3CC21

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc2100
3OW2Z 1YIJ1 3CCEZ 1VQ9Z 1VQM1 3CCUZ 1K8A2 1Q821 1VQP1 3CCQZ 1YHQ1 1JJ2Z 3CME1 1YJN1 3G711 2OTLZ 3CC4Z 3CC2Z 3I56Z 1KC81 3CCR1 1QVFY 2OTJ1 1S72Z 1YIJZ 1Q822 1VQ61 1VQMZ 3CCL1 1VQK1 1VQ4Z 1YJ91 1Q811 1VQPZ 3CXCZ 2QA41 3G6E1 3G4S1 1KC82 1K9M1 1VQ7Z 1VQ51 1QVGY 1VQOZ 1VQN1 3CCVZ 1KQSY 3CMA1 1N8R1 1VQ81 2OTJZ 1M901 3CCJ1 1YIT1 3I551 2QEX1 1M1K1 1VQ6Z 3CC71 1K9M2 3CCLZ 1VQKZ 1YI21 1NJI1 2QA4Z 3G4SZ 3CPWY 1W2BY 1Q861 3CCE1 1QVFZ 1N8R2 1VQ5Z 1YHQZ 1K731 1M902 3CMEZ 1Q7Y1 3CCM1 3CCU1 1YJNZ 3G71Z 1M1K2 1VQ8Z 3CCJZ 3OW2Y 1YITZ 1KD11 1NJI2 1K8A1 3I55Z 3CCRZ 2OTL1 3CXCY 3I561 1YJW1 1Q862 3CCS1 1Q812 1YI2Z 1QVGZ 1K732 1VQL1 1S721 1JJ2Y 1KQSZ 1Q7Y2 3CD61 1YJ9Z 3G6EZ 1VQ41 1KD12 3CCMZ 1VQ91 1VQ71 1VQNZ 3CCQ1 3CMAZ 3CPWZ 1W2BZ 1VQO1 1YJWZ 3CCV1 3CCSZ 2QEXZ 1VQLZ 3CC41 3CC21 3CC7Z 3CD6Z
chains in the Genus database with same CATH superfamily
2ZAEB 2R6MA 4HGZA 3FQQA 1I50I 3LUSA 1VQM1 3VMHA 2LIYA 3CCUZ 1VQP1 1YHQ1 1TWAI 4A3KI 1SFOI 2E7ZA 2JA5I 3MZKB 2OTLZ 3MONA 2M6NA 3CC2Z 3I56Z 3S2DI 4BY1I 2P28A 1KC81 3CCR1 1S72Z 1I6HI 1WZNA 4NBBA 1Q822 4NBHA 4RVGA 2JIQA 5C44I 1VQK1 2WB1A 2QA41 4A93I 1K9M1 3GTKI 3HOZI 2O53A 1YUKA 3S2HI 3JAMf 2DE5A 3CCVZ 1QYPA 5C4JI 2OTJZ 1YIT1 1Q16A 3EERA 3I551 2QEX1 1VQ6Z 1Y1VS 2PMZA 2YU9I 1S7MA 1RO2A 3BG0B 4AYBA 4EWCA 2JR6A 1W2BY 3GTQI 3CCE1 4A3JI 3HOYI 2GU2A 3F3FC 1YHQZ 1K731 1M902 4BBSI 3PO2I 1Q7Y1 2O4HA 1ML8A 1KD11 1NJI2 3CCRZ 3CXCY 1YJW1 3CCS1 4Y52I 1QVGZ 3GTMI 1ZB8A 2H85A 5D1OA 2IV2X 5T67A 5IT9f 1KQSZ 4MXUA 3GCFA 2R7ZI 3GKQA 3J81b 5AN9F 1LQLA 3CCMZ 1FDOA 3NH5A 5IP9I 2JIMA 3CPWZ 4A3BI 1VQO1 2QRCB 2J6AA 2QEXZ 3CC21 4NH1C 2VPZA 1K83I 3OW2Z 1SIWA 3HOVI 5IT9b 3CCEZ 1WCMI 4HH4A 2EGTA 3NH4A 1Q821 1VLAA 3CCQZ 2KI7B 2B63I 3HOWI 4E2YA 5T6BA 4E2XA 3G711 1X3WA 2YADA 3M3YI 2V45A 4NFRA 3EEDA 3D2LA 1ZH1A 3U50C 1RO4A 2OTJ1 4NBEA 5FLXb 1YIJZ 1VQ61 2VPYA 2NVXI 5CM2M 1YJ91 3CXCZ 2AKLA 4HGYA 1I3QI 3PO3I 4A3CI 3KIHA 1QVGY 4NB9A 1VQOZ 1R9TI 1KQSY 3CMA1 3D6WA 1M901 4A3EI 4QTTA 4Y7NI 3J7A4 1Y8CA 1NJI1 3CPWY 1QVFZ 1N8R2 3I07A 3TE5B 2R93I 3CCM1 3G71Z 4RVDA 3CCJZ 3OW2Y 4A3MI 5FLMI 5A2Qf 3IF8A 3VMIA 2JIPA 1Q862 2Q51A 2IZ3A 2JA8I 1YJ9Z 2OZKA 3J81f 1KRLA 1RO0A 2JA7I 2K5RA 1JWHC 2NAPA 3S1NI 2V8JA 3CCQ1 3CMAZ 4A3GI 2JUBA 3MZLB 5D1PA 3VTNA 2HU9A 4A3DI 3I4MI 5A2Qb 3NDJA 4NBAA 1USPA 2RBLA 2E2HI 1YIJ1 3HKZA 5D1OB 1TWHI 2F4OA 3NDIA 2K3RA 1JJ2Z 4E32A 3CME1 3VMGA 4E2ZA 2V8KA 3T4NB 5IP7I 2JIRA 3HOUI 3CC4Z 1QVFY 5FLXf 1FDIA 2V3VA 3RZOI 2RT9A 3VB9A 3GTJI 4E31A 2RPRA 3G6E1 4DK1A 2E2II 4NBCA 4S1TA 3IX0A 2NVYI 2VF1A 3CQZI 4E2WA 1N8R1 3F3PC 1X3ZA 4DQYB 2R92I 3CCJ1 2VPWA 2E2JI 2JIOA 4RVFA 2IZ4A 3GTLI 3CCLZ 1RQFA 2V8IA 1P9NA 1TWCI 3K7AI 3G4SZ 3S1MI 3GTOI 1Q861 2HF1A 1VQ5Z 3CMEZ 4A3II 1NP6A 2VUGA 2OOXB 2RHBA 4MD9A 1M1K2 2NVQI 4NBFA 1VQ8Z 1Z01A 1Y1WI 5C3EI 4RS4A 1TWGI 1K8A1 5LL6f 2QLVB 1YI2Z 3S14I 2DE6A 1JJ2Y 3GTPI 3HOXI 5C4XI 1QF8A 3G6EZ 4E30A 2AYDA 1VQ41 2I3CA 1Z03A 2M48A 3H3VJ 1TFIA 2PK7A 1VQ71 3PO3S 2Y0SA 2KPIA 3S1RI 2WAQA 1VQLZ 3CC41 1Y1VI 3CD6Z 3H0GI 4MONA 1QXFA 3ESWA 2QKDA 4XX2A 2W03A 3P5JB 1VQ9Z 4QTUA 3IFUA 1AA6A 1K8A2 4DGLA 4A3FI 4MD7A 2LEXA 1L1OC 3FKII 1YJN1 4MRIA 1RLYA 4MD8A 3BG1B 3FQMA 1Z02A 3TDHB 2W04A 1PFTA 1VQMZ 3CCL1 4BBRI 1VQ4Z 4MH4A 1USPB 3J80f 1Q811 1VQPZ 4BXXI 2JNYA 3G4S1 3NH8A 1KC82 1VQ7Z 1VQ51 3M4OI 3JAMb 1VQN1 2G2KA 3RZDI 4RV9A 1VQ81 2QREB 4NBGA 3S16I 1M1K1 3CC71 1K9M2 2QR1B 1VQKZ 1YI21 1DL6A 3GTMS 4X6AI 2RIQA 2QA4Z 3I4NI 2LFUA 1YUAA 2PM9A 3J80b 4CL1A 2QRDB 3CCU1 1YJNZ 2VUMI 1TWFI 1N2FA 2GTIA 4E33A 1YITZ 3I55Z 2OTL1 1WJ2A 1WIIA 3I561 1Q812 1K732 1VQL1 1NUIA 1S721 3S17I 2DE7A 1Q7Y2 3CD61 3QWUA 2F4MA 2JMOA 4A3LI 2JS4A 3NFZA 1ZB9A 1KD12 3D9XA 2GTHA 1VQ91 3GTGI 3KIFA 5T64A 1VQNZ 4NOZA 1X0TA 3IR7A 2BJOA 2OOYB 4NB8A 3S15I 2E9HA 2P3YA 1W2BZ 2Q4ZA 4NBDA 1YJWZ 3CCV1 3CCSZ 3S1QI 2NVTI 2JA6I 3Q87A 1RNIA 4TNUA 1WW9A 3CC7Z 4RVHA 4BY7I 2VPXA
chains in the Genus database with same CATH topology
2ZAEB 2R6MA 4HGZA 3FQQA 1I50I 3LUSA 1VQM1 3VMHA 2LIYA 3CCUZ 1VQP1 1YHQ1 1TWAI 4A3KI 1SFOI 2JA5I 3MZKB 2OTLZ 3MONA 2M6NA 3CC2Z 3I56Z 3S2DI 4BY1I 2P28A 1KC81 3CCR1 1S72Z 1I6HI 4NBBA 1Q822 4NBHA 4RVGA 5C44I 1VQK1 2WB1A 2QA41 4A93I 1K9M1 3GTKI 3HOZI 2O53A 1YUKA 3S2HI 3JAMf 2DE5A 3CCVZ 1QYPA 5C4JI 2OTJZ 1YIT1 3EERA 3I551 2QEX1 1VQ6Z 1Y1VS 2PMZA 2YU9I 1S7MA 1RO2A 3BG0B 4AYBA 4EWCA 2JR6A 1W2BY 3GTQI 3CCE1 4A3JI 3HOYI 2GU2A 3F3FC 1YHQZ 1K731 1M902 4BBSI 3PO2I 1Q7Y1 2O4HA 1ML8A 1KD11 1NJI2 3CCRZ 3CXCY 1YJW1 3CCS1 4Y52I 1QVGZ 3GTMI 1ZB8A 2H85A 5D1OA 5IT9f 5T67A 1KQSZ 4MXUA 3GCFA 2R7ZI 3GKQA 3J81b 5AN9F 1LQLA 3CCMZ 3NH5A 5IP9I 3CPWZ 4A3BI 1VQO1 2QRCB 2J6AA 2QEXZ 3CC21 4NH1C 1K83I 3OW2Z 3HOVI 5IT9b 3CCEZ 1WCMI 4HH4A 2EGTA 3NH4A 1Q821 1VLAA 3CCQZ 2KI7B 2B63I 3HOWI 4E2YA 5T6BA 4E2XA 3G711 1X3WA 2YADA 3M3YI 4NFRA 3EEDA 1ZH1A 3U50C 1RO4A 2OTJ1 4NBEA 5FLXb 1YIJZ 1VQ61 2NVXI 5CM2M 1YJ91 3CXCZ 2AKLA 4HGYA 1I3QI 3PO3I 4A3CI 3KIHA 1QVGY 4NB9A 1VQOZ 1R9TI 1KQSY 3CMA1 3D6WA 1M901 4A3EI 4QTTA 4Y7NI 3J7A4 1NJI1 3CPWY 1QVFZ 1N8R2 3I07A 3TE5B 2R93I 3CCM1 3G71Z 4RVDA 3CCJZ 3OW2Y 4A3MI 5FLMI 5A2Qf 3IF8A 3VMIA 1Q862 2Q51A 2IZ3A 2JA8I 1YJ9Z 2OZKA 3J81f 1KRLA 1RO0A 2JA7I 2K5RA 1JWHC 3S1NI 2V8JA 3CCQ1 3CMAZ 4A3GI 2JUBA 3MZLB 5D1PA 3VTNA 2HU9A 4A3DI 3I4MI 5A2Qb 3NDJA 4NBAA 1USPA 2RBLA 2E2HI 1YIJ1 3HKZA 5D1OB 1TWHI 2F4OA 3NDIA 2K3RA 1JJ2Z 4E32A 3CME1 3VMGA 4E2ZA 2V8KA 3T4NB 5IP7I 3HOUI 3CC4Z 1QVFY 5FLXf 3RZOI 2RT9A 3VB9A 3GTJI 4E31A 2RPRA 3G6E1 4DK1A 2E2II 4NBCA 4S1TA 3IX0A 2NVYI 2VF1A 3CQZI 4E2WA 1N8R1 3F3PC 1X3ZA 4DQYB 2R92I 3CCJ1 2E2JI 4RVFA 2IZ4A 3GTLI 3CCLZ 1RQFA 2V8IA 1P9NA 1TWCI 3K7AI 3G4SZ 3S1MI 3GTOI 1Q861 2HF1A 1VQ5Z 3CMEZ 4A3II 1NP6A 2VUGA 2OOXB 2RHBA 4MD9A 1M1K2 2NVQI 4NBFA 1VQ8Z 1Z01A 1Y1WI 5C3EI 4RS4A 1TWGI 1K8A1 5LL6f 2QLVB 1YI2Z 3S14I 2DE6A 1JJ2Y 3GTPI 3HOXI 5C4XI 1QF8A 3G6EZ 4E30A 1VQ41 2I3CA 1Z03A 2M48A 3H3VJ 1TFIA 2PK7A 1VQ71 3PO3S 2Y0SA 2KPIA 3S1RI 2WAQA 1VQLZ 3CC41 1Y1VI 3CD6Z 3H0GI 4MONA 3ESWA 2QKDA 4XX2A 2W03A 3P5JB 1VQ9Z 4QTUA 3IFUA 1K8A2 4DGLA 4A3FI 4MD7A 1L1OC 3FKII 1YJN1 4MRIA 1RLYA 4MD8A 3BG1B 3FQMA 1Z02A 3TDHB 2W04A 1PFTA 1VQMZ 3CCL1 4BBRI 1VQ4Z 4MH4A 1USPB 3J80f 1Q811 1VQPZ 4BXXI 2JNYA 3G4S1 3NH8A 1KC82 1VQ7Z 1VQ51 3M4OI 3JAMb 1VQN1 2G2KA 3RZDI 4RV9A 1VQ81 2QREB 4NBGA 3S16I 1M1K1 3CC71 1K9M2 2QR1B 1VQKZ 1YI21 1DL6A 3GTMS 4X6AI 2RIQA 2QA4Z 3I4NI 2LFUA 1YUAA 2PM9A 3J80b 4CL1A 2QRDB 3CCU1 1YJNZ 2VUMI 1TWFI 1N2FA 2GTIA 4E33A 1YITZ 3I55Z 2OTL1 1WIIA 3I561 1Q812 1K732 1VQL1 1NUIA 1S721 3S17I 2DE7A 1Q7Y2 3CD61 3QWUA 2F4MA 2JMOA 4A3LI 2JS4A 3NFZA 1ZB9A 1KD12 3D9XA 2GTHA 1VQ91 3GTGI 3KIFA 5T64A 1VQNZ 4NOZA 1X0TA 2BJOA 2OOYB 4NB8A 3S15I 2E9HA 2P3YA 1W2BZ 2Q4ZA 4NBDA 1YJWZ 3CCV1 3CCSZ 3S1QI 2NVTI 2JA6I 3Q87A 1RNIA 4TNUA 1WW9A 3CC7Z 4RVHA 4BY7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Z;  1YIJ 1;  3CCE Z;  1VQ9 Z;  1VQM 1;  3CCU Z;  1K8A 2;  1Q82 1;  1VQP 1;  3CCQ Z;  1YHQ 1;  1JJ2 Z;  3CME 1;  1YJN 1;  3G71 1;  2OTL Z;  3CC4 Z;  3CC2 Z;  3I56 Z;  1KC8 1;  3CCR 1;  1QVF Y;  2OTJ 1;  1S72 Z;  1YIJ Z;  1Q82 2;  1VQ6 1;  1VQM Z;  3CCL 1;  1VQK 1;  1VQ4 Z;  1YJ9 1;  1Q81 1;  1VQP Z;  3CXC Z;  2QA4 1;  3G6E 1;  3G4S 1;  1KC8 2;  1K9M 1;  1VQ7 Z;  1VQ5 1;  1QVG Y;  1VQO Z;  1VQN 1;  3CCV Z;  1KQS Y;  3CMA 1;  1N8R 1;  1VQ8 1;  2OTJ Z;  1M90 1;  3CCJ 1;  1YIT 1;  3I55 1;  2QEX 1;  1M1K 1;  1VQ6 Z;  3CC7 1;  1K9M 2;  3CCL Z;  1VQK Z;  1YI2 1;  1NJI 1;  2QA4 Z;  3G4S Z;  3CPW Y;  1W2B Y;  1Q86 1;  3CCE 1;  1QVF Z;  1N8R 2;  1VQ5 Z;  1YHQ Z;  1K73 1;  1M90 2;  3CME Z;  1Q7Y 1;  3CCM 1;  3CCU 1;  1YJN Z;  3G71 Z;  1M1K 2;  1VQ8 Z;  3CCJ Z;  3OW2 Y;  1YIT Z;  1KD1 1;  1NJI 2;  1K8A 1;  3I55 Z;  3CCR Z;  2OTL 1;  3CXC Y;  3I56 1;  1YJW 1;  1Q86 2;  3CCS 1;  1Q81 2;  1YI2 Z;  1QVG Z;  1K73 2;  1VQL 1;  1S72 1;  1JJ2 Y;  1KQS Z;  1Q7Y 2;  3CD6 1;  1YJ9 Z;  3G6E Z;  1VQ4 1;  1KD1 2;  3CCM Z;  1VQ9 1;  1VQ7 1;  1VQN Z;  3CCQ 1;  3CMA Z;  3CPW Z;  1W2B Z;  1VQO 1;  1YJW Z;  3CCV 1;  3CCS Z;  2QEX Z;  1VQL Z;  3CC4 1;  3CC2 1;  3CC7 Z;  3CD6 Z; 
#chains in the Genus database with same CATH topology
 2ZAE B;  2R6M A;  4HGZ A;  3FQQ A;  1I50 I;  3LUS A;  1VQM 1;  3VMH A;  2LIY A;  3CCU Z;  1VQP 1;  1YHQ 1;  1TWA I;  4A3K I;  1SFO I;  2E7Z A;  2JA5 I;  3MZK B;  2OTL Z;  3MON A;  2M6N A;  3CC2 Z;  3I56 Z;  3S2D I;  4BY1 I;  2P28 A;  1KC8 1;  3CCR 1;  1S72 Z;  1I6H I;  1WZN A;  4NBB A;  1Q82 2;  4NBH A;  4RVG A;  2JIQ A;  5C44 I;  1VQK 1;  2WB1 A;  2QA4 1;  4A93 I;  1K9M 1;  3GTK I;  3HOZ I;  2O53 A;  1YUK A;  3S2H I;  3JAM f;  2DE5 A;  3CCV Z;  1QYP A;  5C4J I;  2OTJ Z;  1YIT 1;  1Q16 A;  3EER A;  3I55 1;  2QEX 1;  1VQ6 Z;  1Y1V S;  2PMZ A;  2YU9 I;  1S7M A;  1RO2 A;  3BG0 B;  4AYB A;  4EWC A;  2JR6 A;  1W2B Y;  3GTQ I;  3CCE 1;  4A3J I;  3HOY I;  2GU2 A;  3F3F C;  1YHQ Z;  1K73 1;  1M90 2;  4BBS I;  3PO2 I;  1Q7Y 1;  2O4H A;  1ML8 A;  1KD1 1;  1NJI 2;  3CCR Z;  3CXC Y;  1YJW 1;  3CCS 1;  4Y52 I;  1QVG Z;  3GTM I;  1ZB8 A;  2H85 A;  5D1O A;  2IV2 X;  5T67 A;  5IT9 f;  1KQS Z;  4MXU A;  3GCF A;  2R7Z I;  3GKQ A;  3J81 b;  5AN9 F;  1LQL A;  3CCM Z;  1FDO A;  3NH5 A;  5IP9 I;  2JIM A;  3CPW Z;  4A3B I;  1VQO 1;  2QRC B;  2J6A A;  2QEX Z;  3CC2 1;  4NH1 C;  2VPZ A;  1K83 I;  3OW2 Z;  1SIW A;  3HOV I;  5IT9 b;  3CCE Z;  1WCM I;  4HH4 A;  2EGT A;  3NH4 A;  1Q82 1;  1VLA A;  3CCQ Z;  2KI7 B;  2B63 I;  3HOW I;  4E2Y A;  5T6B A;  4E2X A;  3G71 1;  1X3W A;  2YAD A;  3M3Y I;  2V45 A;  4NFR A;  3EED A;  3D2L A;  1ZH1 A;  3U50 C;  1RO4 A;  2OTJ 1;  4NBE A;  5FLX b;  1YIJ Z;  1VQ6 1;  2VPY A;  2NVX I;  5CM2 M;  1YJ9 1;  3CXC Z;  2AKL A;  4HGY A;  1I3Q I;  3PO3 I;  4A3C I;  3KIH A;  1QVG Y;  4NB9 A;  1VQO Z;  1R9T I;  1KQS Y;  3CMA 1;  3D6W A;  1M90 1;  4A3E I;  4QTT A;  4Y7N I;  3J7A 4;  1Y8C A;  1NJI 1;  3CPW Y;  1QVF Z;  1N8R 2;  3I07 A;  3TE5 B;  2R93 I;  3CCM 1;  3G71 Z;  4RVD A;  3CCJ Z;  3OW2 Y;  4A3M I;  5FLM I;  5A2Q f;  3IF8 A;  3VMI A;  2JIP A;  1Q86 2;  2Q51 A;  2IZ3 A;  2JA8 I;  1YJ9 Z;  2OZK A;  3J81 f;  1KRL A;  1RO0 A;  2JA7 I;  2K5R A;  1JWH C;  2NAP A;  3S1N I;  2V8J A;  3CCQ 1;  3CMA Z;  4A3G I;  2JUB A;  3MZL B;  5D1P A;  3VTN A;  2HU9 A;  4A3D I;  3I4M I;  5A2Q b;  3NDJ A;  4NBA A;  1USP A;  2RBL A;  2E2H I;  1YIJ 1;  3HKZ A;  5D1O B;  1TWH I;  2F4O A;  3NDI A;  2K3R A;  1JJ2 Z;  4E32 A;  3CME 1;  3VMG A;  4E2Z A;  2V8K A;  3T4N B;  5IP7 I;  2JIR A;  3HOU I;  3CC4 Z;  1QVF Y;  5FLX f;  1FDI A;  2V3V A;  3RZO I;  2RT9 A;  3VB9 A;  3GTJ I;  4E31 A;  2RPR A;  3G6E 1;  4DK1 A;  2E2I I;  4NBC A;  4S1T A;  3IX0 A;  2NVY I;  2VF1 A;  3CQZ I;  4E2W A;  1N8R 1;  3F3P C;  1X3Z A;  4DQY B;  2R92 I;  3CCJ 1;  2VPW A;  2E2J I;  2JIO A;  4RVF A;  2IZ4 A;  3GTL I;  3CCL Z;  1RQF A;  2V8I A;  1P9N A;  1TWC I;  3K7A I;  3G4S Z;  3S1M I;  3GTO I;  1Q86 1;  2HF1 A;  1VQ5 Z;  3CME Z;  4A3I I;  1NP6 A;  2VUG A;  2OOX B;  2RHB A;  4MD9 A;  1M1K 2;  2NVQ I;  4NBF A;  1VQ8 Z;  1Z01 A;  1Y1W I;  5C3E I;  4RS4 A;  1TWG I;  1K8A 1;  5LL6 f;  2QLV B;  1YI2 Z;  3S14 I;  2DE6 A;  1JJ2 Y;  3GTP I;  3HOX I;  5C4X I;  1QF8 A;  3G6E Z;  4E30 A;  2AYD A;  1VQ4 1;  2I3C A;  1Z03 A;  2M48 A;  3H3V J;  1TFI A;  2PK7 A;  1VQ7 1;  3PO3 S;  2Y0S A;  2KPI A;  3S1R I;  2WAQ A;  1VQL Z;  3CC4 1;  1Y1V I;  3CD6 Z;  3H0G I;  4MON A;  1QXF A;  3ESW A;  2QKD A;  4XX2 A;  2W03 A;  3P5J B;  1VQ9 Z;  4QTU A;  3IFU A;  1AA6 A;  1K8A 2;  4DGL A;  4A3F I;  4MD7 A;  2LEX A;  1L1O C;  3FKI I;  1YJN 1;  4MRI A;  1RLY A;  4MD8 A;  3BG1 B;  3FQM A;  1Z02 A;  3TDH B;  2W04 A;  1PFT A;  1VQM Z;  3CCL 1;  4BBR I;  1VQ4 Z;  4MH4 A;  1USP B;  3J80 f;  1Q81 1;  1VQP Z;  4BXX I;  2JNY A;  3G4S 1;  3NH8 A;  1KC8 2;  1VQ7 Z;  1VQ5 1;  3M4O I;  3JAM b;  1VQN 1;  2G2K A;  3RZD I;  4RV9 A;  1VQ8 1;  2QRE B;  4NBG A;  3S16 I;  1M1K 1;  3CC7 1;  1K9M 2;  2QR1 B;  1VQK Z;  1YI2 1;  1DL6 A;  3GTM S;  4X6A I;  2RIQ A;  2QA4 Z;  3I4N I;  2LFU A;  1YUA A;  2PM9 A;  3J80 b;  4CL1 A;  2QRD B;  3CCU 1;  1YJN Z;  2VUM I;  1TWF I;  1N2F A;  2GTI A;  4E33 A;  1YIT Z;  3I55 Z;  2OTL 1;  1WJ2 A;  1WII A;  3I56 1;  1Q81 2;  1K73 2;  1VQL 1;  1NUI A;  1S72 1;  3S17 I;  2DE7 A;  1Q7Y 2;  3CD6 1;  3QWU A;  2F4M A;  2JMO A;  4A3L I;  2JS4 A;  3NFZ A;  1ZB9 A;  1KD1 2;  3D9X A;  2GTH A;  1VQ9 1;  3GTG I;  3KIF A;  5T64 A;  1VQN Z;  4NOZ A;  1X0T A;  3IR7 A;  2BJO A;  2OOY B;  4NB8 A;  3S15 I;  2E9H A;  2P3Y A;  1W2B Z;  2Q4Z A;  4NBD A;  1YJW Z;  3CCV 1;  3CCS Z;  3S1Q I;  2NVT I;  2JA6 I;  3Q87 A;  1RNI A;  4TNU A;  1WW9 A;  3CC7 Z;  4RVH A;  4BY7 I;  2VPX A; 
#chains in the Genus database with same CATH homology
 2ZAE B;  2R6M A;  4HGZ A;  3FQQ A;  1I50 I;  3LUS A;  1VQM 1;  3VMH A;  2LIY A;  3CCU Z;  1VQP 1;  1YHQ 1;  1TWA I;  4A3K I;  1SFO I;  2JA5 I;  3MZK B;  2OTL Z;  3MON A;  2M6N A;  3CC2 Z;  3I56 Z;  3S2D I;  4BY1 I;  2P28 A;  1KC8 1;  3CCR 1;  1S72 Z;  1I6H I;  4NBB A;  1Q82 2;  4NBH A;  4RVG A;  5C44 I;  1VQK 1;  2WB1 A;  2QA4 1;  4A93 I;  1K9M 1;  3GTK I;  3HOZ I;  2O53 A;  1YUK A;  3S2H I;  3JAM f;  2DE5 A;  3CCV Z;  1QYP A;  5C4J I;  2OTJ Z;  1YIT 1;  3EER A;  3I55 1;  2QEX 1;  1VQ6 Z;  1Y1V S;  2PMZ A;  2YU9 I;  1S7M A;  1RO2 A;  3BG0 B;  4AYB A;  4EWC A;  2JR6 A;  1W2B Y;  3GTQ I;  3CCE 1;  4A3J I;  3HOY I;  2GU2 A;  3F3F C;  1YHQ Z;  1K73 1;  1M90 2;  4BBS I;  3PO2 I;  1Q7Y 1;  2O4H A;  1ML8 A;  1KD1 1;  1NJI 2;  3CCR Z;  3CXC Y;  1YJW 1;  3CCS 1;  4Y52 I;  1QVG Z;  3GTM I;  1ZB8 A;  2H85 A;  5D1O A;  5IT9 f;  5T67 A;  1KQS Z;  4MXU A;  3GCF A;  2R7Z I;  3GKQ A;  3J81 b;  5AN9 F;  1LQL A;  3CCM Z;  3NH5 A;  5IP9 I;  3CPW Z;  4A3B I;  1VQO 1;  2QRC B;  2J6A A;  2QEX Z;  3CC2 1;  4NH1 C;  1K83 I;  3OW2 Z;  3HOV I;  5IT9 b;  3CCE Z;  1WCM I;  4HH4 A;  2EGT A;  3NH4 A;  1Q82 1;  1VLA A;  3CCQ Z;  2KI7 B;  2B63 I;  3HOW I;  4E2Y A;  5T6B A;  4E2X A;  3G71 1;  1X3W A;  2YAD A;  3M3Y I;  4NFR A;  3EED A;  1ZH1 A;  3U50 C;  1RO4 A;  2OTJ 1;  4NBE A;  5FLX b;  1YIJ Z;  1VQ6 1;  2NVX I;  5CM2 M;  1YJ9 1;  3CXC Z;  2AKL A;  4HGY A;  1I3Q I;  3PO3 I;  4A3C I;  3KIH A;  1QVG Y;  4NB9 A;  1VQO Z;  1R9T I;  1KQS Y;  3CMA 1;  3D6W A;  1M90 1;  4A3E I;  4QTT A;  4Y7N I;  3J7A 4;  1NJI 1;  3CPW Y;  1QVF Z;  1N8R 2;  3I07 A;  3TE5 B;  2R93 I;  3CCM 1;  3G71 Z;  4RVD A;  3CCJ Z;  3OW2 Y;  4A3M I;  5FLM I;  5A2Q f;  3IF8 A;  3VMI A;  1Q86 2;  2Q51 A;  2IZ3 A;  2JA8 I;  1YJ9 Z;  2OZK A;  3J81 f;  1KRL A;  1RO0 A;  2JA7 I;  2K5R A;  1JWH C;  3S1N I;  2V8J A;  3CCQ 1;  3CMA Z;  4A3G I;  2JUB A;  3MZL B;  5D1P A;  3VTN A;  2HU9 A;  4A3D I;  3I4M I;  5A2Q b;  3NDJ A;  4NBA A;  1USP A;  2RBL A;  2E2H I;  1YIJ 1;  3HKZ A;  5D1O B;  1TWH I;  2F4O A;  3NDI A;  2K3R A;  1JJ2 Z;  4E32 A;  3CME 1;  3VMG A;  4E2Z A;  2V8K A;  3T4N B;  5IP7 I;  3HOU I;  3CC4 Z;  1QVF Y;  5FLX f;  3RZO I;  2RT9 A;  3VB9 A;  3GTJ I;  4E31 A;  2RPR A;  3G6E 1;  4DK1 A;  2E2I I;  4NBC A;  4S1T A;  3IX0 A;  2NVY I;  2VF1 A;  3CQZ I;  4E2W A;  1N8R 1;  3F3P C;  1X3Z A;  4DQY B;  2R92 I;  3CCJ 1;  2E2J I;  4RVF A;  2IZ4 A;  3GTL I;  3CCL Z;  1RQF A;  2V8I A;  1P9N A;  1TWC I;  3K7A I;  3G4S Z;  3S1M I;  3GTO I;  1Q86 1;  2HF1 A;  1VQ5 Z;  3CME Z;  4A3I I;  1NP6 A;  2VUG A;  2OOX B;  2RHB A;  4MD9 A;  1M1K 2;  2NVQ I;  4NBF A;  1VQ8 Z;  1Z01 A;  1Y1W I;  5C3E I;  4RS4 A;  1TWG I;  1K8A 1;  5LL6 f;  2QLV B;  1YI2 Z;  3S14 I;  2DE6 A;  1JJ2 Y;  3GTP I;  3HOX I;  5C4X I;  1QF8 A;  3G6E Z;  4E30 A;  1VQ4 1;  2I3C A;  1Z03 A;  2M48 A;  3H3V J;  1TFI A;  2PK7 A;  1VQ7 1;  3PO3 S;  2Y0S A;  2KPI A;  3S1R I;  2WAQ A;  1VQL Z;  3CC4 1;  1Y1V I;  3CD6 Z;  3H0G I;  4MON A;  3ESW A;  2QKD A;  4XX2 A;  2W03 A;  3P5J B;  1VQ9 Z;  4QTU A;  3IFU A;  1K8A 2;  4DGL A;  4A3F I;  4MD7 A;  1L1O C;  3FKI I;  1YJN 1;  4MRI A;  1RLY A;  4MD8 A;  3BG1 B;  3FQM A;  1Z02 A;  3TDH B;  2W04 A;  1PFT A;  1VQM Z;  3CCL 1;  4BBR I;  1VQ4 Z;  4MH4 A;  1USP B;  3J80 f;  1Q81 1;  1VQP Z;  4BXX I;  2JNY A;  3G4S 1;  3NH8 A;  1KC8 2;  1VQ7 Z;  1VQ5 1;  3M4O I;  3JAM b;  1VQN 1;  2G2K A;  3RZD I;  4RV9 A;  1VQ8 1;  2QRE B;  4NBG A;  3S16 I;  1M1K 1;  3CC7 1;  1K9M 2;  2QR1 B;  1VQK Z;  1YI2 1;  1DL6 A;  3GTM S;  4X6A I;  2RIQ A;  2QA4 Z;  3I4N I;  2LFU A;  1YUA A;  2PM9 A;  3J80 b;  4CL1 A;  2QRD B;  3CCU 1;  1YJN Z;  2VUM I;  1TWF I;  1N2F A;  2GTI A;  4E33 A;  1YIT Z;  3I55 Z;  2OTL 1;  1WII A;  3I56 1;  1Q81 2;  1K73 2;  1VQL 1;  1NUI A;  1S72 1;  3S17 I;  2DE7 A;  1Q7Y 2;  3CD6 1;  3QWU A;  2F4M A;  2JMO A;  4A3L I;  2JS4 A;  3NFZ A;  1ZB9 A;  1KD1 2;  3D9X A;  2GTH A;  1VQ9 1;  3GTG I;  3KIF A;  5T64 A;  1VQN Z;  4NOZ A;  1X0T A;  2BJO A;  2OOY B;  4NB8 A;  3S15 I;  2E9H A;  2P3Y A;  1W2B Z;  2Q4Z A;  4NBD A;  1YJW Z;  3CCV 1;  3CCS Z;  3S1Q I;  2NVT I;  2JA6 I;  3Q87 A;  1RNI A;  4TNU A;  1WW9 A;  3CC7 Z;  4RVH A;  4BY7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...