3G6E1

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g6e100
2QA4Z 1Q822 1VQ61 3CMAZ 2QA41 1K8A2 3CXCZ 1N8R2 3CCV1 1W2BZ 3CD6Z 2QEXZ 3OW2Z 1NJI1 1QVGY 1VQ4Z 1Q7Y2 1QVFZ 1KQSZ 1VQ51 1VQNZ 1VQPZ 1M1K2 3CD61 3CPWZ 3CCLZ 1VQ41 3CMEZ 3CCJZ 1VQP1 1K9M2 3CCL1 2OTJ1 3CME1 1YITZ 3CCJ1 1VQ6Z 1JJ2Z 1YIT1 3CCVZ 3CCR1 3CC41 3CCEZ 3CCM1 3CCU1 1VQ5Z 1S721 3CC21 3CCE1 1VQ71 3I561 1K731 1KC81 1YIJ1 2OTJZ 1YHQZ 1QVGZ 3G6E1 3G711 1YHQ1 1NJI2 1VQ91 1YJWZ 1Q811 1KD11 1VQL1 3OW2Y 1YJW1 3CCRZ 1M901 1KQSY 3CC4Z 3CPWY 3CCMZ 1VQMZ 1VQO1 3CCUZ 1S72Z 3CC2Z 1VQM1 1VQ7Z 3I56Z 1Q861 1YIJZ 1M902 2OTL1 3G4SZ 3G4S1 1K8A1 3G6EZ 3G71Z 1VQ9Z 1N8R1 1YJN1 1Q862 1VQ8Z 3CCSZ 3CXCY 1VQLZ 1VQK1 1YI2Z 3CCQZ 1W2BY 1YJ9Z 1K732 1KC82 1Q7Y1 1VQ81 1M1K1 3CCS1 1VQOZ 3CC7Z 1YI21 3CCQ1 3CMA1 1QVFY 1YJ91 1K9M1 3CC71 2OTLZ 1Q812 2QEX1 1KD12 3I55Z 1Q821 1JJ2Y 1VQN1 1YJNZ 3I551 1VQKZ
chains in the Genus database with same CATH superfamily
1Q822 3KIFA 3S1NI 1VQ61 3I4MI 2JA6I 3J81b 3NH8A 4E33A 3CCV1 4NBHA 3CD61 1VQ51 2M48A 1TWCI 1P9NA 3CPWZ 3HKZA 3CCLZ 2E2JI 3J81f 2OTJ1 1LQLA 5A2Qb 3CCJ1 2GTIA 4A3CI 1Z02A 5IP9I 1NP6A 2VUMI 2JR6A 2DE6A 4CL1A 5A2Qf 3NH5A 4A93I 4XX2A 4EWCA 3CCE1 2QREB 5T64A 1YIJ1 2JUBA 2JS4A 2OOYB 1TWAI 1I6HI 1WJ2A 1NJI2 1R9TI 3J7A4 2JIRA 3VB9A 2GTHA 2WAQA 2E2II 1YJW1 1KQSY 4MD7A 4E2ZA 3VMHA 2NAPA 3I56Z 1I3QI 3S16I 3S17I 3NH4A 3I07A 3G4SZ 2R93I 4E2YA 3S2DI 3IX0A 3TE5B 1K83I 2RBLA 3P5JB 4NBAA 4E30A 3S15I 3RZDI 3CCS1 1SIWA 3CC7Z 1QVFY 4DK1A 1YJ91 2RPRA 5IT9b 3H3VJ 3VMIA 2QEX1 1X0TA 2Q4ZA 4RV9A 1AA6A 2RT9A 2JIOA 3T4NB 5IT9f 2JA5I 3NDIA 2R92I 2V8KA 3M3YI 4NBCA 3K7AI 4NB9A 2IZ3A 4NB8A 1K8A2 4HGZA 4BY1I 3GTQI 4QTUA 2F4MA 3CD6Z 4NBFA 4Y52I 1NJI1 4A3DI 1QVFZ 2NVTI 2ZAEB 2OOXB 1VQ41 5C44I 3CCJZ 1VQP1 2GU2A 1K9M2 3S2HI 4MXUA 1TWFI 2AYDA 1ML8A 3PO2I 2YADA 3TDHB 1X3WA 3CC41 3CCEZ 3CCM1 3CCU1 1S721 1WZNA 3CC21 3HOWI 3S1RI 1VQ71 1YUKA 5C4JI 2BJOA 4MD9A 2I3CA 1PFTA 3G711 1VQ91 1YJWZ 3I4NI 2O4HA 3MZKB 1VQL1 2QLVB 2VPYA 2LIYA 3OW2Y 2W04A 3CCRZ 2HF1A 1USPA 1KRLA 3NFZA 2J6AA 2HU9A 3PO3I 1VQO1 2OZKA 3HOZI 1FDOA 5CM2M 1M902 1RO2A 4A3GI 2OTL1 1S7MA 2VPZA 1K8A1 1RNIA 1N2FA 3G6EZ 1Q862 4BY7I 1Q16A 3CCSZ 3MONA 3CXCY 1VQK1 1W2BY 3GTJI 1YJ9Z 1K732 2YU9I 4TNUA 1VQ81 4A3LI 1Y1WI 1YI21 3CCQ1 1ZH1A 1K9M1 3CQZI 2VF1A 4BBRI 2W03A 2NVYI 1Q812 3F3FC 3KIHA 3BG1B 4RVGA 1Q821 2NVQI 2F4OA 3GTPI 4NFRA 1YJNZ 3I551 1WW9A 3FKII 5C3EI 1WIIA 3PO3S 1Z01A 3CMAZ 2QA41 4HH4A 3J80b 3D2LA 3CXCZ 1W2BZ 3EEDA 2R6MA 1FDIA 1VQ4Z 1Z03A 1Q7Y2 1KQSZ 1VQNZ 1VQPZ 3QWUA 5C4XI 3J80f 4RS4A 4A3KI 4A3FI 2LEXA 3CME1 3GTKI 3GTMS 1USPB 1VQ6Z 3MZLB 3FQMA 2B63I 1YIT1 3U50C 3CCVZ 2EGTA 3Q87A 4BBSI 5AN9F 2VPXA 3FQQA 1Y8CA 1I50I 1NUIA 4NBBA 1VQ5Z 3M4OI 2E7ZA 1TFIA 3I561 1K731 2OTJZ 5D1OA 3VMGA 2QRCB 1ZB8A 4RVDA 1WCMI 3GTOI 2E2HI 4NBEA 1YHQ1 5FLXb 1Q811 2H85A 4Y7NI 2O53A 3S14I 1SFOI 2AKLA 4NBDA 4QTTA 3CPWY 2JA8I 3D9XA 4E2WA 1VQM1 3IFUA 1DL6A 5FLXf 1YIJZ 2R7ZI 5IP7I 1RLYA 4RVHA 2KI7B 1RQFA 4NOZA 5T6BA 4A3BI 2Q51A 1VQ8Z 1Y1VS 1QXFA 2JIPA 3GTLI 1YI2Z 3CCQZ 1KC82 1TWHI 1Q7Y1 2QKDA 1JWHC 3HOUI 4E31A 2V45A 5T67A 2Y0SA 4MD8A 1KD12 2G2KA 2P3YA 5D1PA 3I55Z 1JJ2Y 3GTGI 1ZB9A 2WB1A 2JA7I 1RO4A 2M6NA 2V8IA 4S1TA 2QA4Z 2IZ4A 4A3II 1N8R2 3GTMI 1L1OC 2QEXZ 2JIMA 2PMZA 3OW2Z 5D1OB 1QVGY 1QF8A 1M1K2 3HOYI 2PM9A 4A3JI 4MRIA 3CMEZ 2V3VA 2P28A 4NH1C 3D6WA 3S1QI 3CCL1 3ESWA 1YITZ 2IV2X 5FLMI 1JJ2Z 3RZOI 2JIQA 3GCFA 4RVFA 2DE7A 4DGLA 2K3RA 3F3PC 2RIQA 3CCR1 2E9HA 3HOXI 2DE5A 3EERA 4AYBA 4DQYB 4A3MI 4NBGA 1KC81 2JNYA 4E2XA 1YHQZ 1VLAA 1QVGZ 1RO0A 3H0GI 3G6E1 3S1MI 1KD11 2KPIA 2VUGA 2RHBA 1M901 3CC4Z 3CCMZ 1VQMZ 3JAMb 1TWGI 4E32A 3CCUZ 1Y1VI 1S72Z 3CC2Z 3IF8A 3NDJA 1VQ7Z 1Q861 4MH4A 4HGYA 1X3ZA 4A3EI 3BG0B 4MONA 3G4S1 3JAMf 3VTNA 3G71Z 1VQ9Z 1N8R1 2QR1B 1YJN1 4BXXI 2NVXI 1VQLZ 2PK7A 1M1K1 1VQOZ 3IR7A 2QRDB 3CMA1 5LL6f 2JMOA 3CC71 3HOVI 2OTLZ 3GKQA 2K5RA 1QYPA 2LFUA 2VPWA 1YUAA 1VQN1 4X6AI 2V8JA 3LUSA 1VQKZ
chains in the Genus database with same CATH topology
1Q822 3KIFA 3S1NI 1VQ61 3I4MI 2JA6I 3J81b 3NH8A 4E33A 3CCV1 4NBHA 3CD61 1VQ51 2M48A 1TWCI 1P9NA 3CPWZ 3HKZA 3CCLZ 2E2JI 3J81f 2OTJ1 1LQLA 5A2Qb 3CCJ1 2GTIA 4A3CI 1Z02A 5IP9I 1NP6A 2VUMI 2JR6A 2DE6A 4CL1A 5A2Qf 3NH5A 4A93I 4XX2A 4EWCA 3CCE1 2QREB 5T64A 1YIJ1 2JUBA 2JS4A 2OOYB 1TWAI 1I6HI 1NJI2 1R9TI 3J7A4 3VB9A 2GTHA 2WAQA 2E2II 1YJW1 1KQSY 4MD7A 4E2ZA 3VMHA 3I56Z 1I3QI 3S16I 3S17I 3NH4A 3I07A 3G4SZ 2R93I 4E2YA 3S2DI 3IX0A 3TE5B 1K83I 2RBLA 3P5JB 4NBAA 4E30A 3S15I 3RZDI 3CCS1 3CC7Z 1QVFY 4DK1A 1YJ91 2RPRA 5IT9b 3H3VJ 3VMIA 2QEX1 1X0TA 2Q4ZA 4RV9A 2RT9A 3T4NB 5IT9f 2JA5I 3NDIA 2R92I 2V8KA 3M3YI 4NBCA 3K7AI 4NB9A 2IZ3A 4NB8A 1K8A2 4HGZA 4BY1I 3GTQI 4QTUA 2F4MA 3CD6Z 4NBFA 4Y52I 1NJI1 4A3DI 1QVFZ 2NVTI 2ZAEB 2OOXB 1VQ41 5C44I 3CCJZ 1VQP1 2GU2A 1K9M2 3S2HI 4MXUA 1TWFI 1ML8A 3PO2I 2YADA 3TDHB 1X3WA 3CC41 3CCEZ 3CCM1 3CCU1 1S721 3HOWI 3CC21 3S1RI 1VQ71 1YUKA 5C4JI 2BJOA 4MD9A 2I3CA 1PFTA 3G711 1VQ91 1YJWZ 3I4NI 2O4HA 3MZKB 1VQL1 2QLVB 3OW2Y 2LIYA 2W04A 3CCRZ 2HF1A 1USPA 1KRLA 3NFZA 2J6AA 2HU9A 3PO3I 1VQO1 2OZKA 3HOZI 5CM2M 1M902 1RO2A 4A3GI 2OTL1 1S7MA 1K8A1 1RNIA 1N2FA 3G6EZ 1Q862 4BY7I 3CCSZ 3MONA 3CXCY 1VQK1 1W2BY 3GTJI 1YJ9Z 1K732 2YU9I 4TNUA 1VQ81 4A3LI 1Y1WI 1YI21 3CCQ1 1ZH1A 1K9M1 3CQZI 2VF1A 4BBRI 2W03A 2NVYI 1Q812 3F3FC 3KIHA 3BG1B 4RVGA 1Q821 2NVQI 2F4OA 3GTPI 4NFRA 1YJNZ 3I551 1WW9A 3FKII 5C3EI 1WIIA 3PO3S 1Z01A 3CMAZ 2QA41 4HH4A 3J80b 3CXCZ 1W2BZ 3EEDA 2R6MA 1VQ4Z 1Z03A 1Q7Y2 1KQSZ 1VQNZ 1VQPZ 3QWUA 5C4XI 3J80f 4RS4A 4A3KI 4A3FI 3CME1 3GTKI 3GTMS 1USPB 1VQ6Z 3MZLB 3FQMA 2B63I 1YIT1 3U50C 3CCVZ 2EGTA 3Q87A 4BBSI 5AN9F 3FQQA 1I50I 1NUIA 4NBBA 1VQ5Z 3M4OI 1TFIA 3I561 1K731 2OTJZ 5D1OA 3VMGA 2QRCB 1ZB8A 4RVDA 1WCMI 3GTOI 2E2HI 4NBEA 1YHQ1 5FLXb 1Q811 2H85A 4Y7NI 2O53A 3S14I 1SFOI 2AKLA 4NBDA 4QTTA 3CPWY 2JA8I 3D9XA 4E2WA 1VQM1 3IFUA 1DL6A 5FLXf 1YIJZ 2R7ZI 5IP7I 1RLYA 4RVHA 2KI7B 1RQFA 4NOZA 5T6BA 4A3BI 2Q51A 1VQ8Z 1Y1VS 3GTLI 1YI2Z 3CCQZ 1KC82 1TWHI 1Q7Y1 2QKDA 1JWHC 3HOUI 4E31A 5T67A 2Y0SA 4MD8A 1KD12 2G2KA 2P3YA 5D1PA 3I55Z 1JJ2Y 3GTGI 1ZB9A 2WB1A 2JA7I 1RO4A 2M6NA 2V8IA 4S1TA 2QA4Z 2IZ4A 4A3II 1N8R2 3GTMI 1L1OC 2QEXZ 2PMZA 3OW2Z 5D1OB 1QVGY 1QF8A 1M1K2 3HOYI 2PM9A 4A3JI 4MRIA 3CMEZ 2P28A 4NH1C 3D6WA 3S1QI 3CCL1 3ESWA 1YITZ 5FLMI 1JJ2Z 3RZOI 3GCFA 4RVFA 2DE7A 4DGLA 2K3RA 3F3PC 2RIQA 3CCR1 2E9HA 3HOXI 2DE5A 3EERA 4AYBA 4DQYB 4A3MI 4NBGA 1KC81 2JNYA 4E2XA 1YHQZ 1VLAA 1QVGZ 1RO0A 3H0GI 3G6E1 3S1MI 1KD11 2KPIA 2VUGA 2RHBA 1M901 3CC4Z 3CCMZ 1VQMZ 3JAMb 1TWGI 4E32A 3CCUZ 1Y1VI 1S72Z 3CC2Z 3IF8A 3NDJA 1VQ7Z 1Q861 4MH4A 4HGYA 1X3ZA 4A3EI 3BG0B 4MONA 3G4S1 3JAMf 3VTNA 3G71Z 1VQ9Z 1N8R1 2QR1B 1YJN1 4BXXI 2NVXI 1VQLZ 2PK7A 1M1K1 1VQOZ 2QRDB 3CMA1 5LL6f 2JMOA 3CC71 3HOVI 2OTLZ 3GKQA 2K5RA 1QYPA 2LFUA 1YUAA 1VQN1 4X6AI 2V8JA 3LUSA 1VQKZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Z;  1Q82 2;  1VQ6 1;  3CMA Z;  2QA4 1;  1K8A 2;  3CXC Z;  1N8R 2;  3CCV 1;  1W2B Z;  3CD6 Z;  2QEX Z;  3OW2 Z;  1NJI 1;  1QVG Y;  1VQ4 Z;  1Q7Y 2;  1QVF Z;  1KQS Z;  1VQ5 1;  1VQN Z;  1VQP Z;  1M1K 2;  3CD6 1;  3CPW Z;  3CCL Z;  1VQ4 1;  3CME Z;  3CCJ Z;  1VQP 1;  1K9M 2;  3CCL 1;  2OTJ 1;  3CME 1;  1YIT Z;  3CCJ 1;  1VQ6 Z;  1JJ2 Z;  1YIT 1;  3CCV Z;  3CCR 1;  3CC4 1;  3CCE Z;  3CCM 1;  3CCU 1;  1VQ5 Z;  1S72 1;  3CC2 1;  3CCE 1;  1VQ7 1;  3I56 1;  1K73 1;  1KC8 1;  1YIJ 1;  2OTJ Z;  1YHQ Z;  1QVG Z;  3G6E 1;  3G71 1;  1YHQ 1;  1NJI 2;  1VQ9 1;  1YJW Z;  1Q81 1;  1KD1 1;  1VQL 1;  3OW2 Y;  1YJW 1;  3CCR Z;  1M90 1;  1KQS Y;  3CC4 Z;  3CPW Y;  3CCM Z;  1VQM Z;  1VQO 1;  3CCU Z;  1S72 Z;  3CC2 Z;  1VQM 1;  1VQ7 Z;  3I56 Z;  1Q86 1;  1YIJ Z;  1M90 2;  2OTL 1;  3G4S Z;  3G4S 1;  1K8A 1;  3G6E Z;  3G71 Z;  1VQ9 Z;  1N8R 1;  1YJN 1;  1Q86 2;  1VQ8 Z;  3CCS Z;  3CXC Y;  1VQL Z;  1VQK 1;  1YI2 Z;  3CCQ Z;  1W2B Y;  1YJ9 Z;  1K73 2;  1KC8 2;  1Q7Y 1;  1VQ8 1;  1M1K 1;  3CCS 1;  1VQO Z;  3CC7 Z;  1YI2 1;  3CCQ 1;  3CMA 1;  1QVF Y;  1YJ9 1;  1K9M 1;  3CC7 1;  2OTL Z;  1Q81 2;  2QEX 1;  1KD1 2;  3I55 Z;  1Q82 1;  1JJ2 Y;  1VQN 1;  1YJN Z;  3I55 1;  1VQK Z; 
#chains in the Genus database with same CATH topology
 1Q82 2;  3KIF A;  3S1N I;  1VQ6 1;  3I4M I;  2JA6 I;  3J81 b;  3NH8 A;  4E33 A;  3CCV 1;  4NBH A;  3CD6 1;  1VQ5 1;  2M48 A;  1TWC I;  1P9N A;  3CPW Z;  3HKZ A;  3CCL Z;  2E2J I;  3J81 f;  2OTJ 1;  1LQL A;  5A2Q b;  3CCJ 1;  2GTI A;  4A3C I;  1Z02 A;  5IP9 I;  1NP6 A;  2VUM I;  2JR6 A;  2DE6 A;  4CL1 A;  5A2Q f;  3NH5 A;  4A93 I;  4XX2 A;  4EWC A;  3CCE 1;  2QRE B;  5T64 A;  1YIJ 1;  2JUB A;  2JS4 A;  2OOY B;  1TWA I;  1I6H I;  1WJ2 A;  1NJI 2;  1R9T I;  3J7A 4;  2JIR A;  3VB9 A;  2GTH A;  2WAQ A;  2E2I I;  1YJW 1;  1KQS Y;  4MD7 A;  4E2Z A;  3VMH A;  2NAP A;  3I56 Z;  1I3Q I;  3S16 I;  3S17 I;  3NH4 A;  3I07 A;  3G4S Z;  2R93 I;  4E2Y A;  3S2D I;  3IX0 A;  3TE5 B;  1K83 I;  2RBL A;  3P5J B;  4NBA A;  4E30 A;  3S15 I;  3RZD I;  3CCS 1;  1SIW A;  3CC7 Z;  1QVF Y;  4DK1 A;  1YJ9 1;  2RPR A;  5IT9 b;  3H3V J;  3VMI A;  2QEX 1;  1X0T A;  2Q4Z A;  4RV9 A;  1AA6 A;  2RT9 A;  2JIO A;  3T4N B;  5IT9 f;  2JA5 I;  3NDI A;  2R92 I;  2V8K A;  3M3Y I;  4NBC A;  3K7A I;  4NB9 A;  2IZ3 A;  4NB8 A;  1K8A 2;  4HGZ A;  4BY1 I;  3GTQ I;  4QTU A;  2F4M A;  3CD6 Z;  4NBF A;  4Y52 I;  1NJI 1;  4A3D I;  1QVF Z;  2NVT I;  2ZAE B;  2OOX B;  1VQ4 1;  5C44 I;  3CCJ Z;  1VQP 1;  2GU2 A;  1K9M 2;  3S2H I;  4MXU A;  1TWF I;  2AYD A;  1ML8 A;  3PO2 I;  2YAD A;  3TDH B;  1X3W A;  3CC4 1;  3CCE Z;  3CCM 1;  3CCU 1;  1S72 1;  1WZN A;  3CC2 1;  3HOW I;  3S1R I;  1VQ7 1;  1YUK A;  5C4J I;  2BJO A;  4MD9 A;  2I3C A;  1PFT A;  3G71 1;  1VQ9 1;  1YJW Z;  3I4N I;  2O4H A;  3MZK B;  1VQL 1;  2QLV B;  2VPY A;  2LIY A;  3OW2 Y;  2W04 A;  3CCR Z;  2HF1 A;  1USP A;  1KRL A;  3NFZ A;  2J6A A;  2HU9 A;  3PO3 I;  1VQO 1;  2OZK A;  3HOZ I;  1FDO A;  5CM2 M;  1M90 2;  1RO2 A;  4A3G I;  2OTL 1;  1S7M A;  2VPZ A;  1K8A 1;  1RNI A;  1N2F A;  3G6E Z;  1Q86 2;  4BY7 I;  1Q16 A;  3CCS Z;  3MON A;  3CXC Y;  1VQK 1;  1W2B Y;  3GTJ I;  1YJ9 Z;  1K73 2;  2YU9 I;  4TNU A;  1VQ8 1;  4A3L I;  1Y1W I;  1YI2 1;  3CCQ 1;  1ZH1 A;  1K9M 1;  3CQZ I;  2VF1 A;  4BBR I;  2W03 A;  2NVY I;  1Q81 2;  3F3F C;  3KIH A;  3BG1 B;  4RVG A;  1Q82 1;  2NVQ I;  2F4O A;  3GTP I;  4NFR A;  1YJN Z;  3I55 1;  1WW9 A;  3FKI I;  5C3E I;  1WII A;  3PO3 S;  1Z01 A;  3CMA Z;  2QA4 1;  4HH4 A;  3J80 b;  3D2L A;  3CXC Z;  1W2B Z;  3EED A;  2R6M A;  1FDI A;  1VQ4 Z;  1Z03 A;  1Q7Y 2;  1KQS Z;  1VQN Z;  1VQP Z;  3QWU A;  5C4X I;  3J80 f;  4RS4 A;  4A3K I;  4A3F I;  2LEX A;  3CME 1;  3GTK I;  3GTM S;  1USP B;  1VQ6 Z;  3MZL B;  3FQM A;  2B63 I;  1YIT 1;  3U50 C;  3CCV Z;  2EGT A;  3Q87 A;  4BBS I;  5AN9 F;  2VPX A;  3FQQ A;  1Y8C A;  1I50 I;  1NUI A;  4NBB A;  1VQ5 Z;  3M4O I;  2E7Z A;  1TFI A;  3I56 1;  1K73 1;  2OTJ Z;  5D1O A;  3VMG A;  2QRC B;  1ZB8 A;  4RVD A;  1WCM I;  3GTO I;  2E2H I;  4NBE A;  1YHQ 1;  5FLX b;  1Q81 1;  2H85 A;  4Y7N I;  2O53 A;  3S14 I;  1SFO I;  2AKL A;  4NBD A;  4QTT A;  3CPW Y;  2JA8 I;  3D9X A;  4E2W A;  1VQM 1;  3IFU A;  1DL6 A;  5FLX f;  1YIJ Z;  2R7Z I;  5IP7 I;  1RLY A;  4RVH A;  2KI7 B;  1RQF A;  4NOZ A;  5T6B A;  4A3B I;  2Q51 A;  1VQ8 Z;  1Y1V S;  1QXF A;  2JIP A;  3GTL I;  1YI2 Z;  3CCQ Z;  1KC8 2;  1TWH I;  1Q7Y 1;  2QKD A;  1JWH C;  3HOU I;  4E31 A;  2V45 A;  5T67 A;  2Y0S A;  4MD8 A;  1KD1 2;  2G2K A;  2P3Y A;  5D1P A;  3I55 Z;  1JJ2 Y;  3GTG I;  1ZB9 A;  2WB1 A;  2JA7 I;  1RO4 A;  2M6N A;  2V8I A;  4S1T A;  2QA4 Z;  2IZ4 A;  4A3I I;  1N8R 2;  3GTM I;  1L1O C;  2QEX Z;  2JIM A;  2PMZ A;  3OW2 Z;  5D1O B;  1QVG Y;  1QF8 A;  1M1K 2;  3HOY I;  2PM9 A;  4A3J I;  4MRI A;  3CME Z;  2V3V A;  2P28 A;  4NH1 C;  3D6W A;  3S1Q I;  3CCL 1;  3ESW A;  1YIT Z;  2IV2 X;  5FLM I;  1JJ2 Z;  3RZO I;  2JIQ A;  3GCF A;  4RVF A;  2DE7 A;  4DGL A;  2K3R A;  3F3P C;  2RIQ A;  3CCR 1;  2E9H A;  3HOX I;  2DE5 A;  3EER A;  4AYB A;  4DQY B;  4A3M I;  4NBG A;  1KC8 1;  2JNY A;  4E2X A;  1YHQ Z;  1VLA A;  1QVG Z;  1RO0 A;  3H0G I;  3G6E 1;  3S1M I;  1KD1 1;  2KPI A;  2VUG A;  2RHB A;  1M90 1;  3CC4 Z;  3CCM Z;  1VQM Z;  3JAM b;  1TWG I;  4E32 A;  3CCU Z;  1Y1V I;  1S72 Z;  3CC2 Z;  3IF8 A;  3NDJ A;  1VQ7 Z;  1Q86 1;  4MH4 A;  4HGY A;  1X3Z A;  4A3E I;  3BG0 B;  4MON A;  3G4S 1;  3JAM f;  3VTN A;  3G71 Z;  1VQ9 Z;  1N8R 1;  2QR1 B;  1YJN 1;  4BXX I;  2NVX I;  1VQL Z;  2PK7 A;  1M1K 1;  1VQO Z;  3IR7 A;  2QRD B;  3CMA 1;  5LL6 f;  2JMO A;  3CC7 1;  3HOV I;  2OTL Z;  3GKQ A;  2K5R A;  1QYP A;  2LFU A;  2VPW A;  1YUA A;  1VQN 1;  4X6A I;  2V8J A;  3LUS A;  1VQK Z; 
#chains in the Genus database with same CATH homology
 1Q82 2;  3KIF A;  3S1N I;  1VQ6 1;  3I4M I;  2JA6 I;  3J81 b;  3NH8 A;  4E33 A;  3CCV 1;  4NBH A;  3CD6 1;  1VQ5 1;  2M48 A;  1TWC I;  1P9N A;  3CPW Z;  3HKZ A;  3CCL Z;  2E2J I;  3J81 f;  2OTJ 1;  1LQL A;  5A2Q b;  3CCJ 1;  2GTI A;  4A3C I;  1Z02 A;  5IP9 I;  1NP6 A;  2VUM I;  2JR6 A;  2DE6 A;  4CL1 A;  5A2Q f;  3NH5 A;  4A93 I;  4XX2 A;  4EWC A;  3CCE 1;  2QRE B;  5T64 A;  1YIJ 1;  2JUB A;  2JS4 A;  2OOY B;  1TWA I;  1I6H I;  1NJI 2;  1R9T I;  3J7A 4;  3VB9 A;  2GTH A;  2WAQ A;  2E2I I;  1YJW 1;  1KQS Y;  4MD7 A;  4E2Z A;  3VMH A;  3I56 Z;  1I3Q I;  3S16 I;  3S17 I;  3NH4 A;  3I07 A;  3G4S Z;  2R93 I;  4E2Y A;  3S2D I;  3IX0 A;  3TE5 B;  1K83 I;  2RBL A;  3P5J B;  4NBA A;  4E30 A;  3S15 I;  3RZD I;  3CCS 1;  3CC7 Z;  1QVF Y;  4DK1 A;  1YJ9 1;  2RPR A;  5IT9 b;  3H3V J;  3VMI A;  2QEX 1;  1X0T A;  2Q4Z A;  4RV9 A;  2RT9 A;  3T4N B;  5IT9 f;  2JA5 I;  3NDI A;  2R92 I;  2V8K A;  3M3Y I;  4NBC A;  3K7A I;  4NB9 A;  2IZ3 A;  4NB8 A;  1K8A 2;  4HGZ A;  4BY1 I;  3GTQ I;  4QTU A;  2F4M A;  3CD6 Z;  4NBF A;  4Y52 I;  1NJI 1;  4A3D I;  1QVF Z;  2NVT I;  2ZAE B;  2OOX B;  1VQ4 1;  5C44 I;  3CCJ Z;  1VQP 1;  2GU2 A;  1K9M 2;  3S2H I;  4MXU A;  1TWF I;  1ML8 A;  3PO2 I;  2YAD A;  3TDH B;  1X3W A;  3CC4 1;  3CCE Z;  3CCM 1;  3CCU 1;  1S72 1;  3HOW I;  3CC2 1;  3S1R I;  1VQ7 1;  1YUK A;  5C4J I;  2BJO A;  4MD9 A;  2I3C A;  1PFT A;  3G71 1;  1VQ9 1;  1YJW Z;  3I4N I;  2O4H A;  3MZK B;  1VQL 1;  2QLV B;  3OW2 Y;  2LIY A;  2W04 A;  3CCR Z;  2HF1 A;  1USP A;  1KRL A;  3NFZ A;  2J6A A;  2HU9 A;  3PO3 I;  1VQO 1;  2OZK A;  3HOZ I;  5CM2 M;  1M90 2;  1RO2 A;  4A3G I;  2OTL 1;  1S7M A;  1K8A 1;  1RNI A;  1N2F A;  3G6E Z;  1Q86 2;  4BY7 I;  3CCS Z;  3MON A;  3CXC Y;  1VQK 1;  1W2B Y;  3GTJ I;  1YJ9 Z;  1K73 2;  2YU9 I;  4TNU A;  1VQ8 1;  4A3L I;  1Y1W I;  1YI2 1;  3CCQ 1;  1ZH1 A;  1K9M 1;  3CQZ I;  2VF1 A;  4BBR I;  2W03 A;  2NVY I;  1Q81 2;  3F3F C;  3KIH A;  3BG1 B;  4RVG A;  1Q82 1;  2NVQ I;  2F4O A;  3GTP I;  4NFR A;  1YJN Z;  3I55 1;  1WW9 A;  3FKI I;  5C3E I;  1WII A;  3PO3 S;  1Z01 A;  3CMA Z;  2QA4 1;  4HH4 A;  3J80 b;  3CXC Z;  1W2B Z;  3EED A;  2R6M A;  1VQ4 Z;  1Z03 A;  1Q7Y 2;  1KQS Z;  1VQN Z;  1VQP Z;  3QWU A;  5C4X I;  3J80 f;  4RS4 A;  4A3K I;  4A3F I;  3CME 1;  3GTK I;  3GTM S;  1USP B;  1VQ6 Z;  3MZL B;  3FQM A;  2B63 I;  1YIT 1;  3U50 C;  3CCV Z;  2EGT A;  3Q87 A;  4BBS I;  5AN9 F;  3FQQ A;  1I50 I;  1NUI A;  4NBB A;  1VQ5 Z;  3M4O I;  1TFI A;  3I56 1;  1K73 1;  2OTJ Z;  5D1O A;  3VMG A;  2QRC B;  1ZB8 A;  4RVD A;  1WCM I;  3GTO I;  2E2H I;  4NBE A;  1YHQ 1;  5FLX b;  1Q81 1;  2H85 A;  4Y7N I;  2O53 A;  3S14 I;  1SFO I;  2AKL A;  4NBD A;  4QTT A;  3CPW Y;  2JA8 I;  3D9X A;  4E2W A;  1VQM 1;  3IFU A;  1DL6 A;  5FLX f;  1YIJ Z;  2R7Z I;  5IP7 I;  1RLY A;  4RVH A;  2KI7 B;  1RQF A;  4NOZ A;  5T6B A;  4A3B I;  2Q51 A;  1VQ8 Z;  1Y1V S;  3GTL I;  1YI2 Z;  3CCQ Z;  1KC8 2;  1TWH I;  1Q7Y 1;  2QKD A;  1JWH C;  3HOU I;  4E31 A;  5T67 A;  2Y0S A;  4MD8 A;  1KD1 2;  2G2K A;  2P3Y A;  5D1P A;  3I55 Z;  1JJ2 Y;  3GTG I;  1ZB9 A;  2WB1 A;  2JA7 I;  1RO4 A;  2M6N A;  2V8I A;  4S1T A;  2QA4 Z;  2IZ4 A;  4A3I I;  1N8R 2;  3GTM I;  1L1O C;  2QEX Z;  2PMZ A;  3OW2 Z;  5D1O B;  1QVG Y;  1QF8 A;  1M1K 2;  3HOY I;  2PM9 A;  4A3J I;  4MRI A;  3CME Z;  2P28 A;  4NH1 C;  3D6W A;  3S1Q I;  3CCL 1;  3ESW A;  1YIT Z;  5FLM I;  1JJ2 Z;  3RZO I;  3GCF A;  4RVF A;  2DE7 A;  4DGL A;  2K3R A;  3F3P C;  2RIQ A;  3CCR 1;  2E9H A;  3HOX I;  2DE5 A;  3EER A;  4AYB A;  4DQY B;  4A3M I;  4NBG A;  1KC8 1;  2JNY A;  4E2X A;  1YHQ Z;  1VLA A;  1QVG Z;  1RO0 A;  3H0G I;  3G6E 1;  3S1M I;  1KD1 1;  2KPI A;  2VUG A;  2RHB A;  1M90 1;  3CC4 Z;  3CCM Z;  1VQM Z;  3JAM b;  1TWG I;  4E32 A;  3CCU Z;  1Y1V I;  1S72 Z;  3CC2 Z;  3IF8 A;  3NDJ A;  1VQ7 Z;  1Q86 1;  4MH4 A;  4HGY A;  1X3Z A;  4A3E I;  3BG0 B;  4MON A;  3G4S 1;  3JAM f;  3VTN A;  3G71 Z;  1VQ9 Z;  1N8R 1;  2QR1 B;  1YJN 1;  4BXX I;  2NVX I;  1VQL Z;  2PK7 A;  1M1K 1;  1VQO Z;  2QRD B;  3CMA 1;  5LL6 f;  2JMO A;  3CC7 1;  3HOV I;  2OTL Z;  3GKQ A;  2K5R A;  1QYP A;  2LFU A;  1YUA A;  1VQN 1;  4X6A I;  2V8J A;  3LUS A;  1VQK Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...