3K7AI

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
118
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEASPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 9
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI02
2DE7A 4NBCA 2B63I 2JA6I 2J6AA 4BY7I 4A3DI 2JA8I 4A3GI 3H0GI 3HOWI 4A3FI 3GCFA 1ZB8A 1ML8A 2JR6A 2NVTI 2R92I 2VUMI 1Y1VS 3M3YI 4NBBA 2JA7I 1TFIA 4NB9A 1QYPA 4NBGA 3S1NI 1R9TI 3I07A 1RO4A 1TWCI 3HOUI 4A3CI 1SFOI 3M4OI 3LUSA 2R93I 2JNYA 1Y1VI 2R7ZI 3GTOI 2NVYI 4BBSI 4NBEA 3HOXI 3S1RI 2E2HI 3GTKI 2NVXI 4A3II 3CQZI 3EERA 3H3VJ 3GTMI 4NB8A 3I4MI 3PO3I 3HOYI 2F4OA 1X3ZA 5C4XI 3PO3S 1USPA 3S1QI 3VB9A 5IP7I 1RLYA 1N2FA 1LQLA 3S16I 2PK7A 4X6AI 2YU9I 2HF1A 4A3KI 1I6HI 3S14I 3VMIA 4QTUA 5CM2M 1PFTA 3GTPI 1TWAI 5C3EI 4Y7NI 4QTTA 4A93I 1WCMI 2NVQI 1TWGI 3S15I 4BBRI 2RBLA 2KPIA 1DL6A 4BXXI 1YUAA 1Y1WI 4XX2A 3ESWA 1USPB 3S2HI 4NBHA 3U50C 1L1OC 5C44I 3GTGI 4A3EI 4A3JI 3RZDI 3I4NI 5FLMI 1ZB9A 1X3WA 2P3YA 4A3LI 3RZOI 4MH4A 2JA5I 2E2JI 3GTMS 3VMGA 3Q87A 3S2DI 4NBFA 5IP9I 1WW9A 3GTJI 3PO2I 3K7AI 4NOZA 5C4JI 2JS4A 4A3BI 4Y52I 2DE6A 3HOZI 1K83I 3S1MI 3GKQA 3VMHA 1NUIA 2F4MA 1I3QI 1TWFI 2DE5A 3GTQI 1VLAA 2BJOA 3FKII 4NBDA 3S17I 1TWHI 4A3MI 3GTLI 3D6WA 3HOVI 2AKLA 4NBAA 1I50I 2E2II 2K5RA 4BY1I
chains in the Genus database with same CATH superfamily
2B63I 1QVFY 2I3CA 3CCQZ 2JA6I 4BY7I 2V8JA 5A2Qb 1SIWA 1KC81 3GCFA 3HKZA 1ML8A 1Y1VS 3G6EZ 3M3YI 1VQ91 3J7A4 2WB1A 3S1NI 1RO2A 3I56Z 3I07A 1RO4A 1TWCI 3HOUI 2PMZA 4A3CI 1VQ51 3LUSA 3NH8A 2V8IA 3D2LA 1VQL1 1Y1VI 3HOXI 1KD11 3S1RI 3GTKI 4MRIA 2R6MA 3CQZI 1VQ9Z 3HOYI 2VPWA 2O4HA 1RLYA 3J81f 3CC71 1LQLA 4DGLA 1K9M1 4X6AI 3CC2Z 1X0TA 3MZLB 2RT9A 2HF1A 2V3VA 3I551 3S14I 1KRLA 4QTUA 1TWAI 1WZNA 4Y7NI 5C3EI 4QTTA 2ZAEB 2JIMA 3F3FC 1WCMI 1TWGI 4RVGA 5IT9f 1FDIA 1Y1WI 2H85A 4NH1C 4NBHA 3CD61 3CCVZ 1Q7Y1 3RZDI 1Q861 5D1OB 1RNIA 2P3YA 3CPWY 1KQSY 3RZOI 2JA5I 2E2JI 1QF8A 1K8A1 3NH4A 3J81b 3PO2I 3GTJI 3K7AI 4A3BI 4Y52I 4TNUA 3GKQA 3VMHA 3CCS1 1NUIA 1TWFI 2VPZA 1VLAA 1Q7Y2 4NBDA 4RV9A 1QVFZ 4HGZA 1VQNZ 1I50I 1P9NA 2DE7A 1RQFA 3CXCY 2AYDA 3JAMb 3I561 2JA8I 4A3GI 4A3FI 1VQ41 1ZB8A 2JR6A 2QRDB 5D1OA 5T6BA 4NBBA 1YJWZ 1Z01A 2LFUA 4NBGA 1YJ91 4E32A 3CCJZ 2RHBA 2OTJZ 5FLXb 2IZ4A 2OTLZ 1VQKZ 4BBSI 4NBEA 2JMOA 4A3II 2IV2X 1Y8CA 1NJI2 1VQ6Z 4AYBA 2M6NA 3I4MI 3CXCZ 3KIHA 3PO3I 1M902 1WJ2A 3FQQA 3IF8A 1X3ZA 3CCU1 1USPA 1ZH1A 3VB9A 5LL6f 3NDIA 2V8KA 2PK7A 3G4S1 1YIT1 2YU9I 1I6HI 5AN9F 2QRCB 2KI7B 1YIJZ 5T67A 3CCRZ 1VQ71 4MD7A 4S1TA 2OZKA 2V45A 3MONA 1YUAA 3CCMZ 4XX2A 3ESWA 3NDJA 1VQMZ 1N8R1 3NH5A 5C44I 3MZKB 1Q862 1VQPZ 1KQSZ 1ZB9A 1WIIA 2OOYB 3CCL1 1YJN1 4A3LI 3GTMS 1WW9A 2GTHA 4NOZA 1M1K1 5C4JI 5IT9b 2Y0SA 2PM9A 1K83I 4MXUA 2E9HA 3GTQI 3G6E1 3FKII 3IR7A 2VPXA 3G4SZ 3G711 3CCLZ 3S17I 1YI2Z 3D6WA 2HU9A 3CCV1 4NBAA 2E2II 1VQ7Z 4NBCA 2QA4Z 2GTIA 2J6AA 1VQOZ 3EEDA 2NVTI 2R92I 1K732 1YHQ1 1QYPA 1YI21 1VQM1 3IFUA 3OW2Z 2P28A 1N8R2 2W04A 2VPYA 3VTNA 3CPWZ 2R93I 2JNYA 2R7ZI 2NVYI 1K8A2 4MD8A 2NVXI 1YITZ 2VF1A 3JAMf 4MONA 3EERA 3H3VJ 2JIRA 2GU2A 4E2YA 3CCEZ 4NB8A 3GTMI 1YHQZ 3CMAZ 1KD12 1Q822 2F4OA 3TDHB 5C4XI 3PO3S 3S1QI 5IP7I 1VQ4Z 3CME1 1RO0A 3S16I 2OOXB 3CCQ1 4RVFA 3CC7Z 3VMIA 5CM2M 1VQ8Z 5FLXf 3GTPI 2QREB 3CCJ1 2NVQI 3BG0B 4EWCA 1USPB 1QVGY 1KC82 1VQP1 3U50C 2E7ZA 1K9M2 2QA41 1YIJ1 3GTGI 1NJI1 4A3EI 3P5JB 1YJNZ 5T64A 4A3JI 1Z02A 2QR1B 2IZ3A 3CCM1 1Q812 1Q811 4MH4A 1JJ2Z 3VMGA 4NBFA 3OW2Y 5IP9I 2LIYA 3G71Z 4RVDA 2QEXZ 3CMEZ 1VQK1 2JIQA 2F4MA 4RVHA 4E2ZA 2DE5A 1Q16A 1NP6A 4E2XA 1VQN1 1TWHI 3CC41 3TE5B 4E30A 2AKLA 4DK1A 3CCUZ 2LEXA 4BY1I 1AA6A 3CCR1 3CD6Z 1YUKA 3IX0A 4E33A 2QEX1 1JWHC 3I55Z 4A3DI 2YADA 1FDOA 3H0GI 3HOWI 2WAQA 1W2BZ 4RS4A 3NFZA 2VUMI 1YJW1 1W2BY 1QXFA 2JA7I 1TFIA 4NB9A 1R9TI 4CL1A 2JIPA 1SFOI 3M4OI 3CCSZ 3GTOI 3CCE1 1M901 2E2HI 2JIOA 2JUBA 1K731 2W03A 1VQ81 1S7MA 1VQO1 5D1PA 2QLVB 1N2FA 2RIQA 3F3PC 3D9XA 4A3KI 4E2WA 1Z03A 1PFTA 1S721 3T4NB 4DQYB 4A93I 3CC4Z 3S15I 4BBRI 1VQ61 2RBLA 2KPIA 1DL6A 4BXXI 3KIFA 1Q821 2K3RA 3S2HI 2Q4ZA 2Q51A 4E31A 1L1OC 2RPRA 2OTJ1 1VQ5Z 4HGYA 1JJ2Y 3J80b 4MD9A 3I4NI 5FLMI 2EGTA 1X3WA 3J80f 2G2KA 3BG1B 3Q87A 2O53A 3CMA1 3S2DI 2NAPA 5A2Qf 1YJ9Z 2QKDA 4HH4A 2JS4A 1QVGZ 2VUGA 2DE6A 3HOZI 3S1MI 4NFRA 1VQLZ 2OTL1 1I3QI 3QWUA 2BJOA 3FQMA 2M48A 4A3MI 3GTLI 3CC21 3HOVI 1M1K2 2K5RA 1S72Z
chains in the Genus database with same CATH topology
2B63I 1QVFY 2I3CA 3CCQZ 2JA6I 4BY7I 2V8JA 5A2Qb 1KC81 3GCFA 3HKZA 1ML8A 1Y1VS 3G6EZ 3M3YI 1VQ91 3J7A4 2WB1A 3S1NI 1RO2A 3I56Z 3I07A 1RO4A 1TWCI 3HOUI 2PMZA 4A3CI 1VQ51 3LUSA 3NH8A 2V8IA 1VQL1 1Y1VI 3HOXI 1KD11 3S1RI 3GTKI 4MRIA 2R6MA 3CQZI 1VQ9Z 3HOYI 2O4HA 1RLYA 3J81f 3CC71 1LQLA 4DGLA 1K9M1 4X6AI 1X0TA 3MZLB 3CC2Z 2RT9A 2HF1A 3I551 3S14I 1KRLA 4QTUA 1TWAI 5C3EI 4Y7NI 4QTTA 2ZAEB 3F3FC 1WCMI 1TWGI 4RVGA 5IT9f 1Y1WI 2H85A 4NH1C 4NBHA 3CD61 3CCVZ 1Q7Y1 3RZDI 1Q861 5D1OB 1RNIA 2P3YA 3CPWY 1KQSY 3RZOI 2JA5I 2E2JI 1QF8A 1K8A1 3NH4A 3J81b 3PO2I 3GTJI 3K7AI 4A3BI 4Y52I 4TNUA 3GKQA 3VMHA 3CCS1 1NUIA 1TWFI 1VLAA 1Q7Y2 4NBDA 4RV9A 1QVFZ 4HGZA 1VQNZ 1I50I 1P9NA 2DE7A 1RQFA 3CXCY 3JAMb 3I561 2JA8I 4A3GI 4A3FI 1VQ41 1ZB8A 2JR6A 2QRDB 5D1OA 5T6BA 4NBBA 1YJWZ 1Z01A 2LFUA 4NBGA 1YJ91 4E32A 3CCJZ 2RHBA 2OTJZ 5FLXb 2IZ4A 2OTLZ 1VQKZ 4BBSI 4NBEA 2JMOA 4A3II 1NJI2 1VQ6Z 4AYBA 2M6NA 3I4MI 3CXCZ 3KIHA 3PO3I 1M902 3FQQA 3IF8A 1X3ZA 3CCU1 1USPA 1ZH1A 3VB9A 5LL6f 3NDIA 2V8KA 2PK7A 3G4S1 1YIT1 2YU9I 1I6HI 5AN9F 2QRCB 2KI7B 1YIJZ 5T67A 3CCRZ 1VQ71 4MD7A 4S1TA 2OZKA 3MONA 1YUAA 3CCMZ 4XX2A 3ESWA 3NDJA 1VQMZ 1N8R1 3NH5A 5C44I 3MZKB 1Q862 1VQPZ 1KQSZ 1ZB9A 1WIIA 2OOYB 3CCL1 1YJN1 4A3LI 3GTMS 1WW9A 2GTHA 4NOZA 1M1K1 5C4JI 5IT9b 2Y0SA 2PM9A 1K83I 4MXUA 2E9HA 3GTQI 3G6E1 3FKII 3G4SZ 3G711 3CCLZ 3S17I 1YI2Z 3D6WA 2HU9A 3CCV1 4NBAA 2E2II 1VQ7Z 4NBCA 2QA4Z 2GTIA 2J6AA 1VQOZ 3EEDA 2NVTI 2R92I 1K732 1YHQ1 1QYPA 1YI21 1VQM1 3IFUA 3OW2Z 2P28A 1N8R2 2W04A 3VTNA 3CPWZ 2R93I 2JNYA 2R7ZI 2NVYI 1K8A2 4MD8A 2NVXI 1YITZ 2VF1A 3JAMf 4MONA 3EERA 3H3VJ 2GU2A 4E2YA 3CCEZ 4NB8A 3GTMI 1YHQZ 3CMAZ 1KD12 1Q822 2F4OA 3TDHB 5C4XI 3PO3S 3S1QI 5IP7I 1VQ4Z 3CME1 1RO0A 3S16I 2OOXB 3CCQ1 4RVFA 3CC7Z 3VMIA 5CM2M 1VQ8Z 5FLXf 3GTPI 2QREB 3CCJ1 2NVQI 3BG0B 4EWCA 1USPB 1QVGY 1KC82 1VQP1 3U50C 1K9M2 2QA41 1YIJ1 3GTGI 1NJI1 4A3EI 3P5JB 1YJNZ 5T64A 4A3JI 1Z02A 2QR1B 2IZ3A 3CCM1 1Q812 1Q811 4MH4A 1JJ2Z 3VMGA 4NBFA 3OW2Y 5IP9I 2LIYA 3G71Z 4RVDA 2QEXZ 3CMEZ 1VQK1 2F4MA 4RVHA 4E2ZA 2DE5A 1NP6A 4E2XA 1VQN1 1TWHI 3CC41 3TE5B 4E30A 2AKLA 4DK1A 3CCUZ 4BY1I 3CCR1 3CD6Z 1YUKA 3IX0A 4E33A 2QEX1 1JWHC 3I55Z 4A3DI 2YADA 3H0GI 3HOWI 2WAQA 1W2BZ 4RS4A 3NFZA 2VUMI 1YJW1 1W2BY 2JA7I 1TFIA 4NB9A 1R9TI 4CL1A 1SFOI 3M4OI 3CCSZ 3GTOI 3CCE1 1M901 2E2HI 2JUBA 1K731 2W03A 1VQ81 1S7MA 1VQO1 5D1PA 2QLVB 1N2FA 2RIQA 3F3PC 3D9XA 4A3KI 4E2WA 1Z03A 1PFTA 1S721 3T4NB 4DQYB 4A93I 3CC4Z 3S15I 4BBRI 1VQ61 2RBLA 2KPIA 1DL6A 4BXXI 3KIFA 1Q821 2K3RA 3S2HI 2Q4ZA 2Q51A 4E31A 1L1OC 2RPRA 2OTJ1 1VQ5Z 4HGYA 1JJ2Y 3J80b 4MD9A 3I4NI 5FLMI 2EGTA 1X3WA 3J80f 2G2KA 3BG1B 3Q87A 2O53A 3CMA1 3S2DI 5A2Qf 1YJ9Z 2QKDA 4HH4A 2JS4A 1QVGZ 2VUGA 2DE6A 3HOZI 3S1MI 4NFRA 1VQLZ 2OTL1 1I3QI 3QWUA 2BJOA 3FQMA 2M48A 4A3MI 3GTLI 3CC21 3HOVI 1M1K2 2K5RA 1S72Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE7 A;  4NBC A;  2B63 I;  2JA6 I;  2J6A A;  4BY7 I;  4A3D I;  2JA8 I;  4A3G I;  3H0G I;  3HOW I;  4A3F I;  3GCF A;  1ZB8 A;  1ML8 A;  2JR6 A;  2NVT I;  2R92 I;  2VUM I;  1Y1V S;  3M3Y I;  4NBB A;  2JA7 I;  1TFI A;  4NB9 A;  1QYP A;  4NBG A;  3S1N I;  1R9T I;  3I07 A;  1RO4 A;  1TWC I;  3HOU I;  4A3C I;  1SFO I;  3M4O I;  3LUS A;  2R93 I;  2JNY A;  1Y1V I;  2R7Z I;  3GTO I;  2NVY I;  4BBS I;  4NBE A;  3HOX I;  3S1R I;  2E2H I;  3GTK I;  2NVX I;  4A3I I;  3CQZ I;  3EER A;  3H3V J;  3GTM I;  4NB8 A;  3I4M I;  3PO3 I;  3HOY I;  2F4O A;  1X3Z A;  5C4X I;  3PO3 S;  1USP A;  3S1Q I;  3VB9 A;  5IP7 I;  1RLY A;  1N2F A;  1LQL A;  3S16 I;  2PK7 A;  4X6A I;  2YU9 I;  2HF1 A;  4A3K I;  1I6H I;  3S14 I;  3VMI A;  4QTU A;  5CM2 M;  1PFT A;  3GTP I;  1TWA I;  5C3E I;  4Y7N I;  4QTT A;  4A93 I;  1WCM I;  2NVQ I;  1TWG I;  3S15 I;  4BBR I;  2RBL A;  2KPI A;  1DL6 A;  4BXX I;  1YUA A;  1Y1W I;  4XX2 A;  3ESW A;  1USP B;  3S2H I;  4NBH A;  3U50 C;  1L1O C;  5C44 I;  3GTG I;  4A3E I;  4A3J I;  3RZD I;  3I4N I;  5FLM I;  1ZB9 A;  1X3W A;  2P3Y A;  4A3L I;  3RZO I;  4MH4 A;  2JA5 I;  2E2J I;  3GTM S;  3VMG A;  3Q87 A;  3S2D I;  4NBF A;  5IP9 I;  1WW9 A;  3GTJ I;  3PO2 I;  3K7A I;  4NOZ A;  5C4J I;  2JS4 A;  4A3B I;  4Y52 I;  2DE6 A;  3HOZ I;  1K83 I;  3S1M I;  3GKQ A;  3VMH A;  1NUI A;  2F4M A;  1I3Q I;  1TWF I;  2DE5 A;  3GTQ I;  1VLA A;  2BJO A;  3FKI I;  4NBD A;  3S17 I;  1TWH I;  4A3M I;  3GTL I;  3D6W A;  3HOV I;  2AKL A;  4NBA A;  1I50 I;  2E2I I;  2K5R A;  4BY1 I; 
#chains in the Genus database with same CATH topology
 2B63 I;  1QVF Y;  2I3C A;  3CCQ Z;  2JA6 I;  4BY7 I;  2V8J A;  5A2Q b;  1SIW A;  1KC8 1;  3GCF A;  3HKZ A;  1ML8 A;  1Y1V S;  3G6E Z;  3M3Y I;  1VQ9 1;  3J7A 4;  2WB1 A;  3S1N I;  1RO2 A;  3I56 Z;  3I07 A;  1RO4 A;  1TWC I;  3HOU I;  2PMZ A;  4A3C I;  1VQ5 1;  3LUS A;  3NH8 A;  2V8I A;  3D2L A;  1VQL 1;  1Y1V I;  3HOX I;  1KD1 1;  3S1R I;  3GTK I;  4MRI A;  2R6M A;  3CQZ I;  1VQ9 Z;  3HOY I;  2VPW A;  2O4H A;  1RLY A;  3J81 f;  3CC7 1;  1LQL A;  4DGL A;  1K9M 1;  4X6A I;  3CC2 Z;  1X0T A;  3MZL B;  2RT9 A;  2HF1 A;  2V3V A;  3I55 1;  3S14 I;  1KRL A;  4QTU A;  1TWA I;  1WZN A;  4Y7N I;  5C3E I;  4QTT A;  2ZAE B;  2JIM A;  3F3F C;  1WCM I;  1TWG I;  4RVG A;  5IT9 f;  1FDI A;  1Y1W I;  2H85 A;  4NH1 C;  4NBH A;  3CD6 1;  3CCV Z;  1Q7Y 1;  3RZD I;  1Q86 1;  5D1O B;  1RNI A;  2P3Y A;  3CPW Y;  1KQS Y;  3RZO I;  2JA5 I;  2E2J I;  1QF8 A;  1K8A 1;  3NH4 A;  3J81 b;  3PO2 I;  3GTJ I;  3K7A I;  4A3B I;  4Y52 I;  4TNU A;  3GKQ A;  3VMH A;  3CCS 1;  1NUI A;  1TWF I;  2VPZ A;  1VLA A;  1Q7Y 2;  4NBD A;  4RV9 A;  1QVF Z;  4HGZ A;  1VQN Z;  1I50 I;  1P9N A;  2DE7 A;  1RQF A;  3CXC Y;  2AYD A;  3JAM b;  3I56 1;  2JA8 I;  4A3G I;  4A3F I;  1VQ4 1;  1ZB8 A;  2JR6 A;  2QRD B;  5D1O A;  5T6B A;  4NBB A;  1YJW Z;  1Z01 A;  2LFU A;  4NBG A;  1YJ9 1;  4E32 A;  3CCJ Z;  2RHB A;  2OTJ Z;  5FLX b;  2IZ4 A;  2OTL Z;  1VQK Z;  4BBS I;  4NBE A;  2JMO A;  4A3I I;  2IV2 X;  1Y8C A;  1NJI 2;  1VQ6 Z;  4AYB A;  2M6N A;  3I4M I;  3CXC Z;  3KIH A;  3PO3 I;  1M90 2;  1WJ2 A;  3FQQ A;  3IF8 A;  1X3Z A;  3CCU 1;  1USP A;  1ZH1 A;  3VB9 A;  5LL6 f;  3NDI A;  2V8K A;  2PK7 A;  3G4S 1;  1YIT 1;  2YU9 I;  1I6H I;  5AN9 F;  2QRC B;  2KI7 B;  1YIJ Z;  5T67 A;  3CCR Z;  1VQ7 1;  4MD7 A;  4S1T A;  2OZK A;  2V45 A;  3MON A;  1YUA A;  3CCM Z;  4XX2 A;  3ESW A;  3NDJ A;  1VQM Z;  1N8R 1;  3NH5 A;  5C44 I;  3MZK B;  1Q86 2;  1VQP Z;  1KQS Z;  1ZB9 A;  1WII A;  2OOY B;  3CCL 1;  1YJN 1;  4A3L I;  3GTM S;  1WW9 A;  2GTH A;  4NOZ A;  1M1K 1;  5C4J I;  5IT9 b;  2Y0S A;  2PM9 A;  1K83 I;  4MXU A;  2E9H A;  3GTQ I;  3G6E 1;  3FKI I;  3IR7 A;  2VPX A;  3G4S Z;  3G71 1;  3CCL Z;  3S17 I;  1YI2 Z;  3D6W A;  2HU9 A;  3CCV 1;  4NBA A;  2E2I I;  1VQ7 Z;  4NBC A;  2QA4 Z;  2GTI A;  2J6A A;  1VQO Z;  3EED A;  2NVT I;  2R92 I;  1K73 2;  1YHQ 1;  1QYP A;  1YI2 1;  1VQM 1;  3IFU A;  3OW2 Z;  2P28 A;  1N8R 2;  2W04 A;  2VPY A;  3VTN A;  3CPW Z;  2R93 I;  2JNY A;  2R7Z I;  2NVY I;  1K8A 2;  4MD8 A;  2NVX I;  1YIT Z;  2VF1 A;  3JAM f;  4MON A;  3EER A;  3H3V J;  2JIR A;  2GU2 A;  4E2Y A;  3CCE Z;  4NB8 A;  3GTM I;  1YHQ Z;  3CMA Z;  1KD1 2;  1Q82 2;  2F4O A;  3TDH B;  5C4X I;  3PO3 S;  3S1Q I;  5IP7 I;  1VQ4 Z;  3CME 1;  1RO0 A;  3S16 I;  2OOX B;  3CCQ 1;  4RVF A;  3CC7 Z;  3VMI A;  5CM2 M;  1VQ8 Z;  5FLX f;  3GTP I;  2QRE B;  3CCJ 1;  2NVQ I;  3BG0 B;  4EWC A;  1USP B;  1QVG Y;  1KC8 2;  1VQP 1;  3U50 C;  2E7Z A;  1K9M 2;  2QA4 1;  1YIJ 1;  3GTG I;  1NJI 1;  4A3E I;  3P5J B;  1YJN Z;  5T64 A;  4A3J I;  1Z02 A;  2QR1 B;  2IZ3 A;  3CCM 1;  1Q81 2;  1Q81 1;  4MH4 A;  1JJ2 Z;  3VMG A;  4NBF A;  3OW2 Y;  5IP9 I;  2LIY A;  3G71 Z;  4RVD A;  2QEX Z;  3CME Z;  1VQK 1;  2JIQ A;  2F4M A;  4RVH A;  4E2Z A;  2DE5 A;  1Q16 A;  1NP6 A;  4E2X A;  1VQN 1;  1TWH I;  3CC4 1;  3TE5 B;  4E30 A;  2AKL A;  4DK1 A;  3CCU Z;  2LEX A;  4BY1 I;  1AA6 A;  3CCR 1;  3CD6 Z;  1YUK A;  3IX0 A;  4E33 A;  2QEX 1;  1JWH C;  3I55 Z;  4A3D I;  2YAD A;  1FDO A;  3H0G I;  3HOW I;  2WAQ A;  1W2B Z;  4RS4 A;  3NFZ A;  2VUM I;  1YJW 1;  1W2B Y;  1QXF A;  2JA7 I;  1TFI A;  4NB9 A;  1R9T I;  4CL1 A;  2JIP A;  1SFO I;  3M4O I;  3CCS Z;  3GTO I;  3CCE 1;  1M90 1;  2E2H I;  2JIO A;  2JUB A;  1K73 1;  2W03 A;  1VQ8 1;  1S7M A;  1VQO 1;  5D1P A;  2QLV B;  1N2F A;  2RIQ A;  3F3P C;  3D9X A;  4A3K I;  4E2W A;  1Z03 A;  1PFT A;  1S72 1;  3T4N B;  4DQY B;  4A93 I;  3CC4 Z;  3S15 I;  4BBR I;  1VQ6 1;  2RBL A;  2KPI A;  1DL6 A;  4BXX I;  3KIF A;  1Q82 1;  2K3R A;  3S2H I;  2Q4Z A;  2Q51 A;  4E31 A;  1L1O C;  2RPR A;  2OTJ 1;  1VQ5 Z;  4HGY A;  1JJ2 Y;  3J80 b;  4MD9 A;  3I4N I;  5FLM I;  2EGT A;  1X3W A;  3J80 f;  2G2K A;  3BG1 B;  3Q87 A;  2O53 A;  3CMA 1;  3S2D I;  2NAP A;  5A2Q f;  1YJ9 Z;  2QKD A;  4HH4 A;  2JS4 A;  1QVG Z;  2VUG A;  2DE6 A;  3HOZ I;  3S1M I;  4NFR A;  1VQL Z;  2OTL 1;  1I3Q I;  3QWU A;  2BJO A;  3FQM A;  2M48 A;  4A3M I;  3GTL I;  3CC2 1;  3HOV I;  1M1K 2;  2K5R A;  1S72 Z; 
#chains in the Genus database with same CATH homology
 2B63 I;  1QVF Y;  2I3C A;  3CCQ Z;  2JA6 I;  4BY7 I;  2V8J A;  5A2Q b;  1KC8 1;  3GCF A;  3HKZ A;  1ML8 A;  1Y1V S;  3G6E Z;  3M3Y I;  1VQ9 1;  3J7A 4;  2WB1 A;  3S1N I;  1RO2 A;  3I56 Z;  3I07 A;  1RO4 A;  1TWC I;  3HOU I;  2PMZ A;  4A3C I;  1VQ5 1;  3LUS A;  3NH8 A;  2V8I A;  1VQL 1;  1Y1V I;  3HOX I;  1KD1 1;  3S1R I;  3GTK I;  4MRI A;  2R6M A;  3CQZ I;  1VQ9 Z;  3HOY I;  2O4H A;  1RLY A;  3J81 f;  3CC7 1;  1LQL A;  4DGL A;  1K9M 1;  4X6A I;  1X0T A;  3MZL B;  3CC2 Z;  2RT9 A;  2HF1 A;  3I55 1;  3S14 I;  1KRL A;  4QTU A;  1TWA I;  5C3E I;  4Y7N I;  4QTT A;  2ZAE B;  3F3F C;  1WCM I;  1TWG I;  4RVG A;  5IT9 f;  1Y1W I;  2H85 A;  4NH1 C;  4NBH A;  3CD6 1;  3CCV Z;  1Q7Y 1;  3RZD I;  1Q86 1;  5D1O B;  1RNI A;  2P3Y A;  3CPW Y;  1KQS Y;  3RZO I;  2JA5 I;  2E2J I;  1QF8 A;  1K8A 1;  3NH4 A;  3J81 b;  3PO2 I;  3GTJ I;  3K7A I;  4A3B I;  4Y52 I;  4TNU A;  3GKQ A;  3VMH A;  3CCS 1;  1NUI A;  1TWF I;  1VLA A;  1Q7Y 2;  4NBD A;  4RV9 A;  1QVF Z;  4HGZ A;  1VQN Z;  1I50 I;  1P9N A;  2DE7 A;  1RQF A;  3CXC Y;  3JAM b;  3I56 1;  2JA8 I;  4A3G I;  4A3F I;  1VQ4 1;  1ZB8 A;  2JR6 A;  2QRD B;  5D1O A;  5T6B A;  4NBB A;  1YJW Z;  1Z01 A;  2LFU A;  4NBG A;  1YJ9 1;  4E32 A;  3CCJ Z;  2RHB A;  2OTJ Z;  5FLX b;  2IZ4 A;  2OTL Z;  1VQK Z;  4BBS I;  4NBE A;  2JMO A;  4A3I I;  1NJI 2;  1VQ6 Z;  4AYB A;  2M6N A;  3I4M I;  3CXC Z;  3KIH A;  3PO3 I;  1M90 2;  3FQQ A;  3IF8 A;  1X3Z A;  3CCU 1;  1USP A;  1ZH1 A;  3VB9 A;  5LL6 f;  3NDI A;  2V8K A;  2PK7 A;  3G4S 1;  1YIT 1;  2YU9 I;  1I6H I;  5AN9 F;  2QRC B;  2KI7 B;  1YIJ Z;  5T67 A;  3CCR Z;  1VQ7 1;  4MD7 A;  4S1T A;  2OZK A;  3MON A;  1YUA A;  3CCM Z;  4XX2 A;  3ESW A;  3NDJ A;  1VQM Z;  1N8R 1;  3NH5 A;  5C44 I;  3MZK B;  1Q86 2;  1VQP Z;  1KQS Z;  1ZB9 A;  1WII A;  2OOY B;  3CCL 1;  1YJN 1;  4A3L I;  3GTM S;  1WW9 A;  2GTH A;  4NOZ A;  1M1K 1;  5C4J I;  5IT9 b;  2Y0S A;  2PM9 A;  1K83 I;  4MXU A;  2E9H A;  3GTQ I;  3G6E 1;  3FKI I;  3G4S Z;  3G71 1;  3CCL Z;  3S17 I;  1YI2 Z;  3D6W A;  2HU9 A;  3CCV 1;  4NBA A;  2E2I I;  1VQ7 Z;  4NBC A;  2QA4 Z;  2GTI A;  2J6A A;  1VQO Z;  3EED A;  2NVT I;  2R92 I;  1K73 2;  1YHQ 1;  1QYP A;  1YI2 1;  1VQM 1;  3IFU A;  3OW2 Z;  2P28 A;  1N8R 2;  2W04 A;  3VTN A;  3CPW Z;  2R93 I;  2JNY A;  2R7Z I;  2NVY I;  1K8A 2;  4MD8 A;  2NVX I;  1YIT Z;  2VF1 A;  3JAM f;  4MON A;  3EER A;  3H3V J;  2GU2 A;  4E2Y A;  3CCE Z;  4NB8 A;  3GTM I;  1YHQ Z;  3CMA Z;  1KD1 2;  1Q82 2;  2F4O A;  3TDH B;  5C4X I;  3PO3 S;  3S1Q I;  5IP7 I;  1VQ4 Z;  3CME 1;  1RO0 A;  3S16 I;  2OOX B;  3CCQ 1;  4RVF A;  3CC7 Z;  3VMI A;  5CM2 M;  1VQ8 Z;  5FLX f;  3GTP I;  2QRE B;  3CCJ 1;  2NVQ I;  3BG0 B;  4EWC A;  1USP B;  1QVG Y;  1KC8 2;  1VQP 1;  3U50 C;  1K9M 2;  2QA4 1;  1YIJ 1;  3GTG I;  1NJI 1;  4A3E I;  3P5J B;  1YJN Z;  5T64 A;  4A3J I;  1Z02 A;  2QR1 B;  2IZ3 A;  3CCM 1;  1Q81 2;  1Q81 1;  4MH4 A;  1JJ2 Z;  3VMG A;  4NBF A;  3OW2 Y;  5IP9 I;  2LIY A;  3G71 Z;  4RVD A;  2QEX Z;  3CME Z;  1VQK 1;  2F4M A;  4RVH A;  4E2Z A;  2DE5 A;  1NP6 A;  4E2X A;  1VQN 1;  1TWH I;  3CC4 1;  3TE5 B;  4E30 A;  2AKL A;  4DK1 A;  3CCU Z;  4BY1 I;  3CCR 1;  3CD6 Z;  1YUK A;  3IX0 A;  4E33 A;  2QEX 1;  1JWH C;  3I55 Z;  4A3D I;  2YAD A;  3H0G I;  3HOW I;  2WAQ A;  1W2B Z;  4RS4 A;  3NFZ A;  2VUM I;  1YJW 1;  1W2B Y;  2JA7 I;  1TFI A;  4NB9 A;  1R9T I;  4CL1 A;  1SFO I;  3M4O I;  3CCS Z;  3GTO I;  3CCE 1;  1M90 1;  2E2H I;  2JUB A;  1K73 1;  2W03 A;  1VQ8 1;  1S7M A;  1VQO 1;  5D1P A;  2QLV B;  1N2F A;  2RIQ A;  3F3P C;  3D9X A;  4A3K I;  4E2W A;  1Z03 A;  1PFT A;  1S72 1;  3T4N B;  4DQY B;  4A93 I;  3CC4 Z;  3S15 I;  4BBR I;  1VQ6 1;  2RBL A;  2KPI A;  1DL6 A;  4BXX I;  3KIF A;  1Q82 1;  2K3R A;  3S2H I;  2Q4Z A;  2Q51 A;  4E31 A;  1L1O C;  2RPR A;  2OTJ 1;  1VQ5 Z;  4HGY A;  1JJ2 Y;  3J80 b;  4MD9 A;  3I4N I;  5FLM I;  2EGT A;  1X3W A;  3J80 f;  2G2K A;  3BG1 B;  3Q87 A;  2O53 A;  3CMA 1;  3S2D I;  5A2Q f;  1YJ9 Z;  2QKD A;  4HH4 A;  2JS4 A;  1QVG Z;  2VUG A;  2DE6 A;  3HOZ I;  3S1M I;  4NFR A;  1VQL Z;  2OTL 1;  1I3Q I;  3QWU A;  2BJO A;  3FQM A;  2M48 A;  4A3M I;  3GTL I;  3CC2 1;  3HOV I;  1M1K 2;  2K5R A;  1S72 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...