3CCMZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccmZ00
1Q822 3CXCZ 1Q862 3CCQZ 3CCE1 1W2BY 3CCM1 1K8A2 3CPWZ 1VQ4Z 1S721 3I561 2QA41 3CC21 1VQP1 1M1K1 1JJ2Z 3G6EZ 1VQ71 1M901 3CCVZ 1YJ9Z 3CCU1 1QVFY 1QVGZ 3OW2Y 1QVGY 1YI21 1VQ61 1NJI2 3CCLZ 3G711 1VQOZ 3CCQ1 1M902 1QVFZ 3CC2Z 3I55Z 1Q821 3CC4Z 1YJN1 3CMA1 1VQMZ 1JJ2Y 3G4SZ 1YI2Z 3CMAZ 3CC41 1VQ6Z 3CPWY 1N8R1 1Q861 1W2BZ 1K8A1 1K732 3CD6Z 3CCUZ 1YHQ1 3CXCY 1VQL1 1KD11 2OTLZ 3G71Z 1K9M1 3CCV1 1YJ91 2OTL1 1K731 1YIJZ 3CD61 1N8R2 3CCEZ 3OW2Z 3CCRZ 3I551 1NJI1 1VQK1 1VQ9Z 1Q7Y2 1VQO1 3G6E1 3CCL1 3G4S1 1Q811 2QEXZ 3CCSZ 1VQ81 1VQKZ 1YJNZ 3CC7Z 1S72Z 1VQ41 2OTJ1 3CCJZ 3CCS1 2QEX1 1YITZ 1KQSY 1YIJ1 1KQSZ 1M1K2 1VQ7Z 1VQNZ 1Q812 3CCR1 1VQPZ 1YIT1 3CME1 1VQ51 1YJW1 1VQ5Z 3I56Z 3CC71 1Q7Y1 3CCMZ 1KD12 1YJWZ 1VQ91 2OTJZ 1VQN1 2QA4Z 1K9M2 1VQ8Z 1VQLZ 1YHQZ 1KC82 3CCJ1 1VQM1 3CMEZ 1KC81
chains in the Genus database with same CATH superfamily
4DK1A 2Y0SA 3NFZA 3P5JB 2K3RA 3CXCZ 3CQZI 1Q862 3H3VJ 1RO4A 1RO0A 1K8A2 2Q51A 3EERA 3FKII 1M1K1 3RZDI 1VQ71 1YJ9Z 3U50C 3J7A4 4A3CI 4RV9A 1I50I 4E33A 4A3MI 2KPIA 1QVGZ 1ML8A 3OW2Y 3IR7A 3G711 2M48A 1VQOZ 3CCQ1 3S1RI 2P28A 1JJ2Y 2BJOA 3TDHB 3G4SZ 4A3II 4HGYA 1YI2Z 4MXUA 1YUKA 2RBLA 1N8R1 2R92I 5D1OA 3CCUZ 4A3DI 4NBHA 2R6MA 2JS4A 2IZ3A 1K9M1 1YJ91 3J80f 1SFOI 2RIQA 3GTJI 3FQQA 1VQO1 3G6E1 4A3LI 5A2Qf 3VMIA 1YITZ 5C4XI 1YIJ1 1M1K2 3PO2I 1ZB9A 2K5RA 1NP6A 2V8IA 3GTQI 4RVFA 1RQFA 3K7AI 2GTIA 2HU9A 5FLXb 3CC71 1Q7Y1 1FDIA 1KD12 3NDJA 3RZOI 3HOVI 4MONA 1K9M2 3GTKI 3GTMS 1VQ8Z 2P3YA 1S7MA 5D1OB 1P9NA 3CMEZ 1KC81 3CCQZ 2VUGA 3HOUI 3J80b 4XX2A 3CCM1 2AKLA 3NH4A 1S721 2ZAEB 3MONA 4NBEA 3I561 1TWFI 2VPXA 1PFTA 2RPRA 3I4NI 2LFUA 2AYDA 1M901 1TFIA 3CCU1 1QVFY 3D6WA 3I07A 4S1TA 2V8JA 1SIWA 2JA8I 3KIHA 5C3EI 1VQ61 1L1OC 2O4HA 4NBBA 2E2HI 2JUBA 2QREB 3CC2Z 2O53A 3S1MI 3CMA1 4QTTA 3S14I 1R9TI 4E31A 3Q87A 3CMAZ 2EGTA 2VUMI 2QKDA 2JIOA 3IF8A 4CL1A 3LUSA 1Q861 1Y1WI 1K8A1 1K732 3CD6Z 1QXFA 1YHQ1 4Y7NI 4NFRA 5IP7I 4QTUA 1TWHI 1K731 1N8R2 1NUIA 3M4OI 2F4OA 2PM9A 3OW2Z 1NJI1 1VQK1 4NOZA 5CM2M 1Q811 4MD7A 2QEXZ 3CCSZ 5D1PA 1RO2A 3GTPI 1VQ81 1KRLA 4A3JI 2HF1A 5C4JI 2E2II 3S1NI 1Y1VI 3HKZA 2QR1B 2VPZA 2QEX1 3CCJZ 3CCS1 2OTJ1 3F3FC 3QWUA 4HH4A 3M3YI 1YIT1 5T67A 1VQ51 1YJW1 3I56Z 2JA7I 3PO3S 3NDIA 1VQ91 3BG0B 2OZKA 1VQN1 4HGZA 1Y8CA 2QA4Z 2W03A 1WZNA 2WB1A 2H85A 1LQLA 1KC82 4NH1C 1VQM1 1Z02A 2RT9A 3S2DI 4NBGA 3FQMA 3MZLB 2VPWA 3J81b 1W2BY 3HOYI 1WCMI 3TE5B 1N2FA 5C44I 3CPWZ 3GTGI 4AYBA 3CC21 5T6BA 4E2ZA 4BY7I 3H0GI 3HOWI 3G6EZ 5IT9f 1WW9A 1ZB8A 1X3ZA 3CCVZ 2PK7A 1WIIA 1TWCI 3KIFA 5AN9F 2DE5A 4BXXI 2KI7B 4E2XA 1RNIA 1NJI2 3CCLZ 4NBFA 1DL6A 2JIRA 1QVFZ 4E2WA 2DE6A 2GTHA 2M6NA 3J81f 2E2JI 1YJN1 1VQMZ 4TNUA 2JNYA 1VQ6Z 1RLYA 5T64A 4NB9A 5LL6f 5A2Qb 2JA6I 5FLMI 3VMGA 5IT9b 1VQL1 1KD11 1YUAA 2OTLZ 2V45A 4BBSI 3F3PC 2LIYA 3G71Z 3CCV1 4E30A 1WJ2A 2IV2X 2GU2A 1X0TA 1FDOA 2F4MA 1JWHC 2DE7A 3CCEZ 3JAMf 3CCRZ 3I551 1USPB 3S17I 4BY1I 3S1QI 1VQ9Z 1VQKZ 1YJNZ 3CC7Z 1VQ41 2W04A 2JIMA 2J6AA 3BG1B 2VPYA 4NBAA 2I3CA 3EEDA 1VQ7Z 1USPA 1X3WA 1VQPZ 3VB9A 1Y1VS 4Y52I 1VQ5Z 2RHBA 4MD9A 1YJWZ 4A3GI 2OTJZ 2JR6A 3T4NB 4RVGA 3GCFA 4NB8A 1Q822 3CCE1 4NBDA 2B63I 4RVHA 1VQ4Z 2QA41 2OOYB 4DGLA 1VQP1 3I4MI 2Q4ZA 1JJ2Z 3D2LA 3D9XA 3NH5A 4X6AI 4BBRI 1QYPA 1Z03A 1I3QI 4A93I 5IP9I 1QVGY 1YI21 2IZ4A 2JIQA 5FLXf 4E2YA 3HOXI 1M902 1Z01A 2JMOA 2PMZA 2E7ZA 3I55Z 1Q821 2G2KA 4RS4A 3CC4Z 4A3FI 2YU9I 1I6HI 1TWAI 1K83I 3JAMb 3CC41 3S16I 2VF1A 3CPWY 3NH8A 1W2BZ 3IX0A 4A3BI 3GKQA 3CXCY 2NVXI 3ESWA 2NAPA 4A3KI 2JA5I 3PO3I 2OTL1 2OOXB 1YIJZ 4NBCA 3CD61 2R7ZI 3S2HI 3S15I 2WAQA 4MRIA 3VTNA 2NVYI 1AA6A 2QRCB 1Q7Y2 3CCL1 3G4S1 4MH4A 2V8KA 2JIPA 2YADA 1S72Z 1QF8A 1KQSY 1KQSZ 2NVQI 4RVDA 3GTLI 2NVTI 2V3VA 1VQNZ 1ZH1A 2E9HA 1Q812 3CCR1 2QRDB 3CME1 4E32A 1Q16A 1VLAA 3GTMI 2LEXA 4A3EI 3CCMZ 4DQYB 4MD8A 3VMHA 3HOZI 2QLVB 3GTOI 3MZKB 2R93I 1VQLZ 1YHQZ 4EWCA 3CCJ1 3IFUA 1TWGI
chains in the Genus database with same CATH topology
4DK1A 2Y0SA 3NFZA 3P5JB 2K3RA 3CXCZ 3CQZI 1Q862 3H3VJ 1RO4A 1RO0A 1K8A2 2Q51A 3EERA 3FKII 1M1K1 3RZDI 1VQ71 1YJ9Z 3U50C 3J7A4 4A3CI 4RV9A 1I50I 4E33A 4A3MI 2KPIA 1QVGZ 1ML8A 3OW2Y 3G711 2M48A 1VQOZ 3CCQ1 3S1RI 2P28A 1JJ2Y 2BJOA 3TDHB 3G4SZ 4A3II 4HGYA 1YI2Z 4MXUA 1YUKA 2RBLA 1N8R1 2R92I 5D1OA 3CCUZ 4A3DI 4NBHA 2R6MA 2JS4A 2IZ3A 1K9M1 1YJ91 3J80f 1SFOI 2RIQA 3GTJI 3FQQA 1VQO1 3G6E1 4A3LI 5A2Qf 3VMIA 1YITZ 5C4XI 1YIJ1 1M1K2 3PO2I 1ZB9A 2K5RA 1NP6A 2V8IA 3GTQI 4RVFA 1RQFA 3K7AI 2GTIA 2HU9A 5FLXb 3CC71 1Q7Y1 1KD12 3NDJA 3RZOI 3HOVI 4MONA 1K9M2 3GTKI 3GTMS 1VQ8Z 2P3YA 1S7MA 5D1OB 1P9NA 3CMEZ 1KC81 3CCQZ 2VUGA 3HOUI 3J80b 4XX2A 3CCM1 2AKLA 3NH4A 1S721 2ZAEB 3MONA 4NBEA 3I561 1TWFI 1PFTA 2RPRA 3I4NI 2LFUA 1M901 1TFIA 3CCU1 1QVFY 3D6WA 3I07A 4S1TA 2V8JA 2JA8I 3KIHA 5C3EI 1VQ61 1L1OC 2O4HA 4NBBA 2E2HI 2JUBA 2QREB 3CC2Z 2O53A 3S1MI 3CMA1 4QTTA 3S14I 1R9TI 4E31A 3Q87A 3CMAZ 2EGTA 2VUMI 2QKDA 3IF8A 4CL1A 3LUSA 1Q861 1Y1WI 1K8A1 1K732 3CD6Z 1YHQ1 4Y7NI 4NFRA 5IP7I 4QTUA 1TWHI 1K731 1N8R2 1NUIA 3M4OI 2F4OA 2PM9A 3OW2Z 1NJI1 1VQK1 4NOZA 5CM2M 1Q811 4MD7A 2QEXZ 3CCSZ 5D1PA 1RO2A 3GTPI 1VQ81 1KRLA 4A3JI 2HF1A 5C4JI 2E2II 3S1NI 1Y1VI 3HKZA 2QR1B 2QEX1 3CCJZ 3CCS1 2OTJ1 3F3FC 3QWUA 4HH4A 3M3YI 1YIT1 5T67A 1VQ51 1YJW1 3I56Z 2JA7I 3PO3S 3NDIA 1VQ91 3BG0B 2OZKA 1VQN1 4HGZA 2QA4Z 2W03A 2WB1A 2H85A 1LQLA 1KC82 4NH1C 1VQM1 1Z02A 2RT9A 3S2DI 4NBGA 3FQMA 3MZLB 3J81b 1W2BY 3HOYI 1WCMI 3TE5B 1N2FA 5C44I 3CPWZ 3GTGI 4AYBA 3CC21 5T6BA 4E2ZA 4BY7I 3H0GI 3HOWI 3G6EZ 5IT9f 1WW9A 1ZB8A 1X3ZA 3CCVZ 2PK7A 1WIIA 1TWCI 3KIFA 5AN9F 2DE5A 4BXXI 2KI7B 4E2XA 1RNIA 1NJI2 3CCLZ 4NBFA 1DL6A 1QVFZ 4E2WA 2DE6A 2GTHA 2M6NA 3J81f 2E2JI 1YJN1 1VQMZ 4TNUA 2JNYA 1VQ6Z 1RLYA 5T64A 4NB9A 5LL6f 5A2Qb 2JA6I 5FLMI 3VMGA 5IT9b 1VQL1 1KD11 1YUAA 2OTLZ 4BBSI 3F3PC 2LIYA 3G71Z 3CCV1 4E30A 2GU2A 1X0TA 2F4MA 1JWHC 2DE7A 3CCEZ 3JAMf 3CCRZ 3I551 1USPB 3S17I 4BY1I 3S1QI 1VQ9Z 1VQKZ 1YJNZ 3CC7Z 1VQ41 2W04A 2J6AA 3BG1B 4NBAA 2I3CA 3EEDA 1VQ7Z 1USPA 1X3WA 1VQPZ 3VB9A 1Y1VS 4Y52I 1VQ5Z 2RHBA 4MD9A 1YJWZ 4A3GI 2OTJZ 2JR6A 3T4NB 4RVGA 3GCFA 4NB8A 1Q822 3CCE1 4NBDA 2B63I 4RVHA 1VQ4Z 2QA41 2OOYB 4DGLA 1VQP1 3I4MI 2Q4ZA 1JJ2Z 3D9XA 3NH5A 4X6AI 4BBRI 1QYPA 1Z03A 1I3QI 4A93I 5IP9I 1QVGY 1YI21 2IZ4A 4E2YA 5FLXf 3HOXI 1M902 1Z01A 2JMOA 2PMZA 3I55Z 1Q821 2G2KA 4RS4A 3CC4Z 4A3FI 2YU9I 1I6HI 1TWAI 1K83I 3JAMb 3CC41 3S16I 2VF1A 3CPWY 3NH8A 1W2BZ 3IX0A 4A3BI 3GKQA 3CXCY 2NVXI 3ESWA 4A3KI 2JA5I 3PO3I 2OTL1 2OOXB 1YIJZ 4NBCA 3CD61 2R7ZI 3S2HI 3S15I 2WAQA 4MRIA 3VTNA 2NVYI 2QRCB 1Q7Y2 3CCL1 3G4S1 4MH4A 2V8KA 2YADA 1S72Z 1QF8A 1KQSY 1KQSZ 2NVQI 4RVDA 3GTLI 2NVTI 1VQNZ 1ZH1A 2E9HA 1Q812 3CCR1 2QRDB 3CME1 4E32A 1VLAA 3GTMI 4A3EI 3CCMZ 4DQYB 4MD8A 3VMHA 3HOZI 2QLVB 3GTOI 3MZKB 2R93I 1VQLZ 1YHQZ 4EWCA 3CCJ1 3IFUA 1TWGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 2;  3CXC Z;  1Q86 2;  3CCQ Z;  3CCE 1;  1W2B Y;  3CCM 1;  1K8A 2;  3CPW Z;  1VQ4 Z;  1S72 1;  3I56 1;  2QA4 1;  3CC2 1;  1VQP 1;  1M1K 1;  1JJ2 Z;  3G6E Z;  1VQ7 1;  1M90 1;  3CCV Z;  1YJ9 Z;  3CCU 1;  1QVF Y;  1QVG Z;  3OW2 Y;  1QVG Y;  1YI2 1;  1VQ6 1;  1NJI 2;  3CCL Z;  3G71 1;  1VQO Z;  3CCQ 1;  1M90 2;  1QVF Z;  3CC2 Z;  3I55 Z;  1Q82 1;  3CC4 Z;  1YJN 1;  3CMA 1;  1VQM Z;  1JJ2 Y;  3G4S Z;  1YI2 Z;  3CMA Z;  3CC4 1;  1VQ6 Z;  3CPW Y;  1N8R 1;  1Q86 1;  1W2B Z;  1K8A 1;  1K73 2;  3CD6 Z;  3CCU Z;  1YHQ 1;  3CXC Y;  1VQL 1;  1KD1 1;  2OTL Z;  3G71 Z;  1K9M 1;  3CCV 1;  1YJ9 1;  2OTL 1;  1K73 1;  1YIJ Z;  3CD6 1;  1N8R 2;  3CCE Z;  3OW2 Z;  3CCR Z;  3I55 1;  1NJI 1;  1VQK 1;  1VQ9 Z;  1Q7Y 2;  1VQO 1;  3G6E 1;  3CCL 1;  3G4S 1;  1Q81 1;  2QEX Z;  3CCS Z;  1VQ8 1;  1VQK Z;  1YJN Z;  3CC7 Z;  1S72 Z;  1VQ4 1;  2OTJ 1;  3CCJ Z;  3CCS 1;  2QEX 1;  1YIT Z;  1KQS Y;  1YIJ 1;  1KQS Z;  1M1K 2;  1VQ7 Z;  1VQN Z;  1Q81 2;  3CCR 1;  1VQP Z;  1YIT 1;  3CME 1;  1VQ5 1;  1YJW 1;  1VQ5 Z;  3I56 Z;  3CC7 1;  1Q7Y 1;  3CCM Z;  1KD1 2;  1YJW Z;  1VQ9 1;  2OTJ Z;  1VQN 1;  2QA4 Z;  1K9M 2;  1VQ8 Z;  1VQL Z;  1YHQ Z;  1KC8 2;  3CCJ 1;  1VQM 1;  3CME Z;  1KC8 1; 
#chains in the Genus database with same CATH topology
 4DK1 A;  2Y0S A;  3NFZ A;  3P5J B;  2K3R A;  3CXC Z;  3CQZ I;  1Q86 2;  3H3V J;  1RO4 A;  1RO0 A;  1K8A 2;  2Q51 A;  3EER A;  3FKI I;  1M1K 1;  3RZD I;  1VQ7 1;  1YJ9 Z;  3U50 C;  3J7A 4;  4A3C I;  4RV9 A;  1I50 I;  4E33 A;  4A3M I;  2KPI A;  1QVG Z;  1ML8 A;  3OW2 Y;  3IR7 A;  3G71 1;  2M48 A;  1VQO Z;  3CCQ 1;  3S1R I;  2P28 A;  1JJ2 Y;  2BJO A;  3TDH B;  3G4S Z;  4A3I I;  4HGY A;  1YI2 Z;  4MXU A;  1YUK A;  2RBL A;  1N8R 1;  2R92 I;  5D1O A;  3CCU Z;  4A3D I;  4NBH A;  2R6M A;  2JS4 A;  2IZ3 A;  1K9M 1;  1YJ9 1;  3J80 f;  1SFO I;  2RIQ A;  3GTJ I;  3FQQ A;  1VQO 1;  3G6E 1;  4A3L I;  5A2Q f;  3VMI A;  1YIT Z;  5C4X I;  1YIJ 1;  1M1K 2;  3PO2 I;  1ZB9 A;  2K5R A;  1NP6 A;  2V8I A;  3GTQ I;  4RVF A;  1RQF A;  3K7A I;  2GTI A;  2HU9 A;  5FLX b;  3CC7 1;  1Q7Y 1;  1FDI A;  1KD1 2;  3NDJ A;  3RZO I;  3HOV I;  4MON A;  1K9M 2;  3GTK I;  3GTM S;  1VQ8 Z;  2P3Y A;  1S7M A;  5D1O B;  1P9N A;  3CME Z;  1KC8 1;  3CCQ Z;  2VUG A;  3HOU I;  3J80 b;  4XX2 A;  3CCM 1;  2AKL A;  3NH4 A;  1S72 1;  2ZAE B;  3MON A;  4NBE A;  3I56 1;  1TWF I;  2VPX A;  1PFT A;  2RPR A;  3I4N I;  2LFU A;  2AYD A;  1M90 1;  1TFI A;  3CCU 1;  1QVF Y;  3D6W A;  3I07 A;  4S1T A;  2V8J A;  1SIW A;  2JA8 I;  3KIH A;  5C3E I;  1VQ6 1;  1L1O C;  2O4H A;  4NBB A;  2E2H I;  2JUB A;  2QRE B;  3CC2 Z;  2O53 A;  3S1M I;  3CMA 1;  4QTT A;  3S14 I;  1R9T I;  4E31 A;  3Q87 A;  3CMA Z;  2EGT A;  2VUM I;  2QKD A;  2JIO A;  3IF8 A;  4CL1 A;  3LUS A;  1Q86 1;  1Y1W I;  1K8A 1;  1K73 2;  3CD6 Z;  1QXF A;  1YHQ 1;  4Y7N I;  4NFR A;  5IP7 I;  4QTU A;  1TWH I;  1K73 1;  1N8R 2;  1NUI A;  3M4O I;  2F4O A;  2PM9 A;  3OW2 Z;  1NJI 1;  1VQK 1;  4NOZ A;  5CM2 M;  1Q81 1;  4MD7 A;  2QEX Z;  3CCS Z;  5D1P A;  1RO2 A;  3GTP I;  1VQ8 1;  1KRL A;  4A3J I;  2HF1 A;  5C4J I;  2E2I I;  3S1N I;  1Y1V I;  3HKZ A;  2QR1 B;  2VPZ A;  2QEX 1;  3CCJ Z;  3CCS 1;  2OTJ 1;  3F3F C;  3QWU A;  4HH4 A;  3M3Y I;  1YIT 1;  5T67 A;  1VQ5 1;  1YJW 1;  3I56 Z;  2JA7 I;  3PO3 S;  3NDI A;  1VQ9 1;  3BG0 B;  2OZK A;  1VQN 1;  4HGZ A;  1Y8C A;  2QA4 Z;  2W03 A;  1WZN A;  2WB1 A;  2H85 A;  1LQL A;  1KC8 2;  4NH1 C;  1VQM 1;  1Z02 A;  2RT9 A;  3S2D I;  4NBG A;  3FQM A;  3MZL B;  2VPW A;  3J81 b;  1W2B Y;  3HOY I;  1WCM I;  3TE5 B;  1N2F A;  5C44 I;  3CPW Z;  3GTG I;  4AYB A;  3CC2 1;  5T6B A;  4E2Z A;  4BY7 I;  3H0G I;  3HOW I;  3G6E Z;  5IT9 f;  1WW9 A;  1ZB8 A;  1X3Z A;  3CCV Z;  2PK7 A;  1WII A;  1TWC I;  3KIF A;  5AN9 F;  2DE5 A;  4BXX I;  2KI7 B;  4E2X A;  1RNI A;  1NJI 2;  3CCL Z;  4NBF A;  1DL6 A;  2JIR A;  1QVF Z;  4E2W A;  2DE6 A;  2GTH A;  2M6N A;  3J81 f;  2E2J I;  1YJN 1;  1VQM Z;  4TNU A;  2JNY A;  1VQ6 Z;  1RLY A;  5T64 A;  4NB9 A;  5LL6 f;  5A2Q b;  2JA6 I;  5FLM I;  3VMG A;  5IT9 b;  1VQL 1;  1KD1 1;  1YUA A;  2OTL Z;  2V45 A;  4BBS I;  3F3P C;  2LIY A;  3G71 Z;  3CCV 1;  4E30 A;  1WJ2 A;  2IV2 X;  2GU2 A;  1X0T A;  1FDO A;  2F4M A;  1JWH C;  2DE7 A;  3CCE Z;  3JAM f;  3CCR Z;  3I55 1;  1USP B;  3S17 I;  4BY1 I;  3S1Q I;  1VQ9 Z;  1VQK Z;  1YJN Z;  3CC7 Z;  1VQ4 1;  2W04 A;  2JIM A;  2J6A A;  3BG1 B;  2VPY A;  4NBA A;  2I3C A;  3EED A;  1VQ7 Z;  1USP A;  1X3W A;  1VQP Z;  3VB9 A;  1Y1V S;  4Y52 I;  1VQ5 Z;  2RHB A;  4MD9 A;  1YJW Z;  4A3G I;  2OTJ Z;  2JR6 A;  3T4N B;  4RVG A;  3GCF A;  4NB8 A;  1Q82 2;  3CCE 1;  4NBD A;  2B63 I;  4RVH A;  1VQ4 Z;  2QA4 1;  2OOY B;  4DGL A;  1VQP 1;  3I4M I;  2Q4Z A;  1JJ2 Z;  3D2L A;  3D9X A;  3NH5 A;  4X6A I;  4BBR I;  1QYP A;  1Z03 A;  1I3Q I;  4A93 I;  5IP9 I;  1QVG Y;  1YI2 1;  2IZ4 A;  2JIQ A;  5FLX f;  4E2Y A;  3HOX I;  1M90 2;  1Z01 A;  2JMO A;  2PMZ A;  2E7Z A;  3I55 Z;  1Q82 1;  2G2K A;  4RS4 A;  3CC4 Z;  4A3F I;  2YU9 I;  1I6H I;  1TWA I;  1K83 I;  3JAM b;  3CC4 1;  3S16 I;  2VF1 A;  3CPW Y;  3NH8 A;  1W2B Z;  3IX0 A;  4A3B I;  3GKQ A;  3CXC Y;  2NVX I;  3ESW A;  2NAP A;  4A3K I;  2JA5 I;  3PO3 I;  2OTL 1;  2OOX B;  1YIJ Z;  4NBC A;  3CD6 1;  2R7Z I;  3S2H I;  3S15 I;  2WAQ A;  4MRI A;  3VTN A;  2NVY I;  1AA6 A;  2QRC B;  1Q7Y 2;  3CCL 1;  3G4S 1;  4MH4 A;  2V8K A;  2JIP A;  2YAD A;  1S72 Z;  1QF8 A;  1KQS Y;  1KQS Z;  2NVQ I;  4RVD A;  3GTL I;  2NVT I;  2V3V A;  1VQN Z;  1ZH1 A;  2E9H A;  1Q81 2;  3CCR 1;  2QRD B;  3CME 1;  4E32 A;  1Q16 A;  1VLA A;  3GTM I;  2LEX A;  4A3E I;  3CCM Z;  4DQY B;  4MD8 A;  3VMH A;  3HOZ I;  2QLV B;  3GTO I;  3MZK B;  2R93 I;  1VQL Z;  1YHQ Z;  4EWC A;  3CCJ 1;  3IFU A;  1TWG I; 
#chains in the Genus database with same CATH homology
 4DK1 A;  2Y0S A;  3NFZ A;  3P5J B;  2K3R A;  3CXC Z;  3CQZ I;  1Q86 2;  3H3V J;  1RO4 A;  1RO0 A;  1K8A 2;  2Q51 A;  3EER A;  3FKI I;  1M1K 1;  3RZD I;  1VQ7 1;  1YJ9 Z;  3U50 C;  3J7A 4;  4A3C I;  4RV9 A;  1I50 I;  4E33 A;  4A3M I;  2KPI A;  1QVG Z;  1ML8 A;  3OW2 Y;  3G71 1;  2M48 A;  1VQO Z;  3CCQ 1;  3S1R I;  2P28 A;  1JJ2 Y;  2BJO A;  3TDH B;  3G4S Z;  4A3I I;  4HGY A;  1YI2 Z;  4MXU A;  1YUK A;  2RBL A;  1N8R 1;  2R92 I;  5D1O A;  3CCU Z;  4A3D I;  4NBH A;  2R6M A;  2JS4 A;  2IZ3 A;  1K9M 1;  1YJ9 1;  3J80 f;  1SFO I;  2RIQ A;  3GTJ I;  3FQQ A;  1VQO 1;  3G6E 1;  4A3L I;  5A2Q f;  3VMI A;  1YIT Z;  5C4X I;  1YIJ 1;  1M1K 2;  3PO2 I;  1ZB9 A;  2K5R A;  1NP6 A;  2V8I A;  3GTQ I;  4RVF A;  1RQF A;  3K7A I;  2GTI A;  2HU9 A;  5FLX b;  3CC7 1;  1Q7Y 1;  1KD1 2;  3NDJ A;  3RZO I;  3HOV I;  4MON A;  1K9M 2;  3GTK I;  3GTM S;  1VQ8 Z;  2P3Y A;  1S7M A;  5D1O B;  1P9N A;  3CME Z;  1KC8 1;  3CCQ Z;  2VUG A;  3HOU I;  3J80 b;  4XX2 A;  3CCM 1;  2AKL A;  3NH4 A;  1S72 1;  2ZAE B;  3MON A;  4NBE A;  3I56 1;  1TWF I;  1PFT A;  2RPR A;  3I4N I;  2LFU A;  1M90 1;  1TFI A;  3CCU 1;  1QVF Y;  3D6W A;  3I07 A;  4S1T A;  2V8J A;  2JA8 I;  3KIH A;  5C3E I;  1VQ6 1;  1L1O C;  2O4H A;  4NBB A;  2E2H I;  2JUB A;  2QRE B;  3CC2 Z;  2O53 A;  3S1M I;  3CMA 1;  4QTT A;  3S14 I;  1R9T I;  4E31 A;  3Q87 A;  3CMA Z;  2EGT A;  2VUM I;  2QKD A;  3IF8 A;  4CL1 A;  3LUS A;  1Q86 1;  1Y1W I;  1K8A 1;  1K73 2;  3CD6 Z;  1YHQ 1;  4Y7N I;  4NFR A;  5IP7 I;  4QTU A;  1TWH I;  1K73 1;  1N8R 2;  1NUI A;  3M4O I;  2F4O A;  2PM9 A;  3OW2 Z;  1NJI 1;  1VQK 1;  4NOZ A;  5CM2 M;  1Q81 1;  4MD7 A;  2QEX Z;  3CCS Z;  5D1P A;  1RO2 A;  3GTP I;  1VQ8 1;  1KRL A;  4A3J I;  2HF1 A;  5C4J I;  2E2I I;  3S1N I;  1Y1V I;  3HKZ A;  2QR1 B;  2QEX 1;  3CCJ Z;  3CCS 1;  2OTJ 1;  3F3F C;  3QWU A;  4HH4 A;  3M3Y I;  1YIT 1;  5T67 A;  1VQ5 1;  1YJW 1;  3I56 Z;  2JA7 I;  3PO3 S;  3NDI A;  1VQ9 1;  3BG0 B;  2OZK A;  1VQN 1;  4HGZ A;  2QA4 Z;  2W03 A;  2WB1 A;  2H85 A;  1LQL A;  1KC8 2;  4NH1 C;  1VQM 1;  1Z02 A;  2RT9 A;  3S2D I;  4NBG A;  3FQM A;  3MZL B;  3J81 b;  1W2B Y;  3HOY I;  1WCM I;  3TE5 B;  1N2F A;  5C44 I;  3CPW Z;  3GTG I;  4AYB A;  3CC2 1;  5T6B A;  4E2Z A;  4BY7 I;  3H0G I;  3HOW I;  3G6E Z;  5IT9 f;  1WW9 A;  1ZB8 A;  1X3Z A;  3CCV Z;  2PK7 A;  1WII A;  1TWC I;  3KIF A;  5AN9 F;  2DE5 A;  4BXX I;  2KI7 B;  4E2X A;  1RNI A;  1NJI 2;  3CCL Z;  4NBF A;  1DL6 A;  1QVF Z;  4E2W A;  2DE6 A;  2GTH A;  2M6N A;  3J81 f;  2E2J I;  1YJN 1;  1VQM Z;  4TNU A;  2JNY A;  1VQ6 Z;  1RLY A;  5T64 A;  4NB9 A;  5LL6 f;  5A2Q b;  2JA6 I;  5FLM I;  3VMG A;  5IT9 b;  1VQL 1;  1KD1 1;  1YUA A;  2OTL Z;  4BBS I;  3F3P C;  2LIY A;  3G71 Z;  3CCV 1;  4E30 A;  2GU2 A;  1X0T A;  2F4M A;  1JWH C;  2DE7 A;  3CCE Z;  3JAM f;  3CCR Z;  3I55 1;  1USP B;  3S17 I;  4BY1 I;  3S1Q I;  1VQ9 Z;  1VQK Z;  1YJN Z;  3CC7 Z;  1VQ4 1;  2W04 A;  2J6A A;  3BG1 B;  4NBA A;  2I3C A;  3EED A;  1VQ7 Z;  1USP A;  1X3W A;  1VQP Z;  3VB9 A;  1Y1V S;  4Y52 I;  1VQ5 Z;  2RHB A;  4MD9 A;  1YJW Z;  4A3G I;  2OTJ Z;  2JR6 A;  3T4N B;  4RVG A;  3GCF A;  4NB8 A;  1Q82 2;  3CCE 1;  4NBD A;  2B63 I;  4RVH A;  1VQ4 Z;  2QA4 1;  2OOY B;  4DGL A;  1VQP 1;  3I4M I;  2Q4Z A;  1JJ2 Z;  3D9X A;  3NH5 A;  4X6A I;  4BBR I;  1QYP A;  1Z03 A;  1I3Q I;  4A93 I;  5IP9 I;  1QVG Y;  1YI2 1;  2IZ4 A;  4E2Y A;  5FLX f;  3HOX I;  1M90 2;  1Z01 A;  2JMO A;  2PMZ A;  3I55 Z;  1Q82 1;  2G2K A;  4RS4 A;  3CC4 Z;  4A3F I;  2YU9 I;  1I6H I;  1TWA I;  1K83 I;  3JAM b;  3CC4 1;  3S16 I;  2VF1 A;  3CPW Y;  3NH8 A;  1W2B Z;  3IX0 A;  4A3B I;  3GKQ A;  3CXC Y;  2NVX I;  3ESW A;  4A3K I;  2JA5 I;  3PO3 I;  2OTL 1;  2OOX B;  1YIJ Z;  4NBC A;  3CD6 1;  2R7Z I;  3S2H I;  3S15 I;  2WAQ A;  4MRI A;  3VTN A;  2NVY I;  2QRC B;  1Q7Y 2;  3CCL 1;  3G4S 1;  4MH4 A;  2V8K A;  2YAD A;  1S72 Z;  1QF8 A;  1KQS Y;  1KQS Z;  2NVQ I;  4RVD A;  3GTL I;  2NVT I;  1VQN Z;  1ZH1 A;  2E9H A;  1Q81 2;  3CCR 1;  2QRD B;  3CME 1;  4E32 A;  1VLA A;  3GTM I;  4A3E I;  3CCM Z;  4DQY B;  4MD8 A;  3VMH A;  3HOZ I;  2QLV B;  3GTO I;  3MZK B;  2R93 I;  1VQL Z;  1YHQ Z;  4EWC A;  3CCJ 1;  3IFU A;  1TWG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...