3CCSZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 6
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccsZ00
1N8R1 1M901 1YJW1 1VQ8Z 1QVFZ 1NJI1 3OW2Y 1VQ4Z 2OTLZ 1Q811 1W2BY 1KQSZ 1K8A2 3CCS1 3CCUZ 3CCL1 1Q7Y2 1VQ9Z 1S721 1YHQ1 3CC21 1M1K2 1VQKZ 1K731 3I561 3CCJ1 1VQ81 3CCMZ 1JJ2Y 3CMEZ 2OTL1 1Q821 1VQNZ 3CMAZ 3CCU1 1QVGZ 1VQ91 1K8A1 1VQK1 1YIJZ 1VQMZ 3G71Z 3CCVZ 3CCRZ 3CCM1 3G4SZ 3CPWY 1Q861 3OW2Z 3CME1 1W2BZ 1VQN1 3CMA1 2OTJZ 1YJNZ 1KD12 1VQLZ 1VQ5Z 1KC81 3I551 1YITZ 2QA4Z 1YJ9Z 1YIJ1 1VQM1 3CD6Z 1K9M2 3G711 3CCV1 3CCR1 3G4S1 1JJ2Z 1N8R2 1M902 3I55Z 1NJI2 1VQ7Z 2OTJ1 1Q812 1YJN1 1Q7Y1 1VQL1 1VQ51 1YIT1 2QA41 1YJ91 3G6EZ 1M1K1 3CXCY 3CCQZ 3CC4Z 3CD61 2QEXZ 1VQPZ 1QVGY 3CCEZ 3CPWZ 1K732 1VQ6Z 1QVFY 3CC7Z 1VQOZ 1VQ71 1YI2Z 1Q822 1KQSY 3G6E1 3CC41 3CCQ1 2QEX1 1VQP1 3CCE1 1YJWZ 1VQ61 3CC71 1VQO1 1Q862 1YI21 1KD11 3CCSZ 3CCLZ 1S72Z 1YHQZ 1KC82 1VQ41 3CC2Z 3CXCZ 1K9M1 3I56Z 3CCJZ
chains in the Genus database with same CATH superfamily
2E7ZA 1YJW1 3S16I 3GTQI 1NJI1 2OTLZ 4QTUA 1KQSZ 3JAMb 1R9TI 2W03A 4NBDA 3CCL1 5IT9f 2DE6A 2VUGA 1VQ9Z 2K3RA 2VPYA 2JA7I 3HOYI 4NOZA 1VQKZ 3D2LA 2O53A 3NDJA 2E2HI 5FLXf 1VQ81 2QKDA 3J81b 3GTKI 4TNUA 3CMEZ 1Q821 3PO3I 2OOYB 1SIWA 3CMAZ 1QVGZ 2F4MA 3I4MI 5CM2M 2R6MA 3GTJI 3CCM1 2JS4A 2LFUA 4A3LI 3OW2Z 1W2BZ 1YUAA 4BBRI 4MONA 1QYPA 1VQ5Z 3S1RI 1YITZ 2GTIA 3CCV1 3I4NI 4MD9A 1X0TA 5C4JI 1SFOI 1N8R2 2VPWA 1M902 1Y1VS 2JIMA 4XX2A 1JWHC 2OTJ1 1Q812 1Q7Y1 2RBLA 4RVDA 1YJ91 3G6EZ 2JIRA 2IV2X 3M4OI 2HU9A 4A3MI 3CD61 2E9HA 1QVGY 3CPWZ 1USPB 3CC7Z 2JIPA 1Q16A 3HOZI 1NP6A 3IFUA 4HGYA 5D1PA 4NBCA 3CC41 1RQFA 1ZB9A 2QEX1 1VQP1 4A93I 3CCE1 5T64A 1TWAI 1YJWZ 3QWUA 5D1OB 1TWHI 4Y7NI 2NVTI 2RT9A 3CCLZ 2JA5I 3J7A4 2NVYI 2NVQI 2KPIA 1X3WA 1K9M1 4BXXI 3TDHB 1DL6A 1VQ8Z 1QVFZ 3J80f 5A2Qf 2VF1A 4RVFA 2AYDA 3S1NI 3CQZI 3PO3S 5T67A 1Z03A 1K731 3CCJ1 3GTMI 2W04A 2JIQA 3CCMZ 1RO2A 2Q4ZA 1JJ2Y 2NAPA 2JUBA 2B63I 5IP9I 3FQQA 4E2YA 3VMHA 3NH8A 3KIHA 4MD7A 3CCVZ 1VQN1 2QLVB 2GTHA 2JIOA 3S2DI 2OTJZ 5IT9b 1WZNA 4RV9A 1KD12 2V8JA 1TWGI 1YJ9Z 3GTOI 2AKLA 1TWCI 1N2FA 1YIJ1 2JA8I 1VQM1 2YU9I 1RNIA 3CD6Z 3JAMf 3IF8A 5FLXb 3G711 3CCR1 2F4OA 4E2WA 3F3PC 4DK1A 3G4S1 5LL6f 2JMOA 2P3YA 4MXUA 3I55Z 3FQMA 3RZOI 1ZH1A 1WW9A 4NB9A 3TE5B 2QA41 1Z01A 3NH4A 2R93I 3CXCY 3CC4Z 1NUIA 2QEXZ 1VQPZ 3CCEZ 1QXFA 4NBHA 4NFRA 3HKZA 1WJ2A 1I6HI 1KQSY 4A3JI 4A3GI 2LIYA 1WCMI 3CCQ1 2JA6I 1VQ61 1WIIA 2E2II 3M3YI 1Q862 1VQO1 3D6WA 2NVXI 4E33A 5IP7I 4NH1C 4DQYB 3LUSA 4E32A 2M48A 3HOVI 1KC82 2VPXA 4BY7I 3CCJZ 3I07A 1N8R1 1M901 3NFZA 4DGLA 2I3CA 3EEDA 3OW2Y 1RO4A 1VQ4Z 3GTMS 1Q811 1W2BY 1K8A2 1FDIA 1S721 4Y52I 1YHQ1 4BY1I 3CC21 2GU2A 2V45A 1M1K2 2V3VA 5C3EI 4BBSI 1VQNZ 3Q87A 2P28A 4A3DI 3CCU1 2R92I 3GTPI 2HF1A 1K8A1 1YIJZ 1TFIA 1VQMZ 3G71Z 3J80b 5A2Qb 3CCRZ 2J6AA 3S15I 3G4SZ 3CPWY 3GTGI 5C4XI 4NBBA 1Y8CA 4A3CI 3MZLB 2IZ4A 2DE7A 2V8KA 2JR6A 3VTNA 2QA4Z 4A3FI 1AA6A 4A3II 3MONA 4E2ZA 3VMGA 1NJI2 4A3BI 1YJN1 1VQL1 1I3QI 2BJOA 1KRLA 3H3VJ 3CCQZ 4E30A 4CL1A 3ESWA 1VQ6Z 1Z02A 1QVFY 2RPRA 2YADA 1VQOZ 1P9NA 1VQ71 4AYBA 1Q822 4NBEA 3U50C 2PK7A 3S1QI 3P5JB 2R7ZI 1L1OC 3S2HI 4NBFA 2QREB 1LQLA 2E2JI 1RLYA 1K83I 4RS4A 3J81f 2V8IA 1YI21 3MZKB 1KD11 2G2KA 1USPA 3EERA 3S1MI 2VUMI 1S72Z 2OOXB 1YHQZ 5C44I 3BG1B 2KI7B 3CC2Z 1X3ZA 2ZAEB 3HOUI 3VB9A 1TWFI 2Q51A 4RVGA 3CCS1 3CCUZ 3BG0B 1Q7Y2 5D1OA 3GCFA 3RZDI 2JNYA 2RHBA 4QTTA 4RVHA 3I561 3KIFA 4NBGA 1VLAA 4A3EI 3HOWI 3IR7A 2OZKA 2OTL1 1RO0A 3GTLI 2QRDB 2WAQA 3D9XA 1QF8A 1VQ91 3IX0A 2M6NA 1VQK1 4E2XA 4EWCA 1Q861 3CME1 4HH4A 1Y1WI 3CMA1 1YJNZ 1VQLZ 3FKII 1S7MA 4MD8A 1KC81 2H85A 3I551 2QR1B 3GKQA 3T4NB 1K9M2 4MH4A 2LEXA 1JJ2Z 2QRCB 2PMZA 1PFTA 3NH5A 4NB8A 1VQ7Z 1I50I 2RIQA 3PO2I 2DE5A 4MRIA 4HGZA 1VQ51 4S1TA 2VPZA 1YIT1 1M1K1 1Y1VI 1YUKA 5FLMI 3VMIA 1K732 2PM9A 2WB1A 4NBAA 5AN9F 1YI2Z 4X6AI 2K5RA 3F3FC 3G6E1 2O4HA 3S17I 4A3KI 1ML8A 3NDIA 3CC71 1ZB8A 2Y0SA 1FDOA 4E31A 2EGTA 3H0GI 3CCSZ 1VQ41 3CXCZ 3K7AI 2IZ3A 5T6BA 3HOXI 3S14I 3I56Z
chains in the Genus database with same CATH topology
1YJW1 3S16I 3GTQI 1NJI1 2OTLZ 4QTUA 1KQSZ 3JAMb 1R9TI 2W03A 4NBDA 3CCL1 5IT9f 2DE6A 2VUGA 1VQ9Z 2K3RA 2JA7I 3HOYI 4NOZA 1VQKZ 2O53A 3NDJA 2E2HI 5FLXf 1VQ81 2QKDA 3J81b 3GTKI 4TNUA 3CMEZ 1Q821 3PO3I 2OOYB 3CMAZ 1QVGZ 2F4MA 3I4MI 5CM2M 2R6MA 3GTJI 3CCM1 2JS4A 2LFUA 4A3LI 3OW2Z 1W2BZ 1YUAA 4BBRI 4MONA 1QYPA 1VQ5Z 3S1RI 1YITZ 2GTIA 3CCV1 3I4NI 4MD9A 1X0TA 5C4JI 1SFOI 1N8R2 1M902 1Y1VS 4XX2A 1JWHC 2OTJ1 1Q812 1Q7Y1 2RBLA 4RVDA 1YJ91 3G6EZ 3M4OI 2HU9A 4A3MI 3CD61 2E9HA 1QVGY 3CPWZ 1USPB 3CC7Z 3HOZI 1NP6A 3IFUA 4HGYA 5D1PA 4NBCA 3CC41 1RQFA 1ZB9A 2QEX1 1VQP1 4A93I 3CCE1 5T64A 1TWAI 1YJWZ 3QWUA 5D1OB 1TWHI 4Y7NI 2NVTI 2RT9A 3CCLZ 2JA5I 3J7A4 2NVYI 2NVQI 2KPIA 1X3WA 1K9M1 4BXXI 3TDHB 1DL6A 1VQ8Z 1QVFZ 3J80f 5A2Qf 2VF1A 4RVFA 3S1NI 3CQZI 3PO3S 5T67A 1Z03A 1K731 3CCJ1 3GTMI 2W04A 3CCMZ 1RO2A 2Q4ZA 1JJ2Y 2JUBA 2B63I 5IP9I 3FQQA 4E2YA 3VMHA 3NH8A 3KIHA 4MD7A 3CCVZ 1VQN1 2QLVB 2GTHA 3S2DI 2OTJZ 5IT9b 4RV9A 1KD12 2V8JA 1TWGI 1YJ9Z 3GTOI 2AKLA 1TWCI 1N2FA 1YIJ1 2JA8I 1VQM1 2YU9I 1RNIA 3CD6Z 3JAMf 3IF8A 5FLXb 3G711 3CCR1 2F4OA 4E2WA 3F3PC 4DK1A 3G4S1 5LL6f 2JMOA 2P3YA 4MXUA 3I55Z 3FQMA 3RZOI 1ZH1A 1WW9A 4NB9A 3TE5B 2QA41 1Z01A 3NH4A 2R93I 3CXCY 3CC4Z 1NUIA 2QEXZ 1VQPZ 3CCEZ 4NBHA 4NFRA 3HKZA 1I6HI 1KQSY 4A3JI 4A3GI 2LIYA 1WCMI 3CCQ1 2JA6I 1VQ61 1WIIA 2E2II 3M3YI 1Q862 1VQO1 3D6WA 2NVXI 4E33A 5IP7I 4NH1C 4DQYB 3LUSA 4E32A 2M48A 3HOVI 1KC82 4BY7I 3CCJZ 3I07A 1N8R1 1M901 3NFZA 4DGLA 2I3CA 3EEDA 3OW2Y 1RO4A 1VQ4Z 3GTMS 1Q811 1W2BY 1K8A2 1S721 4Y52I 1YHQ1 4BY1I 3CC21 2GU2A 1M1K2 5C3EI 4BBSI 1VQNZ 3Q87A 2P28A 4A3DI 3CCU1 2R92I 3GTPI 2HF1A 1K8A1 1YIJZ 1TFIA 1VQMZ 3G71Z 3J80b 5A2Qb 3CCRZ 2J6AA 3S15I 3G4SZ 3CPWY 3GTGI 5C4XI 4NBBA 4A3CI 3MZLB 2IZ4A 2DE7A 2V8KA 2JR6A 3VTNA 2QA4Z 4A3FI 4A3II 3MONA 4E2ZA 3VMGA 1NJI2 4A3BI 1YJN1 1VQL1 1I3QI 2BJOA 1KRLA 3H3VJ 3CCQZ 4E30A 4CL1A 3ESWA 1VQ6Z 1Z02A 1QVFY 2RPRA 2YADA 1VQOZ 1P9NA 1VQ71 4AYBA 1Q822 4NBEA 3U50C 2PK7A 3S1QI 3P5JB 2R7ZI 1L1OC 3S2HI 4NBFA 2QREB 1LQLA 2E2JI 1RLYA 1K83I 4RS4A 3J81f 2V8IA 1YI21 3MZKB 1KD11 2G2KA 1USPA 3EERA 3S1MI 2VUMI 1S72Z 2OOXB 1YHQZ 5C44I 3BG1B 2KI7B 3CC2Z 1X3ZA 2ZAEB 3HOUI 3VB9A 1TWFI 2Q51A 4RVGA 3CCS1 3CCUZ 3BG0B 1Q7Y2 5D1OA 3GCFA 3RZDI 2JNYA 2RHBA 4QTTA 4RVHA 3I561 3KIFA 4NBGA 1VLAA 4A3EI 3HOWI 2OZKA 2OTL1 1RO0A 3GTLI 2QRDB 2WAQA 3D9XA 1QF8A 1VQ91 3IX0A 2M6NA 1VQK1 4E2XA 4EWCA 1Q861 3CME1 4HH4A 1Y1WI 3CMA1 1YJNZ 1VQLZ 3FKII 1S7MA 4MD8A 1KC81 2H85A 3I551 2QR1B 3GKQA 3T4NB 1K9M2 4MH4A 1JJ2Z 2QRCB 2PMZA 1PFTA 3NH5A 4NB8A 1VQ7Z 1I50I 2RIQA 3PO2I 2DE5A 4MRIA 4HGZA 1VQ51 4S1TA 1YIT1 1M1K1 1Y1VI 1YUKA 5FLMI 3VMIA 1K732 2PM9A 2WB1A 4NBAA 5AN9F 1YI2Z 4X6AI 2K5RA 3F3FC 3G6E1 2O4HA 3S17I 4A3KI 1ML8A 3NDIA 3CC71 1ZB8A 2Y0SA 4E31A 2EGTA 3H0GI 3CCSZ 1VQ41 3CXCZ 3K7AI 2IZ3A 5T6BA 3HOXI 3S14I 3I56Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 1;  1M90 1;  1YJW 1;  1VQ8 Z;  1QVF Z;  1NJI 1;  3OW2 Y;  1VQ4 Z;  2OTL Z;  1Q81 1;  1W2B Y;  1KQS Z;  1K8A 2;  3CCS 1;  3CCU Z;  3CCL 1;  1Q7Y 2;  1VQ9 Z;  1S72 1;  1YHQ 1;  3CC2 1;  1M1K 2;  1VQK Z;  1K73 1;  3I56 1;  3CCJ 1;  1VQ8 1;  3CCM Z;  1JJ2 Y;  3CME Z;  2OTL 1;  1Q82 1;  1VQN Z;  3CMA Z;  3CCU 1;  1QVG Z;  1VQ9 1;  1K8A 1;  1VQK 1;  1YIJ Z;  1VQM Z;  3G71 Z;  3CCV Z;  3CCR Z;  3CCM 1;  3G4S Z;  3CPW Y;  1Q86 1;  3OW2 Z;  3CME 1;  1W2B Z;  1VQN 1;  3CMA 1;  2OTJ Z;  1YJN Z;  1KD1 2;  1VQL Z;  1VQ5 Z;  1KC8 1;  3I55 1;  1YIT Z;  2QA4 Z;  1YJ9 Z;  1YIJ 1;  1VQM 1;  3CD6 Z;  1K9M 2;  3G71 1;  3CCV 1;  3CCR 1;  3G4S 1;  1JJ2 Z;  1N8R 2;  1M90 2;  3I55 Z;  1NJI 2;  1VQ7 Z;  2OTJ 1;  1Q81 2;  1YJN 1;  1Q7Y 1;  1VQL 1;  1VQ5 1;  1YIT 1;  2QA4 1;  1YJ9 1;  3G6E Z;  1M1K 1;  3CXC Y;  3CCQ Z;  3CC4 Z;  3CD6 1;  2QEX Z;  1VQP Z;  1QVG Y;  3CCE Z;  3CPW Z;  1K73 2;  1VQ6 Z;  1QVF Y;  3CC7 Z;  1VQO Z;  1VQ7 1;  1YI2 Z;  1Q82 2;  1KQS Y;  3G6E 1;  3CC4 1;  3CCQ 1;  2QEX 1;  1VQP 1;  3CCE 1;  1YJW Z;  1VQ6 1;  3CC7 1;  1VQO 1;  1Q86 2;  1YI2 1;  1KD1 1;  3CCS Z;  3CCL Z;  1S72 Z;  1YHQ Z;  1KC8 2;  1VQ4 1;  3CC2 Z;  3CXC Z;  1K9M 1;  3I56 Z;  3CCJ Z; 
#chains in the Genus database with same CATH topology
 2E7Z A;  1YJW 1;  3S16 I;  3GTQ I;  1NJI 1;  2OTL Z;  4QTU A;  1KQS Z;  3JAM b;  1R9T I;  2W03 A;  4NBD A;  3CCL 1;  5IT9 f;  2DE6 A;  2VUG A;  1VQ9 Z;  2K3R A;  2VPY A;  2JA7 I;  3HOY I;  4NOZ A;  1VQK Z;  3D2L A;  2O53 A;  3NDJ A;  2E2H I;  5FLX f;  1VQ8 1;  2QKD A;  3J81 b;  3GTK I;  4TNU A;  3CME Z;  1Q82 1;  3PO3 I;  2OOY B;  1SIW A;  3CMA Z;  1QVG Z;  2F4M A;  3I4M I;  5CM2 M;  2R6M A;  3GTJ I;  3CCM 1;  2JS4 A;  2LFU A;  4A3L I;  3OW2 Z;  1W2B Z;  1YUA A;  4BBR I;  4MON A;  1QYP A;  1VQ5 Z;  3S1R I;  1YIT Z;  2GTI A;  3CCV 1;  3I4N I;  4MD9 A;  1X0T A;  5C4J I;  1SFO I;  1N8R 2;  2VPW A;  1M90 2;  1Y1V S;  2JIM A;  4XX2 A;  1JWH C;  2OTJ 1;  1Q81 2;  1Q7Y 1;  2RBL A;  4RVD A;  1YJ9 1;  3G6E Z;  2JIR A;  2IV2 X;  3M4O I;  2HU9 A;  4A3M I;  3CD6 1;  2E9H A;  1QVG Y;  3CPW Z;  1USP B;  3CC7 Z;  2JIP A;  1Q16 A;  3HOZ I;  1NP6 A;  3IFU A;  4HGY A;  5D1P A;  4NBC A;  3CC4 1;  1RQF A;  1ZB9 A;  2QEX 1;  1VQP 1;  4A93 I;  3CCE 1;  5T64 A;  1TWA I;  1YJW Z;  3QWU A;  5D1O B;  1TWH I;  4Y7N I;  2NVT I;  2RT9 A;  3CCL Z;  2JA5 I;  3J7A 4;  2NVY I;  2NVQ I;  2KPI A;  1X3W A;  1K9M 1;  4BXX I;  3TDH B;  1DL6 A;  1VQ8 Z;  1QVF Z;  3J80 f;  5A2Q f;  2VF1 A;  4RVF A;  2AYD A;  3S1N I;  3CQZ I;  3PO3 S;  5T67 A;  1Z03 A;  1K73 1;  3CCJ 1;  3GTM I;  2W04 A;  2JIQ A;  3CCM Z;  1RO2 A;  2Q4Z A;  1JJ2 Y;  2NAP A;  2JUB A;  2B63 I;  5IP9 I;  3FQQ A;  4E2Y A;  3VMH A;  3NH8 A;  3KIH A;  4MD7 A;  3CCV Z;  1VQN 1;  2QLV B;  2GTH A;  2JIO A;  3S2D I;  2OTJ Z;  5IT9 b;  1WZN A;  4RV9 A;  1KD1 2;  2V8J A;  1TWG I;  1YJ9 Z;  3GTO I;  2AKL A;  1TWC I;  1N2F A;  1YIJ 1;  2JA8 I;  1VQM 1;  2YU9 I;  1RNI A;  3CD6 Z;  3JAM f;  3IF8 A;  5FLX b;  3G71 1;  3CCR 1;  2F4O A;  4E2W A;  3F3P C;  4DK1 A;  3G4S 1;  5LL6 f;  2JMO A;  2P3Y A;  4MXU A;  3I55 Z;  3FQM A;  3RZO I;  1ZH1 A;  1WW9 A;  4NB9 A;  3TE5 B;  2QA4 1;  1Z01 A;  3NH4 A;  2R93 I;  3CXC Y;  3CC4 Z;  1NUI A;  2QEX Z;  1VQP Z;  3CCE Z;  1QXF A;  4NBH A;  4NFR A;  3HKZ A;  1WJ2 A;  1I6H I;  1KQS Y;  4A3J I;  4A3G I;  2LIY A;  1WCM I;  3CCQ 1;  2JA6 I;  1VQ6 1;  1WII A;  2E2I I;  3M3Y I;  1Q86 2;  1VQO 1;  3D6W A;  2NVX I;  4E33 A;  5IP7 I;  4NH1 C;  4DQY B;  3LUS A;  4E32 A;  2M48 A;  3HOV I;  1KC8 2;  2VPX A;  4BY7 I;  3CCJ Z;  3I07 A;  1N8R 1;  1M90 1;  3NFZ A;  4DGL A;  2I3C A;  3EED A;  3OW2 Y;  1RO4 A;  1VQ4 Z;  3GTM S;  1Q81 1;  1W2B Y;  1K8A 2;  1FDI A;  1S72 1;  4Y52 I;  1YHQ 1;  4BY1 I;  3CC2 1;  2GU2 A;  2V45 A;  1M1K 2;  2V3V A;  5C3E I;  4BBS I;  1VQN Z;  3Q87 A;  2P28 A;  4A3D I;  3CCU 1;  2R92 I;  3GTP I;  2HF1 A;  1K8A 1;  1YIJ Z;  1TFI A;  1VQM Z;  3G71 Z;  3J80 b;  5A2Q b;  3CCR Z;  2J6A A;  3S15 I;  3G4S Z;  3CPW Y;  3GTG I;  5C4X I;  4NBB A;  1Y8C A;  4A3C I;  3MZL B;  2IZ4 A;  2DE7 A;  2V8K A;  2JR6 A;  3VTN A;  2QA4 Z;  4A3F I;  1AA6 A;  4A3I I;  3MON A;  4E2Z A;  3VMG A;  1NJI 2;  4A3B I;  1YJN 1;  1VQL 1;  1I3Q I;  2BJO A;  1KRL A;  3H3V J;  3CCQ Z;  4E30 A;  4CL1 A;  3ESW A;  1VQ6 Z;  1Z02 A;  1QVF Y;  2RPR A;  2YAD A;  1VQO Z;  1P9N A;  1VQ7 1;  4AYB A;  1Q82 2;  4NBE A;  3U50 C;  2PK7 A;  3S1Q I;  3P5J B;  2R7Z I;  1L1O C;  3S2H I;  4NBF A;  2QRE B;  1LQL A;  2E2J I;  1RLY A;  1K83 I;  4RS4 A;  3J81 f;  2V8I A;  1YI2 1;  3MZK B;  1KD1 1;  2G2K A;  1USP A;  3EER A;  3S1M I;  2VUM I;  1S72 Z;  2OOX B;  1YHQ Z;  5C44 I;  3BG1 B;  2KI7 B;  3CC2 Z;  1X3Z A;  2ZAE B;  3HOU I;  3VB9 A;  1TWF I;  2Q51 A;  4RVG A;  3CCS 1;  3CCU Z;  3BG0 B;  1Q7Y 2;  5D1O A;  3GCF A;  3RZD I;  2JNY A;  2RHB A;  4QTT A;  4RVH A;  3I56 1;  3KIF A;  4NBG A;  1VLA A;  4A3E I;  3HOW I;  3IR7 A;  2OZK A;  2OTL 1;  1RO0 A;  3GTL I;  2QRD B;  2WAQ A;  3D9X A;  1QF8 A;  1VQ9 1;  3IX0 A;  2M6N A;  1VQK 1;  4E2X A;  4EWC A;  1Q86 1;  3CME 1;  4HH4 A;  1Y1W I;  3CMA 1;  1YJN Z;  1VQL Z;  3FKI I;  1S7M A;  4MD8 A;  1KC8 1;  2H85 A;  3I55 1;  2QR1 B;  3GKQ A;  3T4N B;  1K9M 2;  4MH4 A;  2LEX A;  1JJ2 Z;  2QRC B;  2PMZ A;  1PFT A;  3NH5 A;  4NB8 A;  1VQ7 Z;  1I50 I;  2RIQ A;  3PO2 I;  2DE5 A;  4MRI A;  4HGZ A;  1VQ5 1;  4S1T A;  2VPZ A;  1YIT 1;  1M1K 1;  1Y1V I;  1YUK A;  5FLM I;  3VMI A;  1K73 2;  2PM9 A;  2WB1 A;  4NBA A;  5AN9 F;  1YI2 Z;  4X6A I;  2K5R A;  3F3F C;  3G6E 1;  2O4H A;  3S17 I;  4A3K I;  1ML8 A;  3NDI A;  3CC7 1;  1ZB8 A;  2Y0S A;  1FDO A;  4E31 A;  2EGT A;  3H0G I;  3CCS Z;  1VQ4 1;  3CXC Z;  3K7A I;  2IZ3 A;  5T6B A;  3HOX I;  3S14 I;  3I56 Z; 
#chains in the Genus database with same CATH homology
 1YJW 1;  3S16 I;  3GTQ I;  1NJI 1;  2OTL Z;  4QTU A;  1KQS Z;  3JAM b;  1R9T I;  2W03 A;  4NBD A;  3CCL 1;  5IT9 f;  2DE6 A;  2VUG A;  1VQ9 Z;  2K3R A;  2JA7 I;  3HOY I;  4NOZ A;  1VQK Z;  2O53 A;  3NDJ A;  2E2H I;  5FLX f;  1VQ8 1;  2QKD A;  3J81 b;  3GTK I;  4TNU A;  3CME Z;  1Q82 1;  3PO3 I;  2OOY B;  3CMA Z;  1QVG Z;  2F4M A;  3I4M I;  5CM2 M;  2R6M A;  3GTJ I;  3CCM 1;  2JS4 A;  2LFU A;  4A3L I;  3OW2 Z;  1W2B Z;  1YUA A;  4BBR I;  4MON A;  1QYP A;  1VQ5 Z;  3S1R I;  1YIT Z;  2GTI A;  3CCV 1;  3I4N I;  4MD9 A;  1X0T A;  5C4J I;  1SFO I;  1N8R 2;  1M90 2;  1Y1V S;  4XX2 A;  1JWH C;  2OTJ 1;  1Q81 2;  1Q7Y 1;  2RBL A;  4RVD A;  1YJ9 1;  3G6E Z;  3M4O I;  2HU9 A;  4A3M I;  3CD6 1;  2E9H A;  1QVG Y;  3CPW Z;  1USP B;  3CC7 Z;  3HOZ I;  1NP6 A;  3IFU A;  4HGY A;  5D1P A;  4NBC A;  3CC4 1;  1RQF A;  1ZB9 A;  2QEX 1;  1VQP 1;  4A93 I;  3CCE 1;  5T64 A;  1TWA I;  1YJW Z;  3QWU A;  5D1O B;  1TWH I;  4Y7N I;  2NVT I;  2RT9 A;  3CCL Z;  2JA5 I;  3J7A 4;  2NVY I;  2NVQ I;  2KPI A;  1X3W A;  1K9M 1;  4BXX I;  3TDH B;  1DL6 A;  1VQ8 Z;  1QVF Z;  3J80 f;  5A2Q f;  2VF1 A;  4RVF A;  3S1N I;  3CQZ I;  3PO3 S;  5T67 A;  1Z03 A;  1K73 1;  3CCJ 1;  3GTM I;  2W04 A;  3CCM Z;  1RO2 A;  2Q4Z A;  1JJ2 Y;  2JUB A;  2B63 I;  5IP9 I;  3FQQ A;  4E2Y A;  3VMH A;  3NH8 A;  3KIH A;  4MD7 A;  3CCV Z;  1VQN 1;  2QLV B;  2GTH A;  3S2D I;  2OTJ Z;  5IT9 b;  4RV9 A;  1KD1 2;  2V8J A;  1TWG I;  1YJ9 Z;  3GTO I;  2AKL A;  1TWC I;  1N2F A;  1YIJ 1;  2JA8 I;  1VQM 1;  2YU9 I;  1RNI A;  3CD6 Z;  3JAM f;  3IF8 A;  5FLX b;  3G71 1;  3CCR 1;  2F4O A;  4E2W A;  3F3P C;  4DK1 A;  3G4S 1;  5LL6 f;  2JMO A;  2P3Y A;  4MXU A;  3I55 Z;  3FQM A;  3RZO I;  1ZH1 A;  1WW9 A;  4NB9 A;  3TE5 B;  2QA4 1;  1Z01 A;  3NH4 A;  2R93 I;  3CXC Y;  3CC4 Z;  1NUI A;  2QEX Z;  1VQP Z;  3CCE Z;  4NBH A;  4NFR A;  3HKZ A;  1I6H I;  1KQS Y;  4A3J I;  4A3G I;  2LIY A;  1WCM I;  3CCQ 1;  2JA6 I;  1VQ6 1;  1WII A;  2E2I I;  3M3Y I;  1Q86 2;  1VQO 1;  3D6W A;  2NVX I;  4E33 A;  5IP7 I;  4NH1 C;  4DQY B;  3LUS A;  4E32 A;  2M48 A;  3HOV I;  1KC8 2;  4BY7 I;  3CCJ Z;  3I07 A;  1N8R 1;  1M90 1;  3NFZ A;  4DGL A;  2I3C A;  3EED A;  3OW2 Y;  1RO4 A;  1VQ4 Z;  3GTM S;  1Q81 1;  1W2B Y;  1K8A 2;  1S72 1;  4Y52 I;  1YHQ 1;  4BY1 I;  3CC2 1;  2GU2 A;  1M1K 2;  5C3E I;  4BBS I;  1VQN Z;  3Q87 A;  2P28 A;  4A3D I;  3CCU 1;  2R92 I;  3GTP I;  2HF1 A;  1K8A 1;  1YIJ Z;  1TFI A;  1VQM Z;  3G71 Z;  3J80 b;  5A2Q b;  3CCR Z;  2J6A A;  3S15 I;  3G4S Z;  3CPW Y;  3GTG I;  5C4X I;  4NBB A;  4A3C I;  3MZL B;  2IZ4 A;  2DE7 A;  2V8K A;  2JR6 A;  3VTN A;  2QA4 Z;  4A3F I;  4A3I I;  3MON A;  4E2Z A;  3VMG A;  1NJI 2;  4A3B I;  1YJN 1;  1VQL 1;  1I3Q I;  2BJO A;  1KRL A;  3H3V J;  3CCQ Z;  4E30 A;  4CL1 A;  3ESW A;  1VQ6 Z;  1Z02 A;  1QVF Y;  2RPR A;  2YAD A;  1VQO Z;  1P9N A;  1VQ7 1;  4AYB A;  1Q82 2;  4NBE A;  3U50 C;  2PK7 A;  3S1Q I;  3P5J B;  2R7Z I;  1L1O C;  3S2H I;  4NBF A;  2QRE B;  1LQL A;  2E2J I;  1RLY A;  1K83 I;  4RS4 A;  3J81 f;  2V8I A;  1YI2 1;  3MZK B;  1KD1 1;  2G2K A;  1USP A;  3EER A;  3S1M I;  2VUM I;  1S72 Z;  2OOX B;  1YHQ Z;  5C44 I;  3BG1 B;  2KI7 B;  3CC2 Z;  1X3Z A;  2ZAE B;  3HOU I;  3VB9 A;  1TWF I;  2Q51 A;  4RVG A;  3CCS 1;  3CCU Z;  3BG0 B;  1Q7Y 2;  5D1O A;  3GCF A;  3RZD I;  2JNY A;  2RHB A;  4QTT A;  4RVH A;  3I56 1;  3KIF A;  4NBG A;  1VLA A;  4A3E I;  3HOW I;  2OZK A;  2OTL 1;  1RO0 A;  3GTL I;  2QRD B;  2WAQ A;  3D9X A;  1QF8 A;  1VQ9 1;  3IX0 A;  2M6N A;  1VQK 1;  4E2X A;  4EWC A;  1Q86 1;  3CME 1;  4HH4 A;  1Y1W I;  3CMA 1;  1YJN Z;  1VQL Z;  3FKI I;  1S7M A;  4MD8 A;  1KC8 1;  2H85 A;  3I55 1;  2QR1 B;  3GKQ A;  3T4N B;  1K9M 2;  4MH4 A;  1JJ2 Z;  2QRC B;  2PMZ A;  1PFT A;  3NH5 A;  4NB8 A;  1VQ7 Z;  1I50 I;  2RIQ A;  3PO2 I;  2DE5 A;  4MRI A;  4HGZ A;  1VQ5 1;  4S1T A;  1YIT 1;  1M1K 1;  1Y1V I;  1YUK A;  5FLM I;  3VMI A;  1K73 2;  2PM9 A;  2WB1 A;  4NBA A;  5AN9 F;  1YI2 Z;  4X6A I;  2K5R A;  3F3F C;  3G6E 1;  2O4H A;  3S17 I;  4A3K I;  1ML8 A;  3NDI A;  3CC7 1;  1ZB8 A;  2Y0S A;  4E31 A;  2EGT A;  3H0G I;  3CCS Z;  1VQ4 1;  3CXC Z;  3K7A I;  2IZ3 A;  5T6B A;  3HOX I;  3S14 I;  3I56 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...