3CCMZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccmZ00
3CXCY 3I551 3CPWY 3CCS1 3CME1 1VQ51 1Q7Y2 1K8A1 3CMA1 1VQ6Z 3CXCZ 1Q862 3CCUZ 3CCVZ 2QA41 1N8R1 3CD61 1VQ81 3CMEZ 3G6E1 1VQ5Z 3CMAZ 3CCR1 1YJW1 2QA4Z 3G6EZ 1VQM1 3CCRZ 2OTLZ 1YJWZ 1VQMZ 1Q821 1QVFZ 3CCQ1 3CC4Z 3G71Z 2OTJZ 1Q822 1M1K1 1QVGY 1KQSY 1JJ2Z 3CCLZ 1VQO1 1S721 3CPWZ 1M1K2 3I55Z 1KD11 3CCSZ 2QEX1 1S72Z 1K8A2 1W2BY 3CD6Z 1VQ8Z 1K9M1 1N8R2 1YIJ1 1KD12 1M901 3CC21 3CC71 1KC81 1VQ71 1YIJZ 1Q811 1K9M2 1M902 3CC2Z 3CC7Z 1VQ7Z 1YHQ1 3CCQZ 1Q812 1YHQZ 1QVGZ 1KQSZ 1K731 1YJ91 1YJN1 1YI21 1VQOZ 1YIT1 1K732 1W2BZ 2QEXZ 3CCE1 1YITZ 1VQL1 1Q7Y1 1VQP1 3G4S1 3CCEZ 1VQLZ 1VQ61 1VQK1 3CCU1 3CCV1 1VQPZ 3G4SZ 1KC82 1VQKZ 3CCM1 1VQ91 2OTL1 3CCMZ 1VQ9Z 3OW2Y 1NJI1 1VQN1 3CCJ1 1YJ9Z 3I561 1QVFY 3CC41 3OW2Z 1VQ41 3G711 1YJNZ 2OTJ1 1YI2Z 1VQNZ 3CCJZ 3I56Z 1NJI2 1VQ4Z 1JJ2Y 3CCL1 1Q861
chains in the Genus database with same CATH superfamily
4XX2A 4A3KI 2E2II 3CXCY 3CME1 1Q7Y2 1K8A1 1VQ6Z 3CXCZ 3U50C 3CCVZ 2QA41 4A3JI 1QF8A 2JIQA 4QTUA 3HOZI 3S1NI 3K7AI 1KRLA 3G6EZ 2P28A 3CCRZ 2JIRA 3S17I 1VQMZ 1Y1VI 2GU2A 1WZNA 3PO3S 1YUKA 3NH8A 3TDHB 4A3LI 4E32A 1KQSY 1JJ2Z 2DE6A 2DE5A 2AKLA 1S721 3GTMI 2RIQA 3CPWZ 1Y1VS 1KD11 3NFZA 1RO4A 2QEX1 1K8A2 1L1OC 1W2BY 2HF1A 2OOXB 1K9M1 1YIJ1 1M901 4DQYB 4HGZA 4MONA 3CC71 1DL6A 1VQ7Z 1NP6A 2QLVB 2RHBA 5C4JI 3GTJI 1NUIA 1YJ91 3S14I 2QKDA 3IF8A 2IZ3A 1YI21 2VPXA 1YIT1 3NDIA 2QEXZ 3CCE1 2V45A 1P9NA 4E2ZA 3S2DI 4BXXI 4NBGA 4MRIA 2JIMA 3IFUA 3TE5B 1Y1WI 1VQPZ 3G4SZ 3S2HI 1RLYA 4NB8A 4NBHA 3J81f 1Z02A 1VQKZ 2IZ4A 4MXUA 1Y8CA 5T6BA 4A3BI 4EWCA 4BY1I 1VQ9Z 3FQQA 5FLXb 3JAMf 1VQN1 1YJ9Z 3CC41 1VQ41 2OTJ1 4A3II 1YI2Z 3CCJZ 2R93I 1ZB8A 2O53A 4RVDA 5FLXf 2NVYI 2JUBA 3T4NB 2DE7A 2BJOA 2I3CA 5CM2M 2QREB 1Q862 1N8R1 2VPYA 3G6E1 1VQ5Z 3CCR1 2NVQI 1VQM1 3CQZI 4RV9A 1YJWZ 1Z01A 2JNYA 1QVFZ 2E7ZA 3CCQ1 3CC4Z 2OTJZ 2JS4A 2Q51A 3F3FC 1QXFA 1QVGY 1Z03A 4Y7NI 2LEXA 3MZKB 4A3FI 3PO3I 4MD8A 5FLMI 1ZH1A 1TWCI 3EERA 1N8R2 2VPZA 1TWHI 1VQ71 3MZLB 4BY7I 2V8KA 3EEDA 3CC2Z 2JIOA 3HKZA 3CCQZ 2M6NA 1YHQZ 2KPIA 1KQSZ 3NH5A 2E2HI 5C4XI 5IP7I 1YJN1 1K732 4RVFA 2NAPA 3RZOI 4A3GI 3D2LA 1W2BZ 1RO0A 5A2Qb 4RVHA 4NFRA 4DGLA 1VQP1 3I4NI 3G4S1 1VQLZ 1TWAI 1VQK1 2PM9A 4NH1C 3PO2I 1X3WA 2F4MA 3GTGI 3HOXI 1VQ91 4CL1A 2Q4ZA 3CCMZ 1ZB9A 4A3EI 2OOYB 3OW2Y 5D1PA 5C44I 3VB9A 4NBCA 3CCJ1 3OW2Z 5IT9b 3G711 1YJNZ 3BG0B 1NJI2 3S16I 4RS4A 1SFOI 4NB9A 4BBRI 3CCL1 4NBFA 2O4HA 5IT9f 1Q861 2NVXI 3VMHA 3D6WA 3I551 2E9HA 1VQ51 3F3PC 1X3ZA 2H85A 3BG1B 3CMAZ 1SIWA 1YJW1 1LQLA 2JA7I 1WW9A 1R9TI 2Y0SA 2OZKA 3G71Z 1N2FA 4E2XA 1ML8A 1Q822 2VUGA 1I6HI 3S1QI 5C3EI 3CCLZ 2GTIA 1VQO1 1M1K2 3I55Z 1RNIA 3HOYI 2PK7A 3GCFA 2WB1A 1WIIA 1FDIA 3FQMA 4S1TA 4A3MI 3CC21 1KC81 2K5RA 2QR1B 2K3RA 2HU9A 1YHQ1 3H3VJ 4A3CI 2W04A 5LL6f 1Q812 1QVGZ 2R7ZI 1K731 2NVTI 3S1MI 1JWHC 4AYBA 2RT9A 1VQOZ 1Q16A 4NBAA 3S1RI 2LFUA 4HH4A 4E2WA 1VQL1 4Y52I 4MD9A 4E2YA 2JA8I 4BBSI 2J6AA 3CCU1 3KIHA 1KC82 3VTNA 5IP9I 3CCM1 3I4MI 3GTKI 3IX0A 5D1OB 2OTL1 3VMGA 2G2KA 3GTPI 2V3VA 4DK1A 1NJI1 1USPA 2ZAEB 1K83I 1TWFI 3I56Z 2B63I 1FDOA 3M3YI 1JJ2Y 2KI7B 4MD7A 2E2JI 5A2Qf 3CPWY 3CCS1 3HOUI 3CMA1 4QTTA 4A3DI 3CCUZ 3CD61 4RVGA 1VQ81 2JA5I 3CMEZ 1I3QI 2QA4Z 3D9XA 3MONA 2OTLZ 3FKII 1Q821 2M48A 4E30A 3GTMS 2IV2X 2EGTA 3J80b 3NH4A 4E31A 1M1K1 1RQFA 1TFIA 2JMOA 3GTLI 1TWGI 4X6AI 3J80f 4TNUA 2VPWA 4E33A 1YUAA 3CCSZ 3Q87A 1WJ2A 1S72Z 2QRCB 3CD6Z 2R92I 1VQ8Z 1KD12 4NBEA 2VF1A 3LUSA 3I07A 3ESWA 4HGYA 2PMZA 3GTOI 3J81b 3KIFA 1YIJZ 1Q811 1K9M2 4MH4A 3J7A4 1M902 3CC7Z 5D1OA 5T64A 4NBBA 3M4OI 1USPB 3JAMb 2LIYA 5T67A 3H0GI 1X0TA 1S7MA 3HOWI 2R6MA 3HOVI 3GTQI 2RPRA 2V8IA 2AYDA 3P5JB 1QYPA 1YITZ 2WAQA 2VUMI 1WCMI 1Q7Y1 2P3YA 4NOZA 3CCEZ 2GTHA 1VQ61 3S15I 2F4OA 1I50I 3QWUA 3CCV1 4A93I 3IR7A 3NDJA 2QRDB 2RBLA 2V8JA 5AN9F 3RZDI 2JR6A 3I561 1QVFY 1VLAA 2W03A 2JIPA 2JA6I 3VMIA 1AA6A 1VQNZ 2YADA 1RO2A 1VQ4Z 3GKQA 2YU9I 1PFTA 4NBDA
chains in the Genus database with same CATH topology
4XX2A 4A3KI 2E2II 3CXCY 3CME1 1Q7Y2 1K8A1 1VQ6Z 3CXCZ 3U50C 3CCVZ 2QA41 4A3JI 1QF8A 4QTUA 3HOZI 3S1NI 3K7AI 1KRLA 3G6EZ 2P28A 3CCRZ 3S17I 1VQMZ 1Y1VI 2GU2A 3PO3S 1YUKA 3NH8A 3TDHB 4A3LI 4E32A 1KQSY 1JJ2Z 2DE6A 2DE5A 2AKLA 1S721 3GTMI 2RIQA 3CPWZ 1Y1VS 1KD11 3NFZA 1RO4A 2QEX1 1K8A2 1L1OC 1W2BY 2HF1A 2OOXB 1K9M1 1YIJ1 1M901 4DQYB 4HGZA 4MONA 3CC71 1DL6A 1VQ7Z 1NP6A 2QLVB 2RHBA 5C4JI 3GTJI 1NUIA 1YJ91 3S14I 2QKDA 3IF8A 2IZ3A 1YI21 1YIT1 3NDIA 2QEXZ 3CCE1 1P9NA 4E2ZA 3S2DI 4BXXI 4NBGA 4MRIA 3IFUA 3TE5B 1Y1WI 1VQPZ 3G4SZ 3S2HI 1RLYA 4NB8A 4NBHA 3J81f 1Z02A 1VQKZ 2IZ4A 4MXUA 5T6BA 4A3BI 4EWCA 4BY1I 1VQ9Z 3FQQA 5FLXb 3JAMf 1VQN1 1YJ9Z 3CC41 1VQ41 2OTJ1 4A3II 1YI2Z 3CCJZ 2R93I 1ZB8A 2O53A 4RVDA 5FLXf 2NVYI 2JUBA 3T4NB 2DE7A 2BJOA 2I3CA 5CM2M 2QREB 1Q862 1N8R1 3G6E1 1VQ5Z 3CCR1 2NVQI 1VQM1 3CQZI 4RV9A 1YJWZ 1Z01A 2JNYA 1QVFZ 3CCQ1 3CC4Z 2OTJZ 2JS4A 2Q51A 3F3FC 1QVGY 1Z03A 4Y7NI 3MZKB 4A3FI 3PO3I 4MD8A 5FLMI 1ZH1A 1TWCI 3EERA 1N8R2 1TWHI 1VQ71 3MZLB 4BY7I 2V8KA 3EEDA 3CC2Z 3HKZA 3CCQZ 2M6NA 1YHQZ 2KPIA 1KQSZ 3NH5A 2E2HI 5C4XI 5IP7I 1YJN1 1K732 4RVFA 3RZOI 4A3GI 1W2BZ 1RO0A 5A2Qb 4RVHA 4NFRA 4DGLA 1VQP1 3I4NI 3G4S1 1VQLZ 1TWAI 1VQK1 2PM9A 4NH1C 3PO2I 1X3WA 2F4MA 3GTGI 3HOXI 1VQ91 4CL1A 2Q4ZA 3CCMZ 4A3EI 1ZB9A 2OOYB 3OW2Y 5D1PA 5C44I 3VB9A 4NBCA 3CCJ1 3OW2Z 5IT9b 3G711 1YJNZ 3BG0B 1NJI2 3S16I 4RS4A 1SFOI 4NB9A 4BBRI 3CCL1 4NBFA 2O4HA 5IT9f 1Q861 2NVXI 3VMHA 3D6WA 3I551 2E9HA 1VQ51 3F3PC 1X3ZA 2H85A 3BG1B 3CMAZ 1YJW1 1LQLA 2JA7I 1WW9A 1R9TI 2Y0SA 2OZKA 3G71Z 1N2FA 4E2XA 1ML8A 1Q822 2VUGA 1I6HI 3S1QI 5C3EI 3CCLZ 2GTIA 1VQO1 1M1K2 3I55Z 1RNIA 3HOYI 2PK7A 3GCFA 2WB1A 1WIIA 3FQMA 4S1TA 4A3MI 3CC21 1KC81 2K5RA 2QR1B 2K3RA 2HU9A 1YHQ1 3H3VJ 4A3CI 2W04A 5LL6f 1Q812 1QVGZ 2R7ZI 1K731 2NVTI 3S1MI 1JWHC 4AYBA 2RT9A 1VQOZ 4NBAA 3S1RI 2LFUA 4HH4A 4E2WA 1VQL1 4Y52I 4MD9A 4E2YA 2JA8I 4BBSI 2J6AA 3CCU1 3KIHA 1KC82 3VTNA 5IP9I 3CCM1 3I4MI 3GTKI 3IX0A 5D1OB 2OTL1 3VMGA 2G2KA 3GTPI 4DK1A 1NJI1 1USPA 2ZAEB 1K83I 1TWFI 3I56Z 2B63I 3M3YI 1JJ2Y 2KI7B 4MD7A 2E2JI 5A2Qf 3CPWY 3CCS1 3HOUI 3CMA1 4QTTA 4A3DI 3CCUZ 3CD61 4RVGA 1VQ81 2JA5I 3CMEZ 1I3QI 2QA4Z 3D9XA 3MONA 2OTLZ 3FKII 1Q821 2M48A 4E30A 3GTMS 2EGTA 3J80b 3NH4A 4E31A 1M1K1 1RQFA 1TFIA 2JMOA 3GTLI 1TWGI 4X6AI 3J80f 4TNUA 4E33A 1YUAA 3CCSZ 3Q87A 1S72Z 2QRCB 3CD6Z 2R92I 1VQ8Z 1KD12 4NBEA 2VF1A 3LUSA 3I07A 3ESWA 4HGYA 2PMZA 3GTOI 3J81b 3KIFA 1YIJZ 1Q811 1K9M2 4MH4A 3J7A4 1M902 3CC7Z 5D1OA 5T64A 4NBBA 3M4OI 1USPB 3JAMb 2LIYA 5T67A 3H0GI 1X0TA 1S7MA 3HOWI 2R6MA 3HOVI 3GTQI 2RPRA 2V8IA 3P5JB 1QYPA 1YITZ 2WAQA 2VUMI 1WCMI 1Q7Y1 2P3YA 4NOZA 3CCEZ 2GTHA 1VQ61 3S15I 2F4OA 1I50I 3QWUA 3CCV1 4A93I 3NDJA 2QRDB 2RBLA 2V8JA 5AN9F 3RZDI 2JR6A 3I561 1QVFY 1VLAA 2W03A 2JA6I 3VMIA 1VQNZ 2YADA 1RO2A 1VQ4Z 3GKQA 2YU9I 1PFTA 4NBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC Y;  3I55 1;  3CPW Y;  3CCS 1;  3CME 1;  1VQ5 1;  1Q7Y 2;  1K8A 1;  3CMA 1;  1VQ6 Z;  3CXC Z;  1Q86 2;  3CCU Z;  3CCV Z;  2QA4 1;  1N8R 1;  3CD6 1;  1VQ8 1;  3CME Z;  3G6E 1;  1VQ5 Z;  3CMA Z;  3CCR 1;  1YJW 1;  2QA4 Z;  3G6E Z;  1VQM 1;  3CCR Z;  2OTL Z;  1YJW Z;  1VQM Z;  1Q82 1;  1QVF Z;  3CCQ 1;  3CC4 Z;  3G71 Z;  2OTJ Z;  1Q82 2;  1M1K 1;  1QVG Y;  1KQS Y;  1JJ2 Z;  3CCL Z;  1VQO 1;  1S72 1;  3CPW Z;  1M1K 2;  3I55 Z;  1KD1 1;  3CCS Z;  2QEX 1;  1S72 Z;  1K8A 2;  1W2B Y;  3CD6 Z;  1VQ8 Z;  1K9M 1;  1N8R 2;  1YIJ 1;  1KD1 2;  1M90 1;  3CC2 1;  3CC7 1;  1KC8 1;  1VQ7 1;  1YIJ Z;  1Q81 1;  1K9M 2;  1M90 2;  3CC2 Z;  3CC7 Z;  1VQ7 Z;  1YHQ 1;  3CCQ Z;  1Q81 2;  1YHQ Z;  1QVG Z;  1KQS Z;  1K73 1;  1YJ9 1;  1YJN 1;  1YI2 1;  1VQO Z;  1YIT 1;  1K73 2;  1W2B Z;  2QEX Z;  3CCE 1;  1YIT Z;  1VQL 1;  1Q7Y 1;  1VQP 1;  3G4S 1;  3CCE Z;  1VQL Z;  1VQ6 1;  1VQK 1;  3CCU 1;  3CCV 1;  1VQP Z;  3G4S Z;  1KC8 2;  1VQK Z;  3CCM 1;  1VQ9 1;  2OTL 1;  3CCM Z;  1VQ9 Z;  3OW2 Y;  1NJI 1;  1VQN 1;  3CCJ 1;  1YJ9 Z;  3I56 1;  1QVF Y;  3CC4 1;  3OW2 Z;  1VQ4 1;  3G71 1;  1YJN Z;  2OTJ 1;  1YI2 Z;  1VQN Z;  3CCJ Z;  3I56 Z;  1NJI 2;  1VQ4 Z;  1JJ2 Y;  3CCL 1;  1Q86 1; 
#chains in the Genus database with same CATH topology
 4XX2 A;  4A3K I;  2E2I I;  3CXC Y;  3CME 1;  1Q7Y 2;  1K8A 1;  1VQ6 Z;  3CXC Z;  3U50 C;  3CCV Z;  2QA4 1;  4A3J I;  1QF8 A;  2JIQ A;  4QTU A;  3HOZ I;  3S1N I;  3K7A I;  1KRL A;  3G6E Z;  2P28 A;  3CCR Z;  2JIR A;  3S17 I;  1VQM Z;  1Y1V I;  2GU2 A;  1WZN A;  3PO3 S;  1YUK A;  3NH8 A;  3TDH B;  4A3L I;  4E32 A;  1KQS Y;  1JJ2 Z;  2DE6 A;  2DE5 A;  2AKL A;  1S72 1;  3GTM I;  2RIQ A;  3CPW Z;  1Y1V S;  1KD1 1;  3NFZ A;  1RO4 A;  2QEX 1;  1K8A 2;  1L1O C;  1W2B Y;  2HF1 A;  2OOX B;  1K9M 1;  1YIJ 1;  1M90 1;  4DQY B;  4HGZ A;  4MON A;  3CC7 1;  1DL6 A;  1VQ7 Z;  1NP6 A;  2QLV B;  2RHB A;  5C4J I;  3GTJ I;  1NUI A;  1YJ9 1;  3S14 I;  2QKD A;  3IF8 A;  2IZ3 A;  1YI2 1;  2VPX A;  1YIT 1;  3NDI A;  2QEX Z;  3CCE 1;  2V45 A;  1P9N A;  4E2Z A;  3S2D I;  4BXX I;  4NBG A;  4MRI A;  2JIM A;  3IFU A;  3TE5 B;  1Y1W I;  1VQP Z;  3G4S Z;  3S2H I;  1RLY A;  4NB8 A;  4NBH A;  3J81 f;  1Z02 A;  1VQK Z;  2IZ4 A;  4MXU A;  1Y8C A;  5T6B A;  4A3B I;  4EWC A;  4BY1 I;  1VQ9 Z;  3FQQ A;  5FLX b;  3JAM f;  1VQN 1;  1YJ9 Z;  3CC4 1;  1VQ4 1;  2OTJ 1;  4A3I I;  1YI2 Z;  3CCJ Z;  2R93 I;  1ZB8 A;  2O53 A;  4RVD A;  5FLX f;  2NVY I;  2JUB A;  3T4N B;  2DE7 A;  2BJO A;  2I3C A;  5CM2 M;  2QRE B;  1Q86 2;  1N8R 1;  2VPY A;  3G6E 1;  1VQ5 Z;  3CCR 1;  2NVQ I;  1VQM 1;  3CQZ I;  4RV9 A;  1YJW Z;  1Z01 A;  2JNY A;  1QVF Z;  2E7Z A;  3CCQ 1;  3CC4 Z;  2OTJ Z;  2JS4 A;  2Q51 A;  3F3F C;  1QXF A;  1QVG Y;  1Z03 A;  4Y7N I;  2LEX A;  3MZK B;  4A3F I;  3PO3 I;  4MD8 A;  5FLM I;  1ZH1 A;  1TWC I;  3EER A;  1N8R 2;  2VPZ A;  1TWH I;  1VQ7 1;  3MZL B;  4BY7 I;  2V8K A;  3EED A;  3CC2 Z;  2JIO A;  3HKZ A;  3CCQ Z;  2M6N A;  1YHQ Z;  2KPI A;  1KQS Z;  3NH5 A;  2E2H I;  5C4X I;  5IP7 I;  1YJN 1;  1K73 2;  4RVF A;  2NAP A;  3RZO I;  4A3G I;  3D2L A;  1W2B Z;  1RO0 A;  5A2Q b;  4RVH A;  4NFR A;  4DGL A;  1VQP 1;  3I4N I;  3G4S 1;  1VQL Z;  1TWA I;  1VQK 1;  2PM9 A;  4NH1 C;  3PO2 I;  1X3W A;  2F4M A;  3GTG I;  3HOX I;  1VQ9 1;  4CL1 A;  2Q4Z A;  3CCM Z;  1ZB9 A;  4A3E I;  2OOY B;  3OW2 Y;  5D1P A;  5C44 I;  3VB9 A;  4NBC A;  3CCJ 1;  3OW2 Z;  5IT9 b;  3G71 1;  1YJN Z;  3BG0 B;  1NJI 2;  3S16 I;  4RS4 A;  1SFO I;  4NB9 A;  4BBR I;  3CCL 1;  4NBF A;  2O4H A;  5IT9 f;  1Q86 1;  2NVX I;  3VMH A;  3D6W A;  3I55 1;  2E9H A;  1VQ5 1;  3F3P C;  1X3Z A;  2H85 A;  3BG1 B;  3CMA Z;  1SIW A;  1YJW 1;  1LQL A;  2JA7 I;  1WW9 A;  1R9T I;  2Y0S A;  2OZK A;  3G71 Z;  1N2F A;  4E2X A;  1ML8 A;  1Q82 2;  2VUG A;  1I6H I;  3S1Q I;  5C3E I;  3CCL Z;  2GTI A;  1VQO 1;  1M1K 2;  3I55 Z;  1RNI A;  3HOY I;  2PK7 A;  3GCF A;  2WB1 A;  1WII A;  1FDI A;  3FQM A;  4S1T A;  4A3M I;  3CC2 1;  1KC8 1;  2K5R A;  2QR1 B;  2K3R A;  2HU9 A;  1YHQ 1;  3H3V J;  4A3C I;  2W04 A;  5LL6 f;  1Q81 2;  1QVG Z;  2R7Z I;  1K73 1;  2NVT I;  3S1M I;  1JWH C;  4AYB A;  2RT9 A;  1VQO Z;  1Q16 A;  4NBA A;  3S1R I;  2LFU A;  4HH4 A;  4E2W A;  1VQL 1;  4Y52 I;  4MD9 A;  4E2Y A;  2JA8 I;  4BBS I;  2J6A A;  3CCU 1;  3KIH A;  1KC8 2;  3VTN A;  5IP9 I;  3CCM 1;  3I4M I;  3GTK I;  3IX0 A;  5D1O B;  2OTL 1;  3VMG A;  2G2K A;  3GTP I;  2V3V A;  4DK1 A;  1NJI 1;  1USP A;  2ZAE B;  1K83 I;  1TWF I;  3I56 Z;  2B63 I;  1FDO A;  3M3Y I;  1JJ2 Y;  2KI7 B;  4MD7 A;  2E2J I;  5A2Q f;  3CPW Y;  3CCS 1;  3HOU I;  3CMA 1;  4QTT A;  4A3D I;  3CCU Z;  3CD6 1;  4RVG A;  1VQ8 1;  2JA5 I;  3CME Z;  1I3Q I;  2QA4 Z;  3D9X A;  3MON A;  2OTL Z;  3FKI I;  1Q82 1;  2M48 A;  4E30 A;  3GTM S;  2IV2 X;  2EGT A;  3J80 b;  3NH4 A;  4E31 A;  1M1K 1;  1RQF A;  1TFI A;  2JMO A;  3GTL I;  1TWG I;  4X6A I;  3J80 f;  4TNU A;  2VPW A;  4E33 A;  1YUA A;  3CCS Z;  3Q87 A;  1WJ2 A;  1S72 Z;  2QRC B;  3CD6 Z;  2R92 I;  1VQ8 Z;  1KD1 2;  4NBE A;  2VF1 A;  3LUS A;  3I07 A;  3ESW A;  4HGY A;  2PMZ A;  3GTO I;  3J81 b;  3KIF A;  1YIJ Z;  1Q81 1;  1K9M 2;  4MH4 A;  3J7A 4;  1M90 2;  3CC7 Z;  5D1O A;  5T64 A;  4NBB A;  3M4O I;  1USP B;  3JAM b;  2LIY A;  5T67 A;  3H0G I;  1X0T A;  1S7M A;  3HOW I;  2R6M A;  3HOV I;  3GTQ I;  2RPR A;  2V8I A;  2AYD A;  3P5J B;  1QYP A;  1YIT Z;  2WAQ A;  2VUM I;  1WCM I;  1Q7Y 1;  2P3Y A;  4NOZ A;  3CCE Z;  2GTH A;  1VQ6 1;  3S15 I;  2F4O A;  1I50 I;  3QWU A;  3CCV 1;  4A93 I;  3IR7 A;  3NDJ A;  2QRD B;  2RBL A;  2V8J A;  5AN9 F;  3RZD I;  2JR6 A;  3I56 1;  1QVF Y;  1VLA A;  2W03 A;  2JIP A;  2JA6 I;  3VMI A;  1AA6 A;  1VQN Z;  2YAD A;  1RO2 A;  1VQ4 Z;  3GKQ A;  2YU9 I;  1PFT A;  4NBD A; 
#chains in the Genus database with same CATH homology
 4XX2 A;  4A3K I;  2E2I I;  3CXC Y;  3CME 1;  1Q7Y 2;  1K8A 1;  1VQ6 Z;  3CXC Z;  3U50 C;  3CCV Z;  2QA4 1;  4A3J I;  1QF8 A;  4QTU A;  3HOZ I;  3S1N I;  3K7A I;  1KRL A;  3G6E Z;  2P28 A;  3CCR Z;  3S17 I;  1VQM Z;  1Y1V I;  2GU2 A;  3PO3 S;  1YUK A;  3NH8 A;  3TDH B;  4A3L I;  4E32 A;  1KQS Y;  1JJ2 Z;  2DE6 A;  2DE5 A;  2AKL A;  1S72 1;  3GTM I;  2RIQ A;  3CPW Z;  1Y1V S;  1KD1 1;  3NFZ A;  1RO4 A;  2QEX 1;  1K8A 2;  1L1O C;  1W2B Y;  2HF1 A;  2OOX B;  1K9M 1;  1YIJ 1;  1M90 1;  4DQY B;  4HGZ A;  4MON A;  3CC7 1;  1DL6 A;  1VQ7 Z;  1NP6 A;  2QLV B;  2RHB A;  5C4J I;  3GTJ I;  1NUI A;  1YJ9 1;  3S14 I;  2QKD A;  3IF8 A;  2IZ3 A;  1YI2 1;  1YIT 1;  3NDI A;  2QEX Z;  3CCE 1;  1P9N A;  4E2Z A;  3S2D I;  4BXX I;  4NBG A;  4MRI A;  3IFU A;  3TE5 B;  1Y1W I;  1VQP Z;  3G4S Z;  3S2H I;  1RLY A;  4NB8 A;  4NBH A;  3J81 f;  1Z02 A;  1VQK Z;  2IZ4 A;  4MXU A;  5T6B A;  4A3B I;  4EWC A;  4BY1 I;  1VQ9 Z;  3FQQ A;  5FLX b;  3JAM f;  1VQN 1;  1YJ9 Z;  3CC4 1;  1VQ4 1;  2OTJ 1;  4A3I I;  1YI2 Z;  3CCJ Z;  2R93 I;  1ZB8 A;  2O53 A;  4RVD A;  5FLX f;  2NVY I;  2JUB A;  3T4N B;  2DE7 A;  2BJO A;  2I3C A;  5CM2 M;  2QRE B;  1Q86 2;  1N8R 1;  3G6E 1;  1VQ5 Z;  3CCR 1;  2NVQ I;  1VQM 1;  3CQZ I;  4RV9 A;  1YJW Z;  1Z01 A;  2JNY A;  1QVF Z;  3CCQ 1;  3CC4 Z;  2OTJ Z;  2JS4 A;  2Q51 A;  3F3F C;  1QVG Y;  1Z03 A;  4Y7N I;  3MZK B;  4A3F I;  3PO3 I;  4MD8 A;  5FLM I;  1ZH1 A;  1TWC I;  3EER A;  1N8R 2;  1TWH I;  1VQ7 1;  3MZL B;  4BY7 I;  2V8K A;  3EED A;  3CC2 Z;  3HKZ A;  3CCQ Z;  2M6N A;  1YHQ Z;  2KPI A;  1KQS Z;  3NH5 A;  2E2H I;  5C4X I;  5IP7 I;  1YJN 1;  1K73 2;  4RVF A;  3RZO I;  4A3G I;  1W2B Z;  1RO0 A;  5A2Q b;  4RVH A;  4NFR A;  4DGL A;  1VQP 1;  3I4N I;  3G4S 1;  1VQL Z;  1TWA I;  1VQK 1;  2PM9 A;  4NH1 C;  3PO2 I;  1X3W A;  2F4M A;  3GTG I;  3HOX I;  1VQ9 1;  4CL1 A;  2Q4Z A;  3CCM Z;  4A3E I;  1ZB9 A;  2OOY B;  3OW2 Y;  5D1P A;  5C44 I;  3VB9 A;  4NBC A;  3CCJ 1;  3OW2 Z;  5IT9 b;  3G71 1;  1YJN Z;  3BG0 B;  1NJI 2;  3S16 I;  4RS4 A;  1SFO I;  4NB9 A;  4BBR I;  3CCL 1;  4NBF A;  2O4H A;  5IT9 f;  1Q86 1;  2NVX I;  3VMH A;  3D6W A;  3I55 1;  2E9H A;  1VQ5 1;  3F3P C;  1X3Z A;  2H85 A;  3BG1 B;  3CMA Z;  1YJW 1;  1LQL A;  2JA7 I;  1WW9 A;  1R9T I;  2Y0S A;  2OZK A;  3G71 Z;  1N2F A;  4E2X A;  1ML8 A;  1Q82 2;  2VUG A;  1I6H I;  3S1Q I;  5C3E I;  3CCL Z;  2GTI A;  1VQO 1;  1M1K 2;  3I55 Z;  1RNI A;  3HOY I;  2PK7 A;  3GCF A;  2WB1 A;  1WII A;  3FQM A;  4S1T A;  4A3M I;  3CC2 1;  1KC8 1;  2K5R A;  2QR1 B;  2K3R A;  2HU9 A;  1YHQ 1;  3H3V J;  4A3C I;  2W04 A;  5LL6 f;  1Q81 2;  1QVG Z;  2R7Z I;  1K73 1;  2NVT I;  3S1M I;  1JWH C;  4AYB A;  2RT9 A;  1VQO Z;  4NBA A;  3S1R I;  2LFU A;  4HH4 A;  4E2W A;  1VQL 1;  4Y52 I;  4MD9 A;  4E2Y A;  2JA8 I;  4BBS I;  2J6A A;  3CCU 1;  3KIH A;  1KC8 2;  3VTN A;  5IP9 I;  3CCM 1;  3I4M I;  3GTK I;  3IX0 A;  5D1O B;  2OTL 1;  3VMG A;  2G2K A;  3GTP I;  4DK1 A;  1NJI 1;  1USP A;  2ZAE B;  1K83 I;  1TWF I;  3I56 Z;  2B63 I;  3M3Y I;  1JJ2 Y;  2KI7 B;  4MD7 A;  2E2J I;  5A2Q f;  3CPW Y;  3CCS 1;  3HOU I;  3CMA 1;  4QTT A;  4A3D I;  3CCU Z;  3CD6 1;  4RVG A;  1VQ8 1;  2JA5 I;  3CME Z;  1I3Q I;  2QA4 Z;  3D9X A;  3MON A;  2OTL Z;  3FKI I;  1Q82 1;  2M48 A;  4E30 A;  3GTM S;  2EGT A;  3J80 b;  3NH4 A;  4E31 A;  1M1K 1;  1RQF A;  1TFI A;  2JMO A;  3GTL I;  1TWG I;  4X6A I;  3J80 f;  4TNU A;  4E33 A;  1YUA A;  3CCS Z;  3Q87 A;  1S72 Z;  2QRC B;  3CD6 Z;  2R92 I;  1VQ8 Z;  1KD1 2;  4NBE A;  2VF1 A;  3LUS A;  3I07 A;  3ESW A;  4HGY A;  2PMZ A;  3GTO I;  3J81 b;  3KIF A;  1YIJ Z;  1Q81 1;  1K9M 2;  4MH4 A;  3J7A 4;  1M90 2;  3CC7 Z;  5D1O A;  5T64 A;  4NBB A;  3M4O I;  1USP B;  3JAM b;  2LIY A;  5T67 A;  3H0G I;  1X0T A;  1S7M A;  3HOW I;  2R6M A;  3HOV I;  3GTQ I;  2RPR A;  2V8I A;  3P5J B;  1QYP A;  1YIT Z;  2WAQ A;  2VUM I;  1WCM I;  1Q7Y 1;  2P3Y A;  4NOZ A;  3CCE Z;  2GTH A;  1VQ6 1;  3S15 I;  2F4O A;  1I50 I;  3QWU A;  3CCV 1;  4A93 I;  3NDJ A;  2QRD B;  2RBL A;  2V8J A;  5AN9 F;  3RZD I;  2JR6 A;  3I56 1;  1QVF Y;  1VLA A;  2W03 A;  2JA6 I;  3VMI A;  1VQN Z;  2YAD A;  1RO2 A;  1VQ4 Z;  3GKQ A;  2YU9 I;  1PFT A;  4NBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...