3CC21

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc2100
3CCS1 3OW2Y 3CCRZ 1YJ91 3CCVZ 1N8R1 1VQN1 1VQ8Z 3CC2Z 2QEXZ 3G4S1 3CCMZ 1VQP1 1VQ7Z 3CPWZ 1W2BY 1YHQZ 3CCU1 2QA4Z 1K9M1 1M901 1JJ2Y 3I56Z 1NJI1 3CD61 3CXCZ 1VQM1 2OTL1 2OTJ1 3CCLZ 1YI2Z 3CCEZ 1K8A1 1KD11 3I551 3G6EZ 3CCR1 3CMAZ 1Q7Y2 3CME1 1KQSZ 1VQLZ 3CC4Z 3CC21 1VQ4Z 2QEX1 1M1K1 1YIJZ 1KC82 1YHQ1 1VQ5Z 3CC71 1Q862 1VQKZ 1VQ61 3CCJZ 1VQO1 1N8R2 3G71Z 3CCQZ 1QVGZ 1S72Z 1YJWZ 1QVFZ 1Q822 3CCSZ 1M902 1VQL1 3CCV1 1YJ9Z 1K731 1NJI2 3OW2Z 1VQ81 1Q812 3CPWY 3CCM1 1VQ71 1VQPZ 3CCUZ 2QA41 1YITZ 1K8A2 1KD12 1Q7Y1 1VQ9Z 3I561 3CXCY 1W2BZ 1YJNZ 3G711 1JJ2Z 3CD6Z 1M1K2 1VQMZ 1S721 2OTLZ 3CCL1 1YI21 3CCE1 1KQSY 1Q861 3G6E1 3I55Z 3CMA1 1K9M2 3CMEZ 3CC41 1VQ41 1VQNZ 1YIJ1 3G4SZ 1Q821 1YIT1 1VQ91 1VQ51 1YJN1 3CC7Z 1VQK1 1QVGY 1VQ6Z 1K732 3CCJ1 1Q811 1VQOZ 3CCQ1 1QVFY 1KC81 1YJW1 2OTJZ
chains in the Genus database with same CATH superfamily
1Z02A 1K83I 2V3VA 2H85A 2AKLA 4MXUA 4E2XA 2JA8I 1VQP1 1VQ7Z 3CPWZ 1WCMI 1W2BY 2QA4Z 3GTKI 4DK1A 1NJI1 4A3DI 3TE5B 1VQM1 1Y1WI 3Q87A 1TWCI 3GCFA 3IX0A 5A2Qf 3IF8A 4NBHA 2JIMA 2QRCB 1K8A1 2IZ4A 3HOXI 3G6EZ 1AA6A 1YUKA 3CMAZ 1I3QI 1NUIA 3GTMS 3CME1 3CC4Z 4RV9A 3CC21 2QEX1 1JWHC 1X0TA 2GTHA 1VQ5Z 1WW9A 1L1OC 1VQ61 3NH8A 2NVXI 2HU9A 4NFRA 4QTUA 2RPRA 1RNIA 3JAMb 4MD8A 3S16I 3HOVI 1M902 2W03A 2R7ZI 4X6AI 2NAPA 2K5RA 3CPWY 3NH5A 3S17I 3J7A4 3BG1B 3J81b 1VQ71 2KPIA 5IT9f 2QA41 1KD12 2QLVB 1VQ9Z 2VPXA 1YJNZ 2JA6I 3NDJA 2QRDB 1SIWA 2OZKA 4NBFA 5T6BA 3G6E1 3CMA1 2JIPA 3GTOI 4HH4A 2OOXB 3CC41 1I6HI 2VPYA 3HOUI 4BXXI 1TWGI 2VUMI 1Q821 1YIT1 1VQ51 3CC7Z 3HOWI 3P5JB 1QXFA 2M6NA 3K7AI 1ZB9A 4A3II 4MONA 2IV2X 1PFTA 2E2JI 4BBSI 1Z03A 1WIIA 2RIQA 4NOZA 3FQQA 3MONA 1N8R1 1VQN1 4BY1I 1QF8A 3CC2Z 2QEXZ 2E9HA 3MZKB 3FKII 1R9TI 1K9M1 4A3GI 4E31A 3GTMI 5IP9I 4BBRI 2E2HI 2IZ3A 3GTJI 5FLXf 2BJOA 1Q7Y2 5C4JI 1YIJZ 3NFZA 2GTIA 4AYBA 1KC82 1YHQ1 2DE5A 4NBBA 3NDIA 3CC71 1Q862 2I3CA 3CCJZ 3D2LA 3RZDI 1QVGZ 1S7MA 1YJWZ 3T4NB 3CCSZ 3M4OI 2PM9A 1VQL1 4NBAA 1NJI2 1LQLA 1Y8CA 3S14I 2OOYB 2V45A 2JA5I 2NVYI 3CCUZ 1YITZ 1K8A2 4A3LI 5T67A 3S1MI 3J80f 1JJ2Z 1S721 2OTLZ 4A3MI 2B63I 3S2HI 5A2Qb 3J81f 4A3KI 1VQNZ 1YIJ1 1TFIA 4A3BI 2Q51A 1RO4A 2NVQI 2R92I 1RLYA 2KI7B 2QKDA 1QVGY 3IFUA 2NVTI 1X3WA 3KIFA 3CCJ1 2HF1A 4HGYA 4NBCA 2P3YA 4XX2A 2JIQA 1YJW1 1RO2A 2WAQA 2VUGA 3CCS1 2QREB 4DQYB 3EERA 1TWHI 3FQMA 3D9XA 3H0GI 1KRLA 1YHQZ 3CCU1 1WZNA 1FDOA 2DE6A 1JJ2Y 1YUAA 5AN9F 2JS4A 3I56Z 3M3YI 3EEDA 5C44I 4Y7NI 3KIHA 3CXCZ 1ZH1A 3HKZA 3TDHB 2OTL1 2OTJ1 5C3EI 3VMIA 4MRIA 4S1TA 4A93I 3CCR1 2RT9A 5LL6f 1KQSZ 1VQLZ 1VQ4Z 4E2WA 3HOZI 2V8IA 1M1K1 3GTLI 3GTPI 4RS4A 3S1QI 2RBLA 2V8KA 1I50I 1N8R2 2JUBA 2J6AA 3CCQZ 3VMHA 2LIYA 5FLMI 1RO0A 1S72Z 3D6WA 1QVFZ 2JNYA 4RVGA 3PO3I 1YJ9Z 1K731 2P28A 1TWAI 5CM2M 3OW2Z 1Q812 2F4MA 1Y1VS 4HGZA 4Y52I 4A3CI 2VPWA 1Q7Y1 3I561 2O4HA 3CXCY 2JA7I 3G711 4BY7I 3CD6Z 2PMZA 4NB8A 3VMGA 3MZLB 2K3RA 2W04A 1Q861 1KQSY 3GTQI 3I55Z 4RVHA 2JIOA 4MH4A 5FLXb 1P9NA 1VQ41 4DGLA 2EGTA 4E30A 3PO3S 1NP6A 1VQOZ 3I4NI 3JAMf 3CCQ1 1N2FA 2YADA 1QYPA 4A3EI 1QVFY 2V8JA 2OTJZ 5IP7I 3OW2Y 4MD7A 3CCRZ 1YJ91 3CCVZ 2JIRA 4NB9A 3QWUA 1Z01A 5D1OB 2JMOA 1VQ8Z 3IR7A 4NBEA 3GTGI 1USPB 3G4S1 3CCMZ 3PO2I 2R93I 2AYDA 5T64A 1M901 3LUSA 2VPZA 2E7ZA 3CD61 3NH4A 4E33A 1WJ2A 3J80b 2Q4ZA 2LEXA 1DL6A 3CCLZ 4RVDA 1YI2Z 3CCEZ 3I4MI 1KD11 3I551 1Q16A 4E2ZA 4EWCA 1ML8A 2G2KA 4A3JI 4E2YA 2GU2A 1VQKZ 4NBDA 3RZOI 5IT9b 4QTTA 4MD9A 1VQO1 3G71Z 2O53A 2M48A 1Y1VI 2E2II 3ESWA 2ZAEB 2DE7A 1Q822 3S2DI 2RHBA 2PK7A 2VF1A 3CCV1 1VQ81 3BG0B 3F3PC 3VB9A 1RQFA 2JR6A 3CCM1 3S15I 1SFOI 3F3FC 3GKQA 4A3FI 1VQPZ 3S1NI 3CQZI 1W2BZ 3S1RI 1FDIA 4NBGA 1M1K2 1VQMZ 4E32A 5D1PA 3CCL1 1YI21 3CCE1 4TNUA 1K9M2 3CMEZ 2R6MA 3I07A 2YU9I 4CL1A 2LFUA 5D1OA 3G4SZ 2QR1B 5C4XI 3VTNA 1VQ91 1USPA 3U50C 1ZB8A 1YJN1 1TWFI 1VQK1 3H3VJ 1VQ6Z 4NH1C 1K732 1Q811 1VLAA 2F4OA 2WB1A 3HOYI 4RVFA 1KC81 2Y0SA 1X3ZA
chains in the Genus database with same CATH topology
1Z02A 1K83I 2H85A 2AKLA 4MXUA 4E2XA 2JA8I 1VQP1 1VQ7Z 3CPWZ 1WCMI 1W2BY 2QA4Z 3GTKI 4DK1A 1NJI1 4A3DI 3TE5B 1VQM1 1Y1WI 3Q87A 1TWCI 3GCFA 3IX0A 5A2Qf 3IF8A 4NBHA 2QRCB 1K8A1 2IZ4A 3HOXI 3G6EZ 1YUKA 3CMAZ 1I3QI 1NUIA 3GTMS 3CME1 3CC4Z 4RV9A 3CC21 2QEX1 1JWHC 1X0TA 2GTHA 1VQ5Z 1WW9A 1L1OC 1VQ61 3NH8A 2NVXI 2HU9A 4NFRA 4QTUA 2RPRA 1RNIA 3JAMb 4MD8A 3S16I 3HOVI 1M902 2W03A 2R7ZI 4X6AI 2K5RA 3CPWY 3NH5A 3S17I 3J7A4 3BG1B 3J81b 1VQ71 2KPIA 5IT9f 2QA41 1KD12 2QLVB 1VQ9Z 1YJNZ 2JA6I 3NDJA 2QRDB 2OZKA 4NBFA 5T6BA 3G6E1 3CMA1 3GTOI 4HH4A 2OOXB 3CC41 1I6HI 3HOUI 4BXXI 1TWGI 2VUMI 1Q821 1YIT1 1VQ51 3CC7Z 3HOWI 3P5JB 2M6NA 3K7AI 1ZB9A 4A3II 4MONA 1PFTA 2E2JI 4BBSI 1Z03A 1WIIA 2RIQA 4NOZA 3FQQA 3MONA 1N8R1 1VQN1 4BY1I 1QF8A 3CC2Z 2QEXZ 2E9HA 3MZKB 3FKII 1R9TI 1K9M1 4A3GI 4E31A 3GTMI 5IP9I 4BBRI 2E2HI 2IZ3A 3GTJI 5FLXf 2BJOA 1Q7Y2 5C4JI 1YIJZ 3NFZA 2GTIA 4AYBA 1KC82 1YHQ1 2DE5A 4NBBA 3NDIA 3CC71 1Q862 2I3CA 3CCJZ 3RZDI 1QVGZ 1S7MA 1YJWZ 3T4NB 3CCSZ 3M4OI 2PM9A 1VQL1 4NBAA 1NJI2 1LQLA 3S14I 2OOYB 2JA5I 2NVYI 3CCUZ 1YITZ 1K8A2 4A3LI 5T67A 3S1MI 3J80f 1JJ2Z 1S721 2OTLZ 4A3MI 2B63I 3S2HI 5A2Qb 3J81f 4A3KI 1VQNZ 1YIJ1 1TFIA 4A3BI 2Q51A 1RO4A 2NVQI 2R92I 1RLYA 2KI7B 2QKDA 1QVGY 3IFUA 2NVTI 1X3WA 3KIFA 3CCJ1 2HF1A 4HGYA 4NBCA 2P3YA 4XX2A 1YJW1 1RO2A 2WAQA 2VUGA 3CCS1 2QREB 4DQYB 3EERA 1TWHI 3FQMA 3D9XA 3H0GI 1KRLA 1YHQZ 3CCU1 2DE6A 1JJ2Y 1YUAA 5AN9F 2JS4A 3I56Z 3M3YI 3EEDA 5C44I 4Y7NI 3KIHA 3CXCZ 1ZH1A 3HKZA 3TDHB 2OTL1 2OTJ1 5C3EI 3VMIA 4MRIA 4S1TA 4A93I 3CCR1 2RT9A 5LL6f 1KQSZ 1VQLZ 1VQ4Z 4E2WA 3HOZI 2V8IA 1M1K1 3GTLI 3GTPI 4RS4A 3S1QI 2RBLA 2V8KA 1I50I 1N8R2 2JUBA 2J6AA 3CCQZ 3VMHA 2LIYA 5FLMI 1RO0A 1S72Z 3D6WA 1QVFZ 2JNYA 4RVGA 3PO3I 1YJ9Z 1K731 2P28A 1TWAI 5CM2M 3OW2Z 1Q812 2F4MA 1Y1VS 4HGZA 4Y52I 4A3CI 1Q7Y1 3I561 2O4HA 3CXCY 2JA7I 3G711 4BY7I 3CD6Z 2PMZA 4NB8A 3VMGA 3MZLB 2K3RA 2W04A 1Q861 1KQSY 3GTQI 3I55Z 4RVHA 4MH4A 5FLXb 1P9NA 1VQ41 4DGLA 2EGTA 4E30A 3PO3S 1NP6A 1VQOZ 3I4NI 3JAMf 3CCQ1 1N2FA 4A3EI 1QYPA 2YADA 1QVFY 2V8JA 2OTJZ 5IP7I 3OW2Y 4MD7A 3CCRZ 1YJ91 3CCVZ 4NB9A 3QWUA 1Z01A 5D1OB 2JMOA 1VQ8Z 4NBEA 3GTGI 1USPB 3G4S1 3CCMZ 3PO2I 2R93I 5T64A 1M901 3LUSA 3CD61 3NH4A 4E33A 3J80b 2Q4ZA 1DL6A 3CCLZ 4RVDA 1YI2Z 3CCEZ 3I4MI 1KD11 3I551 4E2ZA 4EWCA 1ML8A 2G2KA 4A3JI 4E2YA 2GU2A 1VQKZ 4NBDA 3RZOI 5IT9b 4QTTA 4MD9A 1VQO1 3G71Z 2O53A 2M48A 1Y1VI 2E2II 3ESWA 2ZAEB 2DE7A 1Q822 3S2DI 2RHBA 2PK7A 2VF1A 3CCV1 1VQ81 3BG0B 3F3PC 3VB9A 1RQFA 2JR6A 3CCM1 3S15I 1SFOI 3F3FC 3GKQA 4A3FI 1VQPZ 3S1NI 3CQZI 1W2BZ 3S1RI 4NBGA 1M1K2 1VQMZ 4E32A 5D1PA 3CCL1 1YI21 3CCE1 4TNUA 1K9M2 3CMEZ 2R6MA 3I07A 2YU9I 4CL1A 2LFUA 5D1OA 3G4SZ 2QR1B 5C4XI 3VTNA 1VQ91 1USPA 3U50C 1ZB8A 1YJN1 1TWFI 1VQK1 3H3VJ 1VQ6Z 4NH1C 1K732 1Q811 1VLAA 2F4OA 2WB1A 3HOYI 4RVFA 1KC81 2Y0SA 1X3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS 1;  3OW2 Y;  3CCR Z;  1YJ9 1;  3CCV Z;  1N8R 1;  1VQN 1;  1VQ8 Z;  3CC2 Z;  2QEX Z;  3G4S 1;  3CCM Z;  1VQP 1;  1VQ7 Z;  3CPW Z;  1W2B Y;  1YHQ Z;  3CCU 1;  2QA4 Z;  1K9M 1;  1M90 1;  1JJ2 Y;  3I56 Z;  1NJI 1;  3CD6 1;  3CXC Z;  1VQM 1;  2OTL 1;  2OTJ 1;  3CCL Z;  1YI2 Z;  3CCE Z;  1K8A 1;  1KD1 1;  3I55 1;  3G6E Z;  3CCR 1;  3CMA Z;  1Q7Y 2;  3CME 1;  1KQS Z;  1VQL Z;  3CC4 Z;  3CC2 1;  1VQ4 Z;  2QEX 1;  1M1K 1;  1YIJ Z;  1KC8 2;  1YHQ 1;  1VQ5 Z;  3CC7 1;  1Q86 2;  1VQK Z;  1VQ6 1;  3CCJ Z;  1VQO 1;  1N8R 2;  3G71 Z;  3CCQ Z;  1QVG Z;  1S72 Z;  1YJW Z;  1QVF Z;  1Q82 2;  3CCS Z;  1M90 2;  1VQL 1;  3CCV 1;  1YJ9 Z;  1K73 1;  1NJI 2;  3OW2 Z;  1VQ8 1;  1Q81 2;  3CPW Y;  3CCM 1;  1VQ7 1;  1VQP Z;  3CCU Z;  2QA4 1;  1YIT Z;  1K8A 2;  1KD1 2;  1Q7Y 1;  1VQ9 Z;  3I56 1;  3CXC Y;  1W2B Z;  1YJN Z;  3G71 1;  1JJ2 Z;  3CD6 Z;  1M1K 2;  1VQM Z;  1S72 1;  2OTL Z;  3CCL 1;  1YI2 1;  3CCE 1;  1KQS Y;  1Q86 1;  3G6E 1;  3I55 Z;  3CMA 1;  1K9M 2;  3CME Z;  3CC4 1;  1VQ4 1;  1VQN Z;  1YIJ 1;  3G4S Z;  1Q82 1;  1YIT 1;  1VQ9 1;  1VQ5 1;  1YJN 1;  3CC7 Z;  1VQK 1;  1QVG Y;  1VQ6 Z;  1K73 2;  3CCJ 1;  1Q81 1;  1VQO Z;  3CCQ 1;  1QVF Y;  1KC8 1;  1YJW 1;  2OTJ Z; 
#chains in the Genus database with same CATH topology
 1Z02 A;  1K83 I;  2V3V A;  2H85 A;  2AKL A;  4MXU A;  4E2X A;  2JA8 I;  1VQP 1;  1VQ7 Z;  3CPW Z;  1WCM I;  1W2B Y;  2QA4 Z;  3GTK I;  4DK1 A;  1NJI 1;  4A3D I;  3TE5 B;  1VQM 1;  1Y1W I;  3Q87 A;  1TWC I;  3GCF A;  3IX0 A;  5A2Q f;  3IF8 A;  4NBH A;  2JIM A;  2QRC B;  1K8A 1;  2IZ4 A;  3HOX I;  3G6E Z;  1AA6 A;  1YUK A;  3CMA Z;  1I3Q I;  1NUI A;  3GTM S;  3CME 1;  3CC4 Z;  4RV9 A;  3CC2 1;  2QEX 1;  1JWH C;  1X0T A;  2GTH A;  1VQ5 Z;  1WW9 A;  1L1O C;  1VQ6 1;  3NH8 A;  2NVX I;  2HU9 A;  4NFR A;  4QTU A;  2RPR A;  1RNI A;  3JAM b;  4MD8 A;  3S16 I;  3HOV I;  1M90 2;  2W03 A;  2R7Z I;  4X6A I;  2NAP A;  2K5R A;  3CPW Y;  3NH5 A;  3S17 I;  3J7A 4;  3BG1 B;  3J81 b;  1VQ7 1;  2KPI A;  5IT9 f;  2QA4 1;  1KD1 2;  2QLV B;  1VQ9 Z;  2VPX A;  1YJN Z;  2JA6 I;  3NDJ A;  2QRD B;  1SIW A;  2OZK A;  4NBF A;  5T6B A;  3G6E 1;  3CMA 1;  2JIP A;  3GTO I;  4HH4 A;  2OOX B;  3CC4 1;  1I6H I;  2VPY A;  3HOU I;  4BXX I;  1TWG I;  2VUM I;  1Q82 1;  1YIT 1;  1VQ5 1;  3CC7 Z;  3HOW I;  3P5J B;  1QXF A;  2M6N A;  3K7A I;  1ZB9 A;  4A3I I;  4MON A;  2IV2 X;  1PFT A;  2E2J I;  4BBS I;  1Z03 A;  1WII A;  2RIQ A;  4NOZ A;  3FQQ A;  3MON A;  1N8R 1;  1VQN 1;  4BY1 I;  1QF8 A;  3CC2 Z;  2QEX Z;  2E9H A;  3MZK B;  3FKI I;  1R9T I;  1K9M 1;  4A3G I;  4E31 A;  3GTM I;  5IP9 I;  4BBR I;  2E2H I;  2IZ3 A;  3GTJ I;  5FLX f;  2BJO A;  1Q7Y 2;  5C4J I;  1YIJ Z;  3NFZ A;  2GTI A;  4AYB A;  1KC8 2;  1YHQ 1;  2DE5 A;  4NBB A;  3NDI A;  3CC7 1;  1Q86 2;  2I3C A;  3CCJ Z;  3D2L A;  3RZD I;  1QVG Z;  1S7M A;  1YJW Z;  3T4N B;  3CCS Z;  3M4O I;  2PM9 A;  1VQL 1;  4NBA A;  1NJI 2;  1LQL A;  1Y8C A;  3S14 I;  2OOY B;  2V45 A;  2JA5 I;  2NVY I;  3CCU Z;  1YIT Z;  1K8A 2;  4A3L I;  5T67 A;  3S1M I;  3J80 f;  1JJ2 Z;  1S72 1;  2OTL Z;  4A3M I;  2B63 I;  3S2H I;  5A2Q b;  3J81 f;  4A3K I;  1VQN Z;  1YIJ 1;  1TFI A;  4A3B I;  2Q51 A;  1RO4 A;  2NVQ I;  2R92 I;  1RLY A;  2KI7 B;  2QKD A;  1QVG Y;  3IFU A;  2NVT I;  1X3W A;  3KIF A;  3CCJ 1;  2HF1 A;  4HGY A;  4NBC A;  2P3Y A;  4XX2 A;  2JIQ A;  1YJW 1;  1RO2 A;  2WAQ A;  2VUG A;  3CCS 1;  2QRE B;  4DQY B;  3EER A;  1TWH I;  3FQM A;  3D9X A;  3H0G I;  1KRL A;  1YHQ Z;  3CCU 1;  1WZN A;  1FDO A;  2DE6 A;  1JJ2 Y;  1YUA A;  5AN9 F;  2JS4 A;  3I56 Z;  3M3Y I;  3EED A;  5C44 I;  4Y7N I;  3KIH A;  3CXC Z;  1ZH1 A;  3HKZ A;  3TDH B;  2OTL 1;  2OTJ 1;  5C3E I;  3VMI A;  4MRI A;  4S1T A;  4A93 I;  3CCR 1;  2RT9 A;  5LL6 f;  1KQS Z;  1VQL Z;  1VQ4 Z;  4E2W A;  3HOZ I;  2V8I A;  1M1K 1;  3GTL I;  3GTP I;  4RS4 A;  3S1Q I;  2RBL A;  2V8K A;  1I50 I;  1N8R 2;  2JUB A;  2J6A A;  3CCQ Z;  3VMH A;  2LIY A;  5FLM I;  1RO0 A;  1S72 Z;  3D6W A;  1QVF Z;  2JNY A;  4RVG A;  3PO3 I;  1YJ9 Z;  1K73 1;  2P28 A;  1TWA I;  5CM2 M;  3OW2 Z;  1Q81 2;  2F4M A;  1Y1V S;  4HGZ A;  4Y52 I;  4A3C I;  2VPW A;  1Q7Y 1;  3I56 1;  2O4H A;  3CXC Y;  2JA7 I;  3G71 1;  4BY7 I;  3CD6 Z;  2PMZ A;  4NB8 A;  3VMG A;  3MZL B;  2K3R A;  2W04 A;  1Q86 1;  1KQS Y;  3GTQ I;  3I55 Z;  4RVH A;  2JIO A;  4MH4 A;  5FLX b;  1P9N A;  1VQ4 1;  4DGL A;  2EGT A;  4E30 A;  3PO3 S;  1NP6 A;  1VQO Z;  3I4N I;  3JAM f;  3CCQ 1;  1N2F A;  2YAD A;  1QYP A;  4A3E I;  1QVF Y;  2V8J A;  2OTJ Z;  5IP7 I;  3OW2 Y;  4MD7 A;  3CCR Z;  1YJ9 1;  3CCV Z;  2JIR A;  4NB9 A;  3QWU A;  1Z01 A;  5D1O B;  2JMO A;  1VQ8 Z;  3IR7 A;  4NBE A;  3GTG I;  1USP B;  3G4S 1;  3CCM Z;  3PO2 I;  2R93 I;  2AYD A;  5T64 A;  1M90 1;  3LUS A;  2VPZ A;  2E7Z A;  3CD6 1;  3NH4 A;  4E33 A;  1WJ2 A;  3J80 b;  2Q4Z A;  2LEX A;  1DL6 A;  3CCL Z;  4RVD A;  1YI2 Z;  3CCE Z;  3I4M I;  1KD1 1;  3I55 1;  1Q16 A;  4E2Z A;  4EWC A;  1ML8 A;  2G2K A;  4A3J I;  4E2Y A;  2GU2 A;  1VQK Z;  4NBD A;  3RZO I;  5IT9 b;  4QTT A;  4MD9 A;  1VQO 1;  3G71 Z;  2O53 A;  2M48 A;  1Y1V I;  2E2I I;  3ESW A;  2ZAE B;  2DE7 A;  1Q82 2;  3S2D I;  2RHB A;  2PK7 A;  2VF1 A;  3CCV 1;  1VQ8 1;  3BG0 B;  3F3P C;  3VB9 A;  1RQF A;  2JR6 A;  3CCM 1;  3S15 I;  1SFO I;  3F3F C;  3GKQ A;  4A3F I;  1VQP Z;  3S1N I;  3CQZ I;  1W2B Z;  3S1R I;  1FDI A;  4NBG A;  1M1K 2;  1VQM Z;  4E32 A;  5D1P A;  3CCL 1;  1YI2 1;  3CCE 1;  4TNU A;  1K9M 2;  3CME Z;  2R6M A;  3I07 A;  2YU9 I;  4CL1 A;  2LFU A;  5D1O A;  3G4S Z;  2QR1 B;  5C4X I;  3VTN A;  1VQ9 1;  1USP A;  3U50 C;  1ZB8 A;  1YJN 1;  1TWF I;  1VQK 1;  3H3V J;  1VQ6 Z;  4NH1 C;  1K73 2;  1Q81 1;  1VLA A;  2F4O A;  2WB1 A;  3HOY I;  4RVF A;  1KC8 1;  2Y0S A;  1X3Z A; 
#chains in the Genus database with same CATH homology
 1Z02 A;  1K83 I;  2H85 A;  2AKL A;  4MXU A;  4E2X A;  2JA8 I;  1VQP 1;  1VQ7 Z;  3CPW Z;  1WCM I;  1W2B Y;  2QA4 Z;  3GTK I;  4DK1 A;  1NJI 1;  4A3D I;  3TE5 B;  1VQM 1;  1Y1W I;  3Q87 A;  1TWC I;  3GCF A;  3IX0 A;  5A2Q f;  3IF8 A;  4NBH A;  2QRC B;  1K8A 1;  2IZ4 A;  3HOX I;  3G6E Z;  1YUK A;  3CMA Z;  1I3Q I;  1NUI A;  3GTM S;  3CME 1;  3CC4 Z;  4RV9 A;  3CC2 1;  2QEX 1;  1JWH C;  1X0T A;  2GTH A;  1VQ5 Z;  1WW9 A;  1L1O C;  1VQ6 1;  3NH8 A;  2NVX I;  2HU9 A;  4NFR A;  4QTU A;  2RPR A;  1RNI A;  3JAM b;  4MD8 A;  3S16 I;  3HOV I;  1M90 2;  2W03 A;  2R7Z I;  4X6A I;  2K5R A;  3CPW Y;  3NH5 A;  3S17 I;  3J7A 4;  3BG1 B;  3J81 b;  1VQ7 1;  2KPI A;  5IT9 f;  2QA4 1;  1KD1 2;  2QLV B;  1VQ9 Z;  1YJN Z;  2JA6 I;  3NDJ A;  2QRD B;  2OZK A;  4NBF A;  5T6B A;  3G6E 1;  3CMA 1;  3GTO I;  4HH4 A;  2OOX B;  3CC4 1;  1I6H I;  3HOU I;  4BXX I;  1TWG I;  2VUM I;  1Q82 1;  1YIT 1;  1VQ5 1;  3CC7 Z;  3HOW I;  3P5J B;  2M6N A;  3K7A I;  1ZB9 A;  4A3I I;  4MON A;  1PFT A;  2E2J I;  4BBS I;  1Z03 A;  1WII A;  2RIQ A;  4NOZ A;  3FQQ A;  3MON A;  1N8R 1;  1VQN 1;  4BY1 I;  1QF8 A;  3CC2 Z;  2QEX Z;  2E9H A;  3MZK B;  3FKI I;  1R9T I;  1K9M 1;  4A3G I;  4E31 A;  3GTM I;  5IP9 I;  4BBR I;  2E2H I;  2IZ3 A;  3GTJ I;  5FLX f;  2BJO A;  1Q7Y 2;  5C4J I;  1YIJ Z;  3NFZ A;  2GTI A;  4AYB A;  1KC8 2;  1YHQ 1;  2DE5 A;  4NBB A;  3NDI A;  3CC7 1;  1Q86 2;  2I3C A;  3CCJ Z;  3RZD I;  1QVG Z;  1S7M A;  1YJW Z;  3T4N B;  3CCS Z;  3M4O I;  2PM9 A;  1VQL 1;  4NBA A;  1NJI 2;  1LQL A;  3S14 I;  2OOY B;  2JA5 I;  2NVY I;  3CCU Z;  1YIT Z;  1K8A 2;  4A3L I;  5T67 A;  3S1M I;  3J80 f;  1JJ2 Z;  1S72 1;  2OTL Z;  4A3M I;  2B63 I;  3S2H I;  5A2Q b;  3J81 f;  4A3K I;  1VQN Z;  1YIJ 1;  1TFI A;  4A3B I;  2Q51 A;  1RO4 A;  2NVQ I;  2R92 I;  1RLY A;  2KI7 B;  2QKD A;  1QVG Y;  3IFU A;  2NVT I;  1X3W A;  3KIF A;  3CCJ 1;  2HF1 A;  4HGY A;  4NBC A;  2P3Y A;  4XX2 A;  1YJW 1;  1RO2 A;  2WAQ A;  2VUG A;  3CCS 1;  2QRE B;  4DQY B;  3EER A;  1TWH I;  3FQM A;  3D9X A;  3H0G I;  1KRL A;  1YHQ Z;  3CCU 1;  2DE6 A;  1JJ2 Y;  1YUA A;  5AN9 F;  2JS4 A;  3I56 Z;  3M3Y I;  3EED A;  5C44 I;  4Y7N I;  3KIH A;  3CXC Z;  1ZH1 A;  3HKZ A;  3TDH B;  2OTL 1;  2OTJ 1;  5C3E I;  3VMI A;  4MRI A;  4S1T A;  4A93 I;  3CCR 1;  2RT9 A;  5LL6 f;  1KQS Z;  1VQL Z;  1VQ4 Z;  4E2W A;  3HOZ I;  2V8I A;  1M1K 1;  3GTL I;  3GTP I;  4RS4 A;  3S1Q I;  2RBL A;  2V8K A;  1I50 I;  1N8R 2;  2JUB A;  2J6A A;  3CCQ Z;  3VMH A;  2LIY A;  5FLM I;  1RO0 A;  1S72 Z;  3D6W A;  1QVF Z;  2JNY A;  4RVG A;  3PO3 I;  1YJ9 Z;  1K73 1;  2P28 A;  1TWA I;  5CM2 M;  3OW2 Z;  1Q81 2;  2F4M A;  1Y1V S;  4HGZ A;  4Y52 I;  4A3C I;  1Q7Y 1;  3I56 1;  2O4H A;  3CXC Y;  2JA7 I;  3G71 1;  4BY7 I;  3CD6 Z;  2PMZ A;  4NB8 A;  3VMG A;  3MZL B;  2K3R A;  2W04 A;  1Q86 1;  1KQS Y;  3GTQ I;  3I55 Z;  4RVH A;  4MH4 A;  5FLX b;  1P9N A;  1VQ4 1;  4DGL A;  2EGT A;  4E30 A;  3PO3 S;  1NP6 A;  1VQO Z;  3I4N I;  3JAM f;  3CCQ 1;  1N2F A;  4A3E I;  1QYP A;  2YAD A;  1QVF Y;  2V8J A;  2OTJ Z;  5IP7 I;  3OW2 Y;  4MD7 A;  3CCR Z;  1YJ9 1;  3CCV Z;  4NB9 A;  3QWU A;  1Z01 A;  5D1O B;  2JMO A;  1VQ8 Z;  4NBE A;  3GTG I;  1USP B;  3G4S 1;  3CCM Z;  3PO2 I;  2R93 I;  5T64 A;  1M90 1;  3LUS A;  3CD6 1;  3NH4 A;  4E33 A;  3J80 b;  2Q4Z A;  1DL6 A;  3CCL Z;  4RVD A;  1YI2 Z;  3CCE Z;  3I4M I;  1KD1 1;  3I55 1;  4E2Z A;  4EWC A;  1ML8 A;  2G2K A;  4A3J I;  4E2Y A;  2GU2 A;  1VQK Z;  4NBD A;  3RZO I;  5IT9 b;  4QTT A;  4MD9 A;  1VQO 1;  3G71 Z;  2O53 A;  2M48 A;  1Y1V I;  2E2I I;  3ESW A;  2ZAE B;  2DE7 A;  1Q82 2;  3S2D I;  2RHB A;  2PK7 A;  2VF1 A;  3CCV 1;  1VQ8 1;  3BG0 B;  3F3P C;  3VB9 A;  1RQF A;  2JR6 A;  3CCM 1;  3S15 I;  1SFO I;  3F3F C;  3GKQ A;  4A3F I;  1VQP Z;  3S1N I;  3CQZ I;  1W2B Z;  3S1R I;  4NBG A;  1M1K 2;  1VQM Z;  4E32 A;  5D1P A;  3CCL 1;  1YI2 1;  3CCE 1;  4TNU A;  1K9M 2;  3CME Z;  2R6M A;  3I07 A;  2YU9 I;  4CL1 A;  2LFU A;  5D1O A;  3G4S Z;  2QR1 B;  5C4X I;  3VTN A;  1VQ9 1;  1USP A;  3U50 C;  1ZB8 A;  1YJN 1;  1TWF I;  1VQK 1;  3H3V J;  1VQ6 Z;  4NH1 C;  1K73 2;  1Q81 1;  1VLA A;  2F4O A;  2WB1 A;  3HOY I;  4RVF A;  1KC8 1;  2Y0S A;  1X3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...