3CCMZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccmZ00
1QVGZ 1YJNZ 1NJI2 1S72Z 1Q862 1KD12 1VQ81 1K9M1 1YI2Z 1M902 3CCQ1 2QA4Z 1YJWZ 1KQSY 3CCM1 1VQP1 1VQKZ 1Q812 3CCSZ 1YIJ1 1VQ51 1YJN1 1Q7Y1 1S721 2OTJZ 1VQ4Z 3OW2Y 3G6EZ 1YI21 3CXCZ 1K9M2 2QA41 1VQOZ 1YJW1 1VQ6Z 1VQ7Z 3CC4Z 1JJ2Y 1W2BY 3CMEZ 1K731 3CMAZ 3CPWY 1VQK1 1KC81 3CCS1 3CCJZ 3CCEZ 1Q7Y2 2OTJ1 1VQL1 1VQ41 3CD6Z 3CCLZ 3G6E1 1VQMZ 3CC7Z 3CC2Z 1VQO1 1VQ61 3G4SZ 3CC41 1VQ71 3CME1 3CMA1 1K732 2OTLZ 1KC82 3CCJ1 3CCRZ 3CCE1 1QVFZ 1VQ9Z 1Q821 1YHQZ 1K8A1 3CD61 1QVGY 3CCL1 1VQM1 3I55Z 3CC71 1VQNZ 1N8R1 1M1K1 3CC21 3G4S1 3G71Z 1YJ9Z 2OTL1 3CCR1 3CCUZ 1VQ91 1KQSZ 1YITZ 3I56Z 1Q822 3CCVZ 2QEXZ 1YHQ1 1K8A2 1NJI1 3I551 1VQN1 1Q861 1KD11 1N8R2 1M1K2 1VQ8Z 1M901 3CXCY 1VQ5Z 3G711 3OW2Z 3CCQZ 1YJ91 1QVFY 3CCMZ 3CCU1 1YIT1 1VQPZ 1VQLZ 3I561 1Q811 1W2BZ 3CCV1 2QEX1 1JJ2Z 1YIJZ 3CPWZ
chains in the Genus database with same CATH superfamily
1NJI2 3MONA 3VMIA 1ZB9A 2AYDA 1YI2Z 1M902 3GTKI 3H3VJ 4A93I 2K5RA 1YJWZ 2JA6I 3S17I 3HKZA 5FLXf 2OZKA 1S721 2OTJZ 2VUGA 3PO2I 3OW2Y 3G6EZ 4BXXI 1USPB 1WJ2A 2KI7B 4NFRA 5T67A 3GTMI 1JWHC 1USPA 2I3CA 1VQ7Z 1ZH1A 5FLXb 2GU2A 3CMAZ 3CCS1 4NOZA 2NVTI 3VMHA 1VQL1 1VQ41 3CCLZ 2JMOA 2V45A 1VQ61 2QKDA 3T4NB 3CME1 1K732 3NDIA 2OOXB 4MXUA 3CCJ1 3CCRZ 1VQ9Z 4X6AI 2W03A 1Q821 1QYPA 2NVYI 1YHQZ 4NBAA 4RVGA 1QXFA 3CC71 2NVXI 2F4OA 1N8R1 3CC21 3G4S1 4E2ZA 1WW9A 3I07A 3BG1B 5T6BA 1N2FA 1YITZ 2O53A 1K83I 4RS4A 2F4MA 3CCVZ 4A3EI 2VF1A 1K8A2 4A3GI 1WZNA 1M1K2 1VQ8Z 3GKQA 3NDJA 4MRIA 3OW2Z 3CCQZ 2NAPA 2V3VA 3KIHA 2M48A 4DQYB 4CL1A 2LEXA 3J80b 3CCU1 2K3RA 1VQLZ 2W04A 2JIMA 1YIJZ 1VQ5Z 2VPWA 4Y7NI 1YJNZ 1S7MA 3M4OI 1X3WA 3D9XA 1Q862 2DE5A 1KD12 4E2WA 1K9M1 3NH4A 2QA4Z 2ZAEB 4E32A 1KQSY 4A3DI 2RIQA 2VPYA 3P5JB 1Q812 3FKII 1Z02A 5A2Qb 4DGLA 1I3QI 3GTPI 2RT9A 3NFZA 2P3YA 1TWGI 3CXCZ 1VQOZ 1RO4A 5T64A 2JNYA 1W2BY 4BBSI 3J81f 5C44I 1VQK1 2P28A 2IV2X 3CCEZ 2J6AA 2IZ3A 1Q7Y2 4A3II 3CD6Z 2PM9A 1VQMZ 1R9TI 5D1PA 4DK1A 4E2XA 3J81b 5IT9f 2JUBA 3LUSA 2E2JI 2JA5I 3CC41 1NP6A 3GCFA 1KC82 3D2LA 4RVHA 5AN9F 2H85A 1AA6A 3HOZI 4RVFA 5D1OB 3PO3I 1X0TA 5IT9b 3I55Z 1YUKA 1TFIA 2GTHA 2JIOA 5LL6f 3G71Z 1I50I 1YJ9Z 2OTL1 2RPRA 3VMGA 1KQSZ 2JIPA 3S15I 4NBHA 3I56Z 1NJI1 1VQN1 3IFUA 4S1TA 3ESWA 4BY1I 3H0GI 1M901 3CXCY 3QWUA 1QVFY 2R93I 4A3JI 2LFUA 2LIYA 2HU9A 1W2BZ 1NUIA 2QEX1 1Z03A 2GTIA 4MD9A 2G2KA 1TWCI 4NBCA 1S72Z 3S2DI 2QR1B 3F3FC 2R7ZI 3J80f 1Y1VS 2JA7I 3HOXI 1Y8CA 3CCM1 5CM2M 1VQP1 4TNUA 1Y1WI 3MZLB 3EERA 3CCSZ 3IF8A 1VQ4Z 1YI21 4A3KI 2E2II 2NVQI 4Y52I 1TWAI 1YJW1 1VQ6Z 5A2Qf 2JR6A 3S16I 2Q4ZA 5IP9I 3HOWI 1L1OC 3CMEZ 1K731 3NH5A 3CPWY 3J7A4 3IX0A 3CCJZ 4A3BI 2OTJ1 1LQLA 2RHBA 3KIFA 3MZKB 4HGZA 4NBDA 1I6HI 3HOYI 1RLYA 3G6E1 4HGYA 1RO2A 4QTTA 3CC7Z 3F3PC 3CC2Z 1FDIA 2O4HA 3G4SZ 1VQ71 3IR7A 4NH1C 3JAMf 1Q16A 3CMA1 3I4MI 2YADA 4RVDA 2PK7A 4EWCA 3VTNA 1QVFZ 1X3ZA 2VPZA 3S1NI 1RO0A 4E30A 3K7AI 2JA8I 1K8A1 2BJOA 3CCL1 4NBEA 3FQMA 1M1K1 1WCMI 3JAMb 4E2YA 2M6NA 3Q87A 4A3CI 1ML8A 3S14I 3CCR1 3CCUZ 1VQ91 2PMZA 1Q822 4NBGA 2JIRA 1YHQ1 4NB8A 3GTLI 4A3MI 5FLMI 3S1MI 2QRCB 1Q861 4MD7A 1KD11 1N8R2 2IZ4A 4RV9A 1DL6A 5D1OA 2DE6A 3GTMS 2VUMI 5C4XI 2E9HA 1YIT1 4NB9A 3FQQA 1Q811 3CCV1 3PO3S 5IP7I 2DE7A 3CPWZ 2Y0SA 1QVGZ 1FDOA 3TDHB 2E2HI 2QREB 1VQ81 3U50C 4MH4A 3CCQ1 1PFTA 3GTOI 3S2HI 1VQKZ 2V8KA 3GTJI 2YU9I 2EGTA 1YIJ1 1VQ51 1YJN1 3BG0B 1Q7Y1 1P9NA 1RNIA 2V8IA 1K9M2 4BY7I 2R92I 2QA41 3RZOI 4E31A 1VLAA 3CC4Z 1JJ2Y 1KRLA 2QRDB 4XX2A 1KC81 4A3FI 3CQZI 4A3LI 4BBRI 3EEDA 1WIIA 3TE5B 2WB1A 1Y1VI 1Z01A 2VPXA 2E7ZA 1VQO1 4MONA 2JIQA 3RZDI 4AYBA 1SFOI 1RQFA 2OTLZ 2R6MA 3CCE1 1YUAA 5C4JI 3GTGI 2AKLA 4MD8A 3CD61 1QVGY 3NH8A 2KPIA 1VQM1 2JS4A 2V8JA 1VQNZ 3M3YI 4QTUA 1ZB8A 2OOYB 2QLVB 1TWFI 2HF1A 5C3EI 1TWHI 4HH4A 4E33A 1SIWA 2Q51A 2QEXZ 3I4NI 4NBBA 4NBFA 3HOUI 3I551 2RBLA 2WAQA 3G711 3GTQI 3S1QI 1YJ91 3VB9A 3CCMZ 2B63I 1VQPZ 3I561 1JJ2Z 3HOVI 3S1RI 3D6WA 1QF8A
chains in the Genus database with same CATH topology
1NJI2 3MONA 3VMIA 1ZB9A 1YI2Z 1M902 3GTKI 3H3VJ 4A93I 2K5RA 1YJWZ 2JA6I 3S17I 3HKZA 5FLXf 2OZKA 1S721 2OTJZ 2VUGA 3PO2I 3OW2Y 3G6EZ 4BXXI 1USPB 2KI7B 4NFRA 5T67A 3GTMI 1JWHC 1USPA 2I3CA 1VQ7Z 1ZH1A 5FLXb 2GU2A 3CMAZ 3CCS1 4NOZA 2NVTI 3VMHA 1VQL1 1VQ41 3CCLZ 2JMOA 1VQ61 2QKDA 3T4NB 3CME1 1K732 3NDIA 2OOXB 4MXUA 3CCJ1 3CCRZ 1VQ9Z 4X6AI 2W03A 1Q821 1QYPA 2NVYI 1YHQZ 4NBAA 4RVGA 3CC71 2NVXI 2F4OA 1N8R1 3CC21 3G4S1 4E2ZA 1WW9A 3I07A 3BG1B 5T6BA 1N2FA 1YITZ 2O53A 1K83I 4RS4A 2F4MA 3CCVZ 4A3EI 2VF1A 1K8A2 4A3GI 1M1K2 1VQ8Z 3GKQA 3NDJA 4MRIA 3OW2Z 3CCQZ 3KIHA 2M48A 4DQYB 4CL1A 3J80b 3CCU1 2K3RA 1VQLZ 2W04A 1YIJZ 1VQ5Z 4Y7NI 1YJNZ 1S7MA 3M4OI 1X3WA 3D9XA 1Q862 2DE5A 1KD12 4E2WA 1K9M1 3NH4A 2QA4Z 2ZAEB 4E32A 1KQSY 4A3DI 2RIQA 3P5JB 1Q812 3FKII 1Z02A 5A2Qb 4DGLA 1I3QI 3GTPI 2RT9A 3NFZA 2P3YA 1TWGI 3CXCZ 1VQOZ 1RO4A 5T64A 2JNYA 1W2BY 4BBSI 3J81f 5C44I 1VQK1 2P28A 3CCEZ 2J6AA 2IZ3A 1Q7Y2 4A3II 3CD6Z 2PM9A 1VQMZ 1R9TI 5D1PA 4DK1A 4E2XA 3J81b 5IT9f 2JUBA 3LUSA 2E2JI 2JA5I 3CC41 1NP6A 3GCFA 1KC82 4RVHA 5AN9F 2H85A 3HOZI 4RVFA 5D1OB 3PO3I 1X0TA 5IT9b 3I55Z 1YUKA 1TFIA 2GTHA 5LL6f 3G71Z 1I50I 1YJ9Z 2OTL1 2RPRA 3VMGA 1KQSZ 3S15I 4NBHA 3I56Z 1NJI1 1VQN1 3IFUA 4S1TA 3ESWA 4BY1I 3H0GI 1M901 3CXCY 3QWUA 1QVFY 2R93I 4A3JI 2LFUA 2LIYA 2HU9A 1W2BZ 1NUIA 2QEX1 1Z03A 2GTIA 4MD9A 2G2KA 1TWCI 4NBCA 1S72Z 3S2DI 2QR1B 3F3FC 2R7ZI 3J80f 1Y1VS 2JA7I 3HOXI 3CCM1 5CM2M 1VQP1 4TNUA 1Y1WI 3MZLB 3EERA 3CCSZ 3IF8A 1VQ4Z 1YI21 4A3KI 2E2II 2NVQI 4Y52I 1TWAI 1YJW1 1VQ6Z 5A2Qf 2JR6A 3S16I 2Q4ZA 5IP9I 3HOWI 1L1OC 3CMEZ 1K731 3NH5A 3CPWY 3J7A4 3IX0A 3CCJZ 4A3BI 2OTJ1 1LQLA 2RHBA 3KIFA 3MZKB 4HGZA 4NBDA 1I6HI 3HOYI 1RLYA 3G6E1 4HGYA 1RO2A 4QTTA 3CC7Z 3F3PC 3CC2Z 2O4HA 3G4SZ 1VQ71 4NH1C 3JAMf 3CMA1 3I4MI 2YADA 4RVDA 2PK7A 4EWCA 3VTNA 1QVFZ 1X3ZA 3S1NI 1RO0A 4E30A 3K7AI 2JA8I 1K8A1 2BJOA 3CCL1 4NBEA 3FQMA 1M1K1 1WCMI 3JAMb 4E2YA 2M6NA 3Q87A 4A3CI 1ML8A 3S14I 3CCR1 3CCUZ 1VQ91 2PMZA 1Q822 4NBGA 1YHQ1 3GTLI 4NB8A 4A3MI 5FLMI 3S1MI 2QRCB 1Q861 4MD7A 1KD11 1N8R2 2IZ4A 4RV9A 1DL6A 5D1OA 2DE6A 3GTMS 2VUMI 5C4XI 2E9HA 1YIT1 4NB9A 3FQQA 1Q811 3CCV1 3PO3S 5IP7I 2DE7A 3CPWZ 2Y0SA 1QVGZ 3TDHB 2E2HI 2QREB 1VQ81 3U50C 4MH4A 3CCQ1 1PFTA 3GTOI 3S2HI 1VQKZ 2V8KA 3GTJI 2YU9I 2EGTA 1YIJ1 1VQ51 1YJN1 3BG0B 1Q7Y1 1P9NA 1RNIA 2V8IA 1K9M2 4BY7I 2R92I 2QA41 3RZOI 4E31A 1VLAA 3CC4Z 1JJ2Y 1KRLA 2QRDB 4XX2A 1KC81 4A3FI 3CQZI 4A3LI 4BBRI 3EEDA 1WIIA 3TE5B 2WB1A 1Y1VI 1Z01A 1VQO1 4MONA 3RZDI 4AYBA 1SFOI 1RQFA 2OTLZ 2R6MA 3CCE1 1YUAA 5C4JI 3GTGI 2AKLA 4MD8A 3CD61 1QVGY 3NH8A 2KPIA 1VQM1 2JS4A 2V8JA 1VQNZ 3M3YI 4QTUA 1ZB8A 2OOYB 2QLVB 1TWFI 2HF1A 5C3EI 1TWHI 4HH4A 4E33A 2Q51A 2QEXZ 3I4NI 4NBBA 4NBFA 3HOUI 3I551 2RBLA 2WAQA 3G711 3GTQI 3S1QI 1YJ91 3VB9A 3CCMZ 2B63I 1VQPZ 3I561 1JJ2Z 3HOVI 3S1RI 3D6WA 1QF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG Z;  1YJN Z;  1NJI 2;  1S72 Z;  1Q86 2;  1KD1 2;  1VQ8 1;  1K9M 1;  1YI2 Z;  1M90 2;  3CCQ 1;  2QA4 Z;  1YJW Z;  1KQS Y;  3CCM 1;  1VQP 1;  1VQK Z;  1Q81 2;  3CCS Z;  1YIJ 1;  1VQ5 1;  1YJN 1;  1Q7Y 1;  1S72 1;  2OTJ Z;  1VQ4 Z;  3OW2 Y;  3G6E Z;  1YI2 1;  3CXC Z;  1K9M 2;  2QA4 1;  1VQO Z;  1YJW 1;  1VQ6 Z;  1VQ7 Z;  3CC4 Z;  1JJ2 Y;  1W2B Y;  3CME Z;  1K73 1;  3CMA Z;  3CPW Y;  1VQK 1;  1KC8 1;  3CCS 1;  3CCJ Z;  3CCE Z;  1Q7Y 2;  2OTJ 1;  1VQL 1;  1VQ4 1;  3CD6 Z;  3CCL Z;  3G6E 1;  1VQM Z;  3CC7 Z;  3CC2 Z;  1VQO 1;  1VQ6 1;  3G4S Z;  3CC4 1;  1VQ7 1;  3CME 1;  3CMA 1;  1K73 2;  2OTL Z;  1KC8 2;  3CCJ 1;  3CCR Z;  3CCE 1;  1QVF Z;  1VQ9 Z;  1Q82 1;  1YHQ Z;  1K8A 1;  3CD6 1;  1QVG Y;  3CCL 1;  1VQM 1;  3I55 Z;  3CC7 1;  1VQN Z;  1N8R 1;  1M1K 1;  3CC2 1;  3G4S 1;  3G71 Z;  1YJ9 Z;  2OTL 1;  3CCR 1;  3CCU Z;  1VQ9 1;  1KQS Z;  1YIT Z;  3I56 Z;  1Q82 2;  3CCV Z;  2QEX Z;  1YHQ 1;  1K8A 2;  1NJI 1;  3I55 1;  1VQN 1;  1Q86 1;  1KD1 1;  1N8R 2;  1M1K 2;  1VQ8 Z;  1M90 1;  3CXC Y;  1VQ5 Z;  3G71 1;  3OW2 Z;  3CCQ Z;  1YJ9 1;  1QVF Y;  3CCM Z;  3CCU 1;  1YIT 1;  1VQP Z;  1VQL Z;  3I56 1;  1Q81 1;  1W2B Z;  3CCV 1;  2QEX 1;  1JJ2 Z;  1YIJ Z;  3CPW Z; 
#chains in the Genus database with same CATH topology
 1NJI 2;  3MON A;  3VMI A;  1ZB9 A;  2AYD A;  1YI2 Z;  1M90 2;  3GTK I;  3H3V J;  4A93 I;  2K5R A;  1YJW Z;  2JA6 I;  3S17 I;  3HKZ A;  5FLX f;  2OZK A;  1S72 1;  2OTJ Z;  2VUG A;  3PO2 I;  3OW2 Y;  3G6E Z;  4BXX I;  1USP B;  1WJ2 A;  2KI7 B;  4NFR A;  5T67 A;  3GTM I;  1JWH C;  1USP A;  2I3C A;  1VQ7 Z;  1ZH1 A;  5FLX b;  2GU2 A;  3CMA Z;  3CCS 1;  4NOZ A;  2NVT I;  3VMH A;  1VQL 1;  1VQ4 1;  3CCL Z;  2JMO A;  2V45 A;  1VQ6 1;  2QKD A;  3T4N B;  3CME 1;  1K73 2;  3NDI A;  2OOX B;  4MXU A;  3CCJ 1;  3CCR Z;  1VQ9 Z;  4X6A I;  2W03 A;  1Q82 1;  1QYP A;  2NVY I;  1YHQ Z;  4NBA A;  4RVG A;  1QXF A;  3CC7 1;  2NVX I;  2F4O A;  1N8R 1;  3CC2 1;  3G4S 1;  4E2Z A;  1WW9 A;  3I07 A;  3BG1 B;  5T6B A;  1N2F A;  1YIT Z;  2O53 A;  1K83 I;  4RS4 A;  2F4M A;  3CCV Z;  4A3E I;  2VF1 A;  1K8A 2;  4A3G I;  1WZN A;  1M1K 2;  1VQ8 Z;  3GKQ A;  3NDJ A;  4MRI A;  3OW2 Z;  3CCQ Z;  2NAP A;  2V3V A;  3KIH A;  2M48 A;  4DQY B;  4CL1 A;  2LEX A;  3J80 b;  3CCU 1;  2K3R A;  1VQL Z;  2W04 A;  2JIM A;  1YIJ Z;  1VQ5 Z;  2VPW A;  4Y7N I;  1YJN Z;  1S7M A;  3M4O I;  1X3W A;  3D9X A;  1Q86 2;  2DE5 A;  1KD1 2;  4E2W A;  1K9M 1;  3NH4 A;  2QA4 Z;  2ZAE B;  4E32 A;  1KQS Y;  4A3D I;  2RIQ A;  2VPY A;  3P5J B;  1Q81 2;  3FKI I;  1Z02 A;  5A2Q b;  4DGL A;  1I3Q I;  3GTP I;  2RT9 A;  3NFZ A;  2P3Y A;  1TWG I;  3CXC Z;  1VQO Z;  1RO4 A;  5T64 A;  2JNY A;  1W2B Y;  4BBS I;  3J81 f;  5C44 I;  1VQK 1;  2P28 A;  2IV2 X;  3CCE Z;  2J6A A;  2IZ3 A;  1Q7Y 2;  4A3I I;  3CD6 Z;  2PM9 A;  1VQM Z;  1R9T I;  5D1P A;  4DK1 A;  4E2X A;  3J81 b;  5IT9 f;  2JUB A;  3LUS A;  2E2J I;  2JA5 I;  3CC4 1;  1NP6 A;  3GCF A;  1KC8 2;  3D2L A;  4RVH A;  5AN9 F;  2H85 A;  1AA6 A;  3HOZ I;  4RVF A;  5D1O B;  3PO3 I;  1X0T A;  5IT9 b;  3I55 Z;  1YUK A;  1TFI A;  2GTH A;  2JIO A;  5LL6 f;  3G71 Z;  1I50 I;  1YJ9 Z;  2OTL 1;  2RPR A;  3VMG A;  1KQS Z;  2JIP A;  3S15 I;  4NBH A;  3I56 Z;  1NJI 1;  1VQN 1;  3IFU A;  4S1T A;  3ESW A;  4BY1 I;  3H0G I;  1M90 1;  3CXC Y;  3QWU A;  1QVF Y;  2R93 I;  4A3J I;  2LFU A;  2LIY A;  2HU9 A;  1W2B Z;  1NUI A;  2QEX 1;  1Z03 A;  2GTI A;  4MD9 A;  2G2K A;  1TWC I;  4NBC A;  1S72 Z;  3S2D I;  2QR1 B;  3F3F C;  2R7Z I;  3J80 f;  1Y1V S;  2JA7 I;  3HOX I;  1Y8C A;  3CCM 1;  5CM2 M;  1VQP 1;  4TNU A;  1Y1W I;  3MZL B;  3EER A;  3CCS Z;  3IF8 A;  1VQ4 Z;  1YI2 1;  4A3K I;  2E2I I;  2NVQ I;  4Y52 I;  1TWA I;  1YJW 1;  1VQ6 Z;  5A2Q f;  2JR6 A;  3S16 I;  2Q4Z A;  5IP9 I;  3HOW I;  1L1O C;  3CME Z;  1K73 1;  3NH5 A;  3CPW Y;  3J7A 4;  3IX0 A;  3CCJ Z;  4A3B I;  2OTJ 1;  1LQL A;  2RHB A;  3KIF A;  3MZK B;  4HGZ A;  4NBD A;  1I6H I;  3HOY I;  1RLY A;  3G6E 1;  4HGY A;  1RO2 A;  4QTT A;  3CC7 Z;  3F3P C;  3CC2 Z;  1FDI A;  2O4H A;  3G4S Z;  1VQ7 1;  3IR7 A;  4NH1 C;  3JAM f;  1Q16 A;  3CMA 1;  3I4M I;  2YAD A;  4RVD A;  2PK7 A;  4EWC A;  3VTN A;  1QVF Z;  1X3Z A;  2VPZ A;  3S1N I;  1RO0 A;  4E30 A;  3K7A I;  2JA8 I;  1K8A 1;  2BJO A;  3CCL 1;  4NBE A;  3FQM A;  1M1K 1;  1WCM I;  3JAM b;  4E2Y A;  2M6N A;  3Q87 A;  4A3C I;  1ML8 A;  3S14 I;  3CCR 1;  3CCU Z;  1VQ9 1;  2PMZ A;  1Q82 2;  4NBG A;  2JIR A;  1YHQ 1;  4NB8 A;  3GTL I;  4A3M I;  5FLM I;  3S1M I;  2QRC B;  1Q86 1;  4MD7 A;  1KD1 1;  1N8R 2;  2IZ4 A;  4RV9 A;  1DL6 A;  5D1O A;  2DE6 A;  3GTM S;  2VUM I;  5C4X I;  2E9H A;  1YIT 1;  4NB9 A;  3FQQ A;  1Q81 1;  3CCV 1;  3PO3 S;  5IP7 I;  2DE7 A;  3CPW Z;  2Y0S A;  1QVG Z;  1FDO A;  3TDH B;  2E2H I;  2QRE B;  1VQ8 1;  3U50 C;  4MH4 A;  3CCQ 1;  1PFT A;  3GTO I;  3S2H I;  1VQK Z;  2V8K A;  3GTJ I;  2YU9 I;  2EGT A;  1YIJ 1;  1VQ5 1;  1YJN 1;  3BG0 B;  1Q7Y 1;  1P9N A;  1RNI A;  2V8I A;  1K9M 2;  4BY7 I;  2R92 I;  2QA4 1;  3RZO I;  4E31 A;  1VLA A;  3CC4 Z;  1JJ2 Y;  1KRL A;  2QRD B;  4XX2 A;  1KC8 1;  4A3F I;  3CQZ I;  4A3L I;  4BBR I;  3EED A;  1WII A;  3TE5 B;  2WB1 A;  1Y1V I;  1Z01 A;  2VPX A;  2E7Z A;  1VQO 1;  4MON A;  2JIQ A;  3RZD I;  4AYB A;  1SFO I;  1RQF A;  2OTL Z;  2R6M A;  3CCE 1;  1YUA A;  5C4J I;  3GTG I;  2AKL A;  4MD8 A;  3CD6 1;  1QVG Y;  3NH8 A;  2KPI A;  1VQM 1;  2JS4 A;  2V8J A;  1VQN Z;  3M3Y I;  4QTU A;  1ZB8 A;  2OOY B;  2QLV B;  1TWF I;  2HF1 A;  5C3E I;  1TWH I;  4HH4 A;  4E33 A;  1SIW A;  2Q51 A;  2QEX Z;  3I4N I;  4NBB A;  4NBF A;  3HOU I;  3I55 1;  2RBL A;  2WAQ A;  3G71 1;  3GTQ I;  3S1Q I;  1YJ9 1;  3VB9 A;  3CCM Z;  2B63 I;  1VQP Z;  3I56 1;  1JJ2 Z;  3HOV I;  3S1R I;  3D6W A;  1QF8 A; 
#chains in the Genus database with same CATH homology
 1NJI 2;  3MON A;  3VMI A;  1ZB9 A;  1YI2 Z;  1M90 2;  3GTK I;  3H3V J;  4A93 I;  2K5R A;  1YJW Z;  2JA6 I;  3S17 I;  3HKZ A;  5FLX f;  2OZK A;  1S72 1;  2OTJ Z;  2VUG A;  3PO2 I;  3OW2 Y;  3G6E Z;  4BXX I;  1USP B;  2KI7 B;  4NFR A;  5T67 A;  3GTM I;  1JWH C;  1USP A;  2I3C A;  1VQ7 Z;  1ZH1 A;  5FLX b;  2GU2 A;  3CMA Z;  3CCS 1;  4NOZ A;  2NVT I;  3VMH A;  1VQL 1;  1VQ4 1;  3CCL Z;  2JMO A;  1VQ6 1;  2QKD A;  3T4N B;  3CME 1;  1K73 2;  3NDI A;  2OOX B;  4MXU A;  3CCJ 1;  3CCR Z;  1VQ9 Z;  4X6A I;  2W03 A;  1Q82 1;  1QYP A;  2NVY I;  1YHQ Z;  4NBA A;  4RVG A;  3CC7 1;  2NVX I;  2F4O A;  1N8R 1;  3CC2 1;  3G4S 1;  4E2Z A;  1WW9 A;  3I07 A;  3BG1 B;  5T6B A;  1N2F A;  1YIT Z;  2O53 A;  1K83 I;  4RS4 A;  2F4M A;  3CCV Z;  4A3E I;  2VF1 A;  1K8A 2;  4A3G I;  1M1K 2;  1VQ8 Z;  3GKQ A;  3NDJ A;  4MRI A;  3OW2 Z;  3CCQ Z;  3KIH A;  2M48 A;  4DQY B;  4CL1 A;  3J80 b;  3CCU 1;  2K3R A;  1VQL Z;  2W04 A;  1YIJ Z;  1VQ5 Z;  4Y7N I;  1YJN Z;  1S7M A;  3M4O I;  1X3W A;  3D9X A;  1Q86 2;  2DE5 A;  1KD1 2;  4E2W A;  1K9M 1;  3NH4 A;  2QA4 Z;  2ZAE B;  4E32 A;  1KQS Y;  4A3D I;  2RIQ A;  3P5J B;  1Q81 2;  3FKI I;  1Z02 A;  5A2Q b;  4DGL A;  1I3Q I;  3GTP I;  2RT9 A;  3NFZ A;  2P3Y A;  1TWG I;  3CXC Z;  1VQO Z;  1RO4 A;  5T64 A;  2JNY A;  1W2B Y;  4BBS I;  3J81 f;  5C44 I;  1VQK 1;  2P28 A;  3CCE Z;  2J6A A;  2IZ3 A;  1Q7Y 2;  4A3I I;  3CD6 Z;  2PM9 A;  1VQM Z;  1R9T I;  5D1P A;  4DK1 A;  4E2X A;  3J81 b;  5IT9 f;  2JUB A;  3LUS A;  2E2J I;  2JA5 I;  3CC4 1;  1NP6 A;  3GCF A;  1KC8 2;  4RVH A;  5AN9 F;  2H85 A;  3HOZ I;  4RVF A;  5D1O B;  3PO3 I;  1X0T A;  5IT9 b;  3I55 Z;  1YUK A;  1TFI A;  2GTH A;  5LL6 f;  3G71 Z;  1I50 I;  1YJ9 Z;  2OTL 1;  2RPR A;  3VMG A;  1KQS Z;  3S15 I;  4NBH A;  3I56 Z;  1NJI 1;  1VQN 1;  3IFU A;  4S1T A;  3ESW A;  4BY1 I;  3H0G I;  1M90 1;  3CXC Y;  3QWU A;  1QVF Y;  2R93 I;  4A3J I;  2LFU A;  2LIY A;  2HU9 A;  1W2B Z;  1NUI A;  2QEX 1;  1Z03 A;  2GTI A;  4MD9 A;  2G2K A;  1TWC I;  4NBC A;  1S72 Z;  3S2D I;  2QR1 B;  3F3F C;  2R7Z I;  3J80 f;  1Y1V S;  2JA7 I;  3HOX I;  3CCM 1;  5CM2 M;  1VQP 1;  4TNU A;  1Y1W I;  3MZL B;  3EER A;  3CCS Z;  3IF8 A;  1VQ4 Z;  1YI2 1;  4A3K I;  2E2I I;  2NVQ I;  4Y52 I;  1TWA I;  1YJW 1;  1VQ6 Z;  5A2Q f;  2JR6 A;  3S16 I;  2Q4Z A;  5IP9 I;  3HOW I;  1L1O C;  3CME Z;  1K73 1;  3NH5 A;  3CPW Y;  3J7A 4;  3IX0 A;  3CCJ Z;  4A3B I;  2OTJ 1;  1LQL A;  2RHB A;  3KIF A;  3MZK B;  4HGZ A;  4NBD A;  1I6H I;  3HOY I;  1RLY A;  3G6E 1;  4HGY A;  1RO2 A;  4QTT A;  3CC7 Z;  3F3P C;  3CC2 Z;  2O4H A;  3G4S Z;  1VQ7 1;  4NH1 C;  3JAM f;  3CMA 1;  3I4M I;  2YAD A;  4RVD A;  2PK7 A;  4EWC A;  3VTN A;  1QVF Z;  1X3Z A;  3S1N I;  1RO0 A;  4E30 A;  3K7A I;  2JA8 I;  1K8A 1;  2BJO A;  3CCL 1;  4NBE A;  3FQM A;  1M1K 1;  1WCM I;  3JAM b;  4E2Y A;  2M6N A;  3Q87 A;  4A3C I;  1ML8 A;  3S14 I;  3CCR 1;  3CCU Z;  1VQ9 1;  2PMZ A;  1Q82 2;  4NBG A;  1YHQ 1;  3GTL I;  4NB8 A;  4A3M I;  5FLM I;  3S1M I;  2QRC B;  1Q86 1;  4MD7 A;  1KD1 1;  1N8R 2;  2IZ4 A;  4RV9 A;  1DL6 A;  5D1O A;  2DE6 A;  3GTM S;  2VUM I;  5C4X I;  2E9H A;  1YIT 1;  4NB9 A;  3FQQ A;  1Q81 1;  3CCV 1;  3PO3 S;  5IP7 I;  2DE7 A;  3CPW Z;  2Y0S A;  1QVG Z;  3TDH B;  2E2H I;  2QRE B;  1VQ8 1;  3U50 C;  4MH4 A;  3CCQ 1;  1PFT A;  3GTO I;  3S2H I;  1VQK Z;  2V8K A;  3GTJ I;  2YU9 I;  2EGT A;  1YIJ 1;  1VQ5 1;  1YJN 1;  3BG0 B;  1Q7Y 1;  1P9N A;  1RNI A;  2V8I A;  1K9M 2;  4BY7 I;  2R92 I;  2QA4 1;  3RZO I;  4E31 A;  1VLA A;  3CC4 Z;  1JJ2 Y;  1KRL A;  2QRD B;  4XX2 A;  1KC8 1;  4A3F I;  3CQZ I;  4A3L I;  4BBR I;  3EED A;  1WII A;  3TE5 B;  2WB1 A;  1Y1V I;  1Z01 A;  1VQO 1;  4MON A;  3RZD I;  4AYB A;  1SFO I;  1RQF A;  2OTL Z;  2R6M A;  3CCE 1;  1YUA A;  5C4J I;  3GTG I;  2AKL A;  4MD8 A;  3CD6 1;  1QVG Y;  3NH8 A;  2KPI A;  1VQM 1;  2JS4 A;  2V8J A;  1VQN Z;  3M3Y I;  4QTU A;  1ZB8 A;  2OOY B;  2QLV B;  1TWF I;  2HF1 A;  5C3E I;  1TWH I;  4HH4 A;  4E33 A;  2Q51 A;  2QEX Z;  3I4N I;  4NBB A;  4NBF A;  3HOU I;  3I55 1;  2RBL A;  2WAQ A;  3G71 1;  3GTQ I;  3S1Q I;  1YJ9 1;  3VB9 A;  3CCM Z;  2B63 I;  1VQP Z;  3I56 1;  1JJ2 Z;  3HOV I;  3S1R I;  3D6W A;  1QF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...