01A 3J81b 1QVGY 3CCLZ 5C4JI 2RBLA 2HU9A 2GTHA 4MH4A 5A2Qf 3GTGI 2F4MA 1TFIA 3OW2Z 3CCU1 1M902 1VQ4Z 2M48A 2QREB 2R92I 1SFOI 4E31A 3HOWI 2M6NA 5FLXb 3GTLI 5T6BA 3F3PC 3ESWA 4A3KI 3HOXI 3J7A4 5D1OB 1ML8A 3NH4A 2V8JA 4E33A 1R9TI 1W2BZ 2QKDA 2KI7B 5A2Qb 2PK7A 1KC82 3K7AI 2H85A 1VQPZ 2YADA 3S1NI 2RHBA 3LUSA 4XX2A 4S1TA 3GTOI 1Q821 2NVQI 2Y0SA 1TWFI 1TWGI 3HOYI 2O53A 2K5RA 3CCSZ 3S15I 1KRLA 1S72Z 3CD61 1VQ71 3J80b 1VQMZ 3CCRZ 1ZH1A 4A3FI 2RPRA 4NB8A 3MZLB 3FQQA 1VQ41 3F3FC 3H3VJ 3BG1B 3CCV1 2DE6A 4BXXI 5C44I 4A93I 5IT9b 3I551 1KC81 3GTJI 2AKLA 3J80f 4NB9A 1YJ9Z 3CCM1 3NDJA 5AN9F 3MONA 4A3GI 1TWCI 1VQLZ 2JA8I 4HH4A 5D1OA 2WB1A 1Y1VI 1K8A1 3IF8A 2OTJZ 1W2BY 3I4MI 2F4OA 4MXUA 3CCS1 2R7ZI 2QA4Z 2O4HA 2V8KA 1X3ZA 2Q51A 1LQLA 4NBFA 4HGYA 1ZB9A 3CCR1 3H0GI 1KD12 1VQP1 3CMEZ 3S1MI 3CCJ1 1K9M1 5T64A 2QEXZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E 1;  1VQ4 Z;  1QVF Z;  1VQO 1;  1YHQ 1;  1YJW Z;  2OTL Z;  1N8R 1;  3CCQ 1;  3G71 Z;  3CXC Y;  1W2B Z;  1KD1 1;  1YIJ 1;  3CCE Z;  1Q7Y 2;  1VQL 1;  1NJI 2;  3CCL 1;  1KQS Z;  1KC8 2;  3CC7 Z;  1VQ5 Z;  1VQP Z;  3CCJ Z;  2OTJ 1;  3CCV Z;  1YJN Z;  1VQ8 Z;  1Q82 1;  3CXC Z;  3I55 Z;  2QA4 1;  3I56 Z;  3CCS Z;  1YI2 1;  3CCQ Z;  3CCM Z;  1S72 Z;  1M90 1;  1YIT Z;  3CMA Z;  3CPW Z;  3CD6 1;  1Q81 2;  1VQ7 1;  1VQM Z;  1YIJ Z;  3CCR Z;  1VQ6 Z;  1VQK Z;  1VQN 1;  1M1K 1;  1Q82 2;  3CME 1;  1VQ4 1;  3CCU Z;  3CC2 1;  3CCV 1;  1QVG Z;  1VQO Z;  1YJN 1;  1VQ8 1;  1Q86 1;  1K73 2;  3CPW Y;  3G4S Z;  3I55 1;  1VQ9 1;  1KC8 1;  1YJW 1;  3I56 1;  1K8A 2;  2OTL 1;  1YJ9 Z;  3G71 1;  1YI2 Z;  1K9M 2;  1KQS Y;  3CCM 1;  3CD6 Z;  1VQM 1;  3CCE 1;  1VQL Z;  1JJ2 Y;  1VQK 1;  3CCU 1;  3CC4 Z;  3CC7 1;  2QEX 1;  1VQ5 1;  3G6E Z;  1JJ2 Z;  1Q81 1;  2OTJ Z;  1K8A 1;  3CC2 Z;  1W2B Y;  1YHQ Z;  1M1K 2;  1NJI 1;  3G4S 1;  1VQ9 Z;  3CCS 1;  2QA4 Z;  1YIT 1;  1YJ9 1;  3CMA 1;  1S72 1;  1VQ7 Z;  1QVF Y;  1N8R 2;  1Q86 2;  1QVG Y;  1K73 1;  3CCR 1;  3CCL Z;  1VQ6 1;  3OW2 Y;  1VQN Z;  1KD1 2;  1VQP 1;  3CME Z;  3CC4 1;  3CCJ 1;  1K9M 1;  1Q7Y 1;  2QEX Z;  3OW2 Z;  1M90 2; 
#chains in the Genus database with same CATH topology
 2OOX B;  2V8I A;  3G6E 1;  1P9N A;  3GTQ I;  2JMO A;  4A3E I;  1VQO 1;  4RVH A;  2JA6 I;  4A3B I;  2OTL Z;  1N8R 1;  3GTM I;  3S2D I;  1ZB8 A;  3S2H I;  3GCF A;  2Q4Z A;  4Y52 I;  1TWH I;  3PO3 I;  1Q7Y 2;  1NP6 A;  1NJI 2;  1KQS Z;  3I4N I;  3CC7 Z;  2VUG A;  3KIF A;  3TDH B;  3CCJ Z;  5IT9 f;  4NFR A;  3CCV Z;  4DQY B;  2JS4 A;  3I55 Z;  1N2F A;  4DK1 A;  4A3M I;  2E7Z A;  4A3C I;  3CCM Z;  1YIT Z;  3FQM A;  4MRI A;  1YIJ Z;  4NBE A;  1VQK Z;  1Q82 2;  4A3J I;  4DGL A;  1Z02 A;  2DE5 A;  2JR6 A;  1VQ8 1;  3BG0 B;  3M3Y I;  4RVF A;  1YJW 1;  5C3E I;  4MD9 A;  1K9M 2;  1SIW A;  2JIO A;  2QR1 B;  3TE5 B;  4E2W A;  2E2J I;  3CCE 1;  1WII A;  1JJ2 Y;  2JIQ A;  1VQK 1;  2QEX 1;  1RNI A;  3G6E Z;  1JJ2 Z;  4CL1 A;  1USP A;  1WZN A;  3JAM f;  1QF8 A;  1NJI 1;  3D6W A;  2E9H A;  1VQ7 Z;  1QVF Y;  4MD7 A;  1RO2 A;  3M4O I;  3EED A;  1JWH C;  3OW2 Y;  3NFZ A;  5CM2 M;  2NVT I;  4A3I I;  2YU9 I;  4A3L I;  1RLY A;  4E2X A;  2IZ3 A;  1RO4 A;  1Y1W I;  1YJW Z;  1Q16 A;  3G71 Z;  3VMH A;  3CXC Y;  1PFT A;  3FKI I;  1YIJ 1;  1VQL 1;  3GTP I;  2PMZ A;  3IFU A;  2KPI A;  3NDI A;  4NBD A;  3S17 I;  4RV9 A;  2W03 A;  2OTJ 1;  1YJN Z;  1VQ8 Z;  5D1P A;  1X3W A;  3CXC Z;  4BY1 I;  2DE7 A;  1VLA A;  2P28 A;  2QA4 1;  2I3C A;  3I56 Z;  1S7M A;  1I6H I;  3CMA Z;  1USP B;  2PM9 A;  3CPW Z;  1YUA A;  4MON A;  2P3Y A;  3RZO I;  3PO2 I;  1VQ6 Z;  1VQN 1;  3HOU I;  3CQZ I;  1RO0 A;  1RQF A;  3HOV I;  2VPZ A;  4RVD A;  3S1R I;  1VQO Z;  1YJN 1;  2R6M A;  1K73 2;  3CPW Y;  2VPX A;  3IR7 A;  1Y1V S;  2HF1 A;  3I56 1;  3G71 1;  1YI2 Z;  1KQS Y;  2R93 I;  3VTN A;  4HGZ A;  3GTK I;  2VF1 A;  3T4N B;  4EWC A;  3S16 I;  2JA7 I;  2JNY A;  1L1O C;  2K3R A;  3CC4 Z;  3KIH A;  1VQ5 1;  5FLX f;  1Q81 1;  2E2I I;  2JIM A;  4NBH A;  1M1K 2;  2JA5 I;  1Z03 A;  2W04 A;  1WCM I;  3VMI A;  1YIT 1;  2JUB A;  3CMA 1;  1S72 1;  4NBA A;  4NH1 C;  2V45 A;  4E30 A;  1K73 1;  2VPW A;  1VQ6 1;  1VQN Z;  3PO3 S;  4MD8 A;  3Q87 A;  3CC4 1;  4E32 A;  1Q7Y 1;  2ZAE B;  4BBR I;  5IP7 I;  2EGT A;  3HKZ A;  2E2H I;  1QVF Z;  1FDO A;  3VMG A;  2NAP A;  1YHQ 1;  4RS4 A;  2NVX I;  3CCQ 1;  5C4X I;  3D9X A;  3I07 A;  2OZK A;  4X6A I;  3NH8 A;  3VB9 A;  1KD1 1;  3CCE Z;  2GTI A;  3CCL 1;  1AA6 A;  3GKQ A;  3J81 f;  3MZK B;  1VQ5 Z;  2RIQ A;  5LL6 f;  2J6A A;  3HOZ I;  2G2K A;  3P5J B;  4AYB A;  2VUM I;  1NUI A;  4BY7 I;  2AYD A;  3S1Q I;  1WW9 A;  1YI2 1;  3CCQ Z;  3NH5 A;  1M90 1;  3GTM S;  1I50 I;  1Q81 2;  4NOZ A;  2GU2 A;  2LEX A;  3IX0 A;  1M1K 1;  4E2Z A;  1X0T A;  3S14 I;  3CME 1;  3CCU Z;  3CC2 1;  1QVG Z;  4NBG A;  4Y7N I;  4E2Y A;  1Q86 1;  3G4S Z;  1VQ9 1;  1QXF A;  2QRC B;  1YUK A;  3U50 C;  4NBC A;  3JAM b;  2IZ4 A;  4BBS I;  1K8A 2;  2OTL 1;  2JIP A;  2LFU A;  2LIY A;  2OOY B;  2RT9 A;  4QTT A;  2BJO A;  4A3D I;  2QLV B;  3CD6 Z;  1VQM 1;  1QYP A;  2WAQ A;  5T67 A;  1TWA I;  3CC7 1;  1DL6 A;  3RZD I;  1I3Q I;  2QRD B;  5FLM I;  3CC2 Z;  4TNU A;  1YHQ Z;  2NVY I;  3EER A;  4QTU A;  3G4S 1;  1VQ9 Z;  1FDI A;  3QWU A;  2JIR A;  4RVG A;  2V3V A;  5IP9 I;  1YJ9 1;  2B63 I;  4NBB A;  1N8R 2;  1K83 I;  1Z01 A;  3J81 b;  1Q86 2;  1QVG Y;  3CCL Z;  5C4J I;  2RBL A;  2HU9 A;  2GTH A;  4MH4 A;  5A2Q f;  3GTG I;  2F4M A;  1TFI A;  3OW2 Z;  3CCU 1;  1M90 2;  1VQ4 Z;  2M48 A;  2QRE B;  2R92 I;  1SFO I;  4E31 A;  3HOW I;  2M6N A;  5FLX b;  3GTL I;  5T6B A;  3F3P C;  3ESW A;  4A3K I;  3HOX I;  3J7A 4;  5D1O B;  1ML8 A;  3NH4 A;  2V8J A;  4E33 A;  1R9T I;  1W2B Z;  2QKD A;  2KI7 B;  5A2Q b;  2PK7 A;  1KC8 2;  3K7A I;  2H85 A;  1VQP Z;  2YAD A;  3S1N I;  2RHB A;  3LUS A;  4XX2 A;  4S1T A;  3GTO I;  1Q82 1;  2NVQ I;  2Y0S A;  1TWF I;  1TWG I;  3HOY I;  2O53 A;  2K5R A;  3CCS Z;  3S15 I;  1KRL A;  1S72 Z;  3CD6 1;  1VQ7 1;  3J80 b;  1VQM Z;  3CCR Z;  1ZH1 A;  4A3F I;  2RPR A;  4NB8 A;  3MZL B;  3FQQ A;  1VQ4 1;  3F3F C;  3H3V J;  3BG1 B;  3CCV 1;  2DE6 A;  4BXX I;  5C44 I;  4A93 I;  5IT9 b;  3I55 1;  1KC8 1;  3GTJ I;  2AKL A;  3J80 f;  4NB9 A;  1YJ9 Z;  3CCM 1;  3NDJ A;  5AN9 F;  3MON A;  4A3G I;  1TWC I;  2IV2 X;  1VQL Z;  2JA8 I;  4HH4 A;  1WJ2 A;  5D1O A;  2WB1 A;  1Y1V I;  1K8A 1;  3IF8 A;  2OTJ Z;  1W2B Y;  3I4M I;  2VPY A;  2F4O A;  4MXU A;  3CCS 1;  2R7Z I;  2QA4 Z;  2O4H A;  2V8K A;  1X3Z A;  2Q51 A;  1LQL A;  4NBF A;  4HGY A;  1ZB9 A;  3CCR 1;  3D2L A;  3H0G I;  1Y8C A;  1KD1 2;  1VQP 1;  3CME Z;  3S1M I;  3CCJ 1;  1K9M 1;  5T64 A;  2QEX Z; 
#chains in the Genus database with same CATH homology
 2OOX B;  2V8I A;  3G6E 1;  1P9N A;  3GTQ I;  2JMO A;  4A3E I;  1VQO 1;  4RVH A;  2JA6 I;  4A3B I;  2OTL Z;  1N8R 1;  3GTM I;  3S2D I;  1ZB8 A;  3S2H I;  3GCF A;  2Q4Z A;  4Y52 I;  1TWH I;  3PO3 I;  1Q7Y 2;  1NP6 A;  1NJI 2;  1KQS Z;  3I4N I;  3CC7 Z;  2VUG A;  3KIF A;  3TDH B;  3CCJ Z;  5IT9 f;  4NFR A;  3CCV Z;  4DQY B;  2JS4 A;  3I55 Z;  1N2F A;  4DK1 A;  4A3M I;  4A3C I;  3CCM Z;  1YIT Z;  3FQM A;  4MRI A;  1YIJ Z;  4NBE A;  1VQK Z;  1Q82 2;  4A3J I;  4DGL A;  1Z02 A;  2DE5 A;  2JR6 A;  1VQ8 1;  3BG0 B;  3M3Y I;  4RVF A;  1YJW 1;  5C3E I;  4MD9 A;  1K9M 2;  2QR1 B;  3TE5 B;  4E2W A;  2E2J I;  3CCE 1;  1WII A;  1JJ2 Y;  1VQK 1;  2QEX 1;  1RNI A;  3G6E Z;  1JJ2 Z;  4CL1 A;  1USP A;  3JAM f;  1QF8 A;  1NJI 1;  3D6W A;  2E9H A;  1VQ7 Z;  1QVF Y;  4MD7 A;  1RO2 A;  3M4O I;  3EED A;  1JWH C;  3OW2 Y;  3NFZ A;  5CM2 M;  2NVT I;  4A3I I;  2YU9 I;  4A3L I;  1RLY A;  4E2X A;  2IZ3 A;  1RO4 A;  1Y1W I;  1YJW Z;  3G71 Z;  3VMH A;  3CXC Y;  1PFT A;  3FKI I;  1YIJ 1;  1VQL 1;  3GTP I;  2PMZ A;  3IFU A;  2KPI A;  3NDI A;  4NBD A;  3S17 I;  4RV9 A;  2W03 A;  2OTJ 1;  1YJN Z;  1VQ8 Z;  5D1P A;  1X3W A;  3CXC Z;  4BY1 I;  2DE7 A;  1VLA A;  2P28 A;  2QA4 1;  2I3C A;  3I56 Z;  1S7M A;  1I6H I;  3CMA Z;  1USP B;  2PM9 A;  3CPW Z;  1YUA A;  4MON A;  2P3Y A;  3RZO I;  3PO2 I;  1VQ6 Z;  1VQN 1;  3HOU I;  3CQZ I;  1RO0 A;  1RQF A;  3HOV I;  4RVD A;  3S1R I;  1VQO Z;  1YJN 1;  2R6M A;  1K73 2;  3CPW Y;  1Y1V S;  2HF1 A;  3I56 1;  3G71 1;  1YI2 Z;  1KQS Y;  2R93 I;  3VTN A;  4HGZ A;  3GTK I;  2VF1 A;  3T4N B;  4EWC A;  3S16 I;  2JA7 I;  2JNY A;  1L1O C;  2K3R A;  3CC4 Z;  3KIH A;  1VQ5 1;  5FLX f;  1Q81 1;  2E2I I;  4NBH A;  1M1K 2;  2JA5 I;  1Z03 A;  2W04 A;  1WCM I;  3VMI A;  1YIT 1;  2JUB A;  3CMA 1;  1S72 1;  4NBA A;  4NH1 C;  4E30 A;  1K73 1;  1VQ6 1;  1VQN Z;  3PO3 S;  4MD8 A;  3Q87 A;  3CC4 1;  4E32 A;  1Q7Y 1;  2ZAE B;  4BBR I;  5IP7 I;  2EGT A;  3HKZ A;  2E2H I;  1QVF Z;  3VMG A;  1YHQ 1;  4RS4 A;  2NVX I;  3CCQ 1;  5C4X I;  3D9X A;  3I07 A;  2OZK A;  4X6A I;  3NH8 A;  3VB9 A;  1KD1 1;  3CCE Z;  2GTI A;  3CCL 1;  3GKQ A;  3J81 f;  3MZK B;  1VQ5 Z;  2RIQ A;  5LL6 f;  2J6A A;  3HOZ I;  2G2K A;  3P5J B;  4AYB A;  2VUM I;  1NUI A;  4BY7 I;  3S1Q I;  1WW9 A;  1YI2 1;  3CCQ Z;  3NH5 A;  1M90 1;  3GTM S;  1I50 I;  1Q81 2;  4NOZ A;  2GU2 A;  3IX0 A;  1M1K 1;  4E2Z A;  1X0T A;  3S14 I;  3CME 1;  3CCU Z;  3CC2 1;  1QVG Z;  4NBG A;  4Y7N I;  4E2Y A;  1Q86 1;  3G4S Z;  1VQ9 1;  2QRC B;  1YUK A;  3U50 C;  4NBC A;  3JAM b;  2IZ4 A;  4BBS I;  1K8A 2;  2OTL 1;  2LFU A;  2LIY A;  2OOY B;  2RT9 A;  4QTT A;  2BJO A;  4A3D I;  2QLV B;  3CD6 Z;  1VQM 1;  1QYP A;  2WAQ A;  5T67 A;  1TWA I;  3CC7 1;  1DL6 A;  3RZD I;  1I3Q I;  2QRD B;  5FLM I;  3CC2 Z;  4TNU A;  1YHQ Z;  2NVY I;  3EER A;  4QTU A;  3G4S 1;  1VQ9 Z;  3QWU A;  4RVG A;  5IP9 I;  1YJ9 1;  2B63 I;  4NBB A;  1N8R 2;  1K83 I;  1Q86 2;  1Z01 A;  3J81 b;  1QVG Y;  3CCL Z;  5C4J I;  2RBL A;  2HU9 A;  2GTH A;  4MH4 A;  5A2Q f;  3GTG I;  2F4M A;  1TFI A;  3OW2 Z;  3CCU 1;  1M90 2;  1VQ4 Z;  2M48 A;  2QRE B;  2R92 I;  1SFO I;  4E31 A;  3HOW I;  2M6N A;  5FLX b;  3GTL I;  5T6B A;  3F3P C;  3ESW A;  4A3K I;  3HOX I;  3J7A 4;  5D1O B;  1ML8 A;  3NH4 A;  2V8J A;  4E33 A;  1R9T I;  1W2B Z;  2QKD A;  2KI7 B;  5A2Q b;  2PK7 A;  1KC8 2;  3K7A I;  2H85 A;  1VQP Z;  2YAD A;  3S1N I;  2RHB A;  3LUS A;  4XX2 A;  4S1T A;  3GTO I;  1Q82 1;  2NVQ I;  2Y0S A;  1TWF I;  1TWG I;  3HOY I;  2O53 A;  2K5R A;  3CCS Z;  3S15 I;  1KRL A;  1S72 Z;  3CD6 1;  1VQ7 1;  3J80 b;  1VQM Z;  3CCR Z;  1ZH1 A;  4A3F I;  2RPR A;  4NB8 A;  3MZL B;  3FQQ A;  1VQ4 1;  3F3F C;  3H3V J;  3BG1 B;  3CCV 1;  2DE6 A;  4BXX I;  5C44 I;  4A93 I;  5IT9 b;  3I55 1;  1KC8 1;  3GTJ I;  2AKL A;  3J80 f;  4NB9 A;  1YJ9 Z;  3CCM 1;  3NDJ A;  5AN9 F;  3MON A;  4A3G I;  1TWC I;  1VQL Z;  2JA8 I;  4HH4 A;  5D1O A;  2WB1 A;  1Y1V I;  1K8A 1;  3IF8 A;  2OTJ Z;  1W2B Y;  3I4M I;  2F4O A;  4MXU A;  3CCS 1;  2R7Z I;  2QA4 Z;  2O4H A;  2V8K A;  1X3Z A;  2Q51 A;  1LQL A;  4NBF A;  4HGY A;  1ZB9 A;  3CCR 1;  3H0G I;  1KD1 2;  1VQP 1;  3CME Z;  3S1M I;  3CCJ 1;  1K9M 1;  5T64 A;  2QEX Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...