3K7AI

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
118
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEASPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 9
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI02
4NBEA 1YUAA 2F4OA 2DE5A 2AKLA 3HOYI 3LUSA 4BBSI 1Y1VS 4NBDA 1LQLA 2HF1A 3HOVI 1TWCI 3D6WA 4A3II 2P3YA 4NB9A 3S1MI 2VUMI 5IP7I 1I3QI 3GTQI 4NBFA 1TWFI 2NVXI 5C3EI 2YU9I 4Y52I 3GCFA 4BBRI 2R7ZI 4X6AI 3H0GI 4BY1I 2E2JI 3RZOI 3VMGA 3GTJI 1ZB9A 3HOUI 4NBAA 1X3WA 1X3ZA 5IP9I 3S16I 4A3JI 2JS4A 5C4XI 4NBHA 4A3BI 1WW9A 1TWHI 2NVTI 3FKII 3HOXI 2JR6A 4Y7NI 1WCMI 2NVQI 2DE7A 2J6AA 3M3YI 2E2HI 4BY7I 3S1QI 2E2II 3I4MI 1L1OC 1TWAI 4QTUA 3U50C 1TWGI 4A3CI 1ZB8A 5CM2M 1I50I 1QYPA 5C44I 3GTOI 3VMHA 1K83I 4NB8A 2JA5I 3GTGI 2NVYI 2BJOA 2F4MA 3GTLI 3HOZI 1PFTA 3H3VJ 1USPB 3S2HI 4A3FI 4XX2A 3EERA 3PO3I 4A3MI 2JA6I 1R9TI 1Y1WI 2R92I 2RBLA 3GKQA 1RLYA 1RO4A 2KPIA 4NBGA 3GTMI 2JNYA 3HOWI 1USPA 1VLAA 3I07A 1Y1VI 1TFIA 3GTMS 3GTPI 2R93I 3VB9A 3RZDI 3M4OI 3S1NI 1SFOI 4A3GI 2JA7I 4MH4A 1I6HI 4BXXI 1DL6A 4A3EI 2K5RA 4A93I 4NBCA 1ML8A 3VMIA 4A3DI 1NUIA 3Q87A 3K7AI 2JA8I 2B63I 2PK7A 4NBBA 2DE6A 3I4NI 4A3LI 5C4JI 1N2FA 3CQZI 3S1RI 3PO3S 3S17I 3S15I 4NOZA 4QTTA 3S2DI 3PO2I 3S14I 3GTKI 5FLMI 3ESWA 4A3KI
chains in the Genus database with same CATH superfamily
1K8A1 4NBEA 1S7MA 2G2KA 4MONA 2DE5A 2KI7B 3LUSA 1JJ2Z 2OZKA 1RNIA 1FDIA 1LQLA 3J80f 3CC41 3D9XA 3F3FC 3S1MI 2V8JA 2AYDA 3BG1B 5IP7I 1TWFI 2NVXI 4TNUA 4Y52I 4MXUA 3J80b 1YJN1 3JAMf 1SIWA 1ZB9A 1YJ9Z 1X3WA 3EEDA 3S16I 1VQM1 1YJ91 4RVDA 4NBHA 3CCVZ 4E2WA 1Q811 4E31A 2NVTI 2LFUA 5FLXf 2NVQI 3CCQ1 3G711 1Z03A 3CMA1 2QA41 1TWAI 4A3CI 2QREB 5CM2M 1I50I 3CCE1 3NH8A 3VMHA 3G4SZ 1K83I 2JA5I 1QVGY 3P5JB 1P9NA 1VQOZ 3S2HI 2Q51A 3MZKB 4XX2A 1VQO1 1RO2A 4A3MI 1YJW1 4RS4A 2R92I 2OTL1 3GKQA 1AA6A 3CMEZ 1USPA 1VQ4Z 1Y1VI 1KC81 1QVGZ 3CC21 3MONA 1WJ2A 5A2Qf 1S721 3M4OI 2QR1B 2GTHA 3S1NI 1DL6A 3NH4A 1Q16A 4A93I 5T64A 3VMIA 1YHQ1 1JWHC 5A2Qb 1M901 2JIQA 3CC7Z 2PK7A 1K731 3I4NI 3I55Z 3S1RI 4NOZA 3S14I 1Q821 3GTKI 1VQ6Z 4A3KI 2VF1A 1VQ61 1KD11 4DK1A 2EGTA 2YU9I 3GCFA 4BBRI 2R7ZI 4X6AI 3H0GI 2V45A 2E9HA 2V8IA 3GTJI 1VQ71 4NBAA 4DGLA 4A3JI 5D1PA 2H85A 5C4XI 1WW9A 1W2BY 3CCJZ 3FKII 3IF8A 3FQMA 3HOXI 2JR6A 3FQQA 3CCJ1 1WCMI 2DE7A 2J6AA 4E33A 4DQYB 3S1QI 2QLVB 4EWCA 1VQ5Z 3CCMZ 2QRCB 1TWGI 1NP6A 1QYPA 5C44I 2W03A 3GTOI 5D1OB 1Y8CA 2OOYB 1Z02A 3GTLI 3H3VJ 1W2BZ 2Y0SA 3CCUZ 2IZ3A 2QKDA 4RVGA 3CCU1 3CCV1 2JMOA 2JIMA 3PO3I 4HGYA 2RBLA 3GTMI 2JNYA 2RT9A 2K3RA 3HOWI 3I07A 1TFIA 2OTJZ 3QWUA 2OTJ1 1QVFY 2VUGA 3VB9A 1SFOI 1X0TA 2R6MA 3G4S1 2RHBA 2JA7I 4BXXI 3G6EZ 2OOXB 5T6BA 1VQ9Z 3K7AI 2NAPA 3I56Z 1VQ91 1Q812 1YITZ 4A3LI 2DE6A 4NFRA 5C4JI 1N2FA 3CQZI 3CME1 3IX0A 1QF8A 3CPWY 1QVFZ 2GU2A 1VQ41 2I3CA 3ESWA 1FDOA 1Q7Y1 2ZAEB 1YUAA 3NFZA 3HOVI 1TWCI 2P3YA 4NB9A 5LL6f 2VUMI 3GTQI 4NBFA 3CPWZ 2PM9A 2VPWA 3CC71 1VQLZ 4BY1I 3I551 1VQL1 2E2JI 3RZOI 2YADA 3VMGA 5IT9f 3HOUI 2W04A 4RV9A 2VPYA 5T67A 4E2XA 1Q861 4MD7A 3NH5A 1K9M1 5IT9b 1KQSY 3M3YI 4BY7I 3I4MI 1N8R2 1KRLA 3U50C 4MD8A 2QRDB 3GTGI 2NVYI 3VTNA 2F4MA 1YIJZ 3HOZI 1USPB 2JIOA 4E2ZA 1Q822 1NJI2 3CCSZ 1M1K2 1KQSZ 3EERA 2M6NA 2JA6I 2JIPA 1KD12 1ZH1A 3CD6Z 2WB1A 3HKZA 1RO4A 3CD61 2KPIA 1YI2Z 1QXFA 1YI21 3CCLZ 1VQ51 2QEXZ 1VLAA 1VQNZ 3CCM1 2P28A 3GTMS 2PMZA 2O4HA 3F3PC 3GTPI 3RZDI 4NH1C 4A3EI 3CC4Z 4E2YA 1K8A2 4A3DI 3Q87A 3TDHB 1WIIA 4AYBA 2Q4ZA 4NBBA 1YJNZ 1WZNA 2VPXA 3TE5B 3S17I 3BG0B 4S1TA 3S2DI 3PO2I 1VQMZ 1PFTA 2RIQA 2F4OA 2AKLA 3HOYI 4BBSI 3JAMb 1Y1VS 1VQPZ 4NBDA 2HF1A 1VQP1 3CCQZ 3D6WA 3G6E1 3G71Z 4A3II 3CMAZ 2QA4Z 3IR7A 1I3QI 4HGZA 1VQKZ 5C3EI 4RVHA 2JUBA 2WAQA 1VQK1 3I561 2M48A 1YIT1 3CCEZ 2VPZA 5FLXb 5IP9I 1X3ZA 2JS4A 4A3BI 1YJWZ 1TWHI 2OTLZ 4E32A 4Y7NI 4E30A 2E2HI 2E2II 1L1OC 4QTUA 2O53A 2HU9A 3CC2Z 1ZB8A 1S72Z 2E7ZA 2JIRA 4NB8A 2BJOA 1Z01A 2IZ4A 1KC82 1YHQZ 3CCRZ 4RVFA 4A3FI 3D2LA 3OW2Y 3CCR1 1RQFA 1Q7Y2 4HH4A 1N8R1 1R9TI 5D1OA 1Y1WI 4CL1A 1RLYA 3CXCY 3KIFA 4NBGA 2RPRA 4MRIA 2IV2X 1VQ8Z 3KIHA 1M902 1VQ81 1NJI1 1M1K1 4MD9A 3J81f 1RO0A 3J7A4 2R93I 1K732 3T4NB 4A3GI 3MZLB 3OW2Z 4MH4A 1I6HI 2GTIA 2K5RA 3IFUA 1YIJ1 4NBCA 1ML8A 2V3VA 3J81b 2LIYA 3CXCZ 1JJ2Y 3CCS1 1NUIA 1YUKA 2JA8I 2B63I 1Q862 3NDIA 1K9M2 3PO3S 5AN9F 1VQ7Z 3CCL1 3S15I 4QTTA 2LEXA 2QEX1 2V8KA 5FLMI 1VQN1 3NDJA
chains in the Genus database with same CATH topology
1K8A1 4NBEA 1S7MA 2G2KA 4MONA 2DE5A 2KI7B 3LUSA 1JJ2Z 2OZKA 1RNIA 1LQLA 3J80f 3CC41 3D9XA 3F3FC 3S1MI 2V8JA 3BG1B 5IP7I 1TWFI 2NVXI 4TNUA 4Y52I 4MXUA 3J80b 1YJN1 3JAMf 1ZB9A 1YJ9Z 1X3WA 3EEDA 3S16I 1VQM1 1YJ91 4RVDA 4NBHA 3CCVZ 4E2WA 1Q811 4E31A 2NVTI 2LFUA 5FLXf 2NVQI 3CCQ1 3G711 1Z03A 3CMA1 2QA41 1TWAI 4A3CI 2QREB 5CM2M 1I50I 3CCE1 3NH8A 3VMHA 3G4SZ 1K83I 2JA5I 1QVGY 3P5JB 1P9NA 1VQOZ 3S2HI 2Q51A 3MZKB 4XX2A 1VQO1 1RO2A 4A3MI 1YJW1 4RS4A 2R92I 2OTL1 3GKQA 3CMEZ 1USPA 1VQ4Z 1Y1VI 1KC81 1QVGZ 3CC21 3MONA 5A2Qf 1S721 3M4OI 2QR1B 2GTHA 3S1NI 1DL6A 3NH4A 4A93I 5T64A 3VMIA 1YHQ1 1JWHC 5A2Qb 1M901 3CC7Z 2PK7A 1K731 3I4NI 3I55Z 3S1RI 4NOZA 3S14I 1Q821 3GTKI 1VQ6Z 4A3KI 2VF1A 1VQ61 1KD11 4DK1A 2EGTA 2YU9I 3GCFA 4BBRI 2R7ZI 4X6AI 3H0GI 2E9HA 2V8IA 3GTJI 1VQ71 4NBAA 4DGLA 4A3JI 5D1PA 2H85A 5C4XI 1WW9A 1W2BY 3CCJZ 3FKII 3IF8A 3FQMA 3HOXI 2JR6A 3FQQA 3CCJ1 1WCMI 2DE7A 2J6AA 4E33A 4DQYB 3S1QI 2QLVB 4EWCA 1VQ5Z 3CCMZ 2QRCB 1TWGI 1NP6A 1QYPA 5C44I 2W03A 3GTOI 5D1OB 2OOYB 1Z02A 3GTLI 3H3VJ 1W2BZ 2Y0SA 3CCUZ 2IZ3A 2QKDA 4RVGA 3CCU1 3CCV1 2JMOA 3PO3I 4HGYA 2RBLA 3GTMI 2JNYA 2RT9A 2K3RA 3HOWI 3I07A 1TFIA 2OTJZ 3QWUA 2OTJ1 1QVFY 2VUGA 3VB9A 1SFOI 1X0TA 2R6MA 3G4S1 2RHBA 2JA7I 4BXXI 3G6EZ 2OOXB 5T6BA 1VQ9Z 3K7AI 3I56Z 1VQ91 1Q812 1YITZ 4A3LI 2DE6A 4NFRA 5C4JI 1N2FA 3CQZI 3CME1 3IX0A 1QF8A 3CPWY 1QVFZ 2GU2A 1VQ41 2I3CA 3ESWA 1Q7Y1 2ZAEB 1YUAA 3NFZA 3HOVI 1TWCI 2P3YA 4NB9A 5LL6f 2VUMI 3GTQI 4NBFA 3CPWZ 2PM9A 4BY1I 3CC71 1VQLZ 3I551 1VQL1 2E2JI 3RZOI 2YADA 3VMGA 5IT9f 3HOUI 2W04A 4RV9A 5T67A 4E2XA 1Q861 4MD7A 3NH5A 1K9M1 5IT9b 1KQSY 3M3YI 4BY7I 3I4MI 1N8R2 1KRLA 3U50C 4MD8A 2QRDB 3GTGI 2NVYI 3VTNA 2F4MA 1YIJZ 3HOZI 1USPB 4E2ZA 1Q822 1NJI2 3CCSZ 1M1K2 1KQSZ 3EERA 2M6NA 2JA6I 1KD12 1ZH1A 3CD6Z 2WB1A 3HKZA 1RO4A 3CD61 2KPIA 1YI2Z 1YI21 3CCLZ 1VQ51 2QEXZ 1VLAA 1VQNZ 3CCM1 2P28A 3GTMS 2PMZA 2O4HA 3F3PC 3GTPI 3RZDI 4NH1C 4A3EI 3CC4Z 4E2YA 1K8A2 4A3DI 3Q87A 3TDHB 1WIIA 4AYBA 2Q4ZA 4NBBA 1YJNZ 3TE5B 3S17I 3BG0B 4S1TA 3S2DI 3PO2I 1VQMZ 1PFTA 2RIQA 2F4OA 2AKLA 3HOYI 4BBSI 3JAMb 1Y1VS 1VQPZ 4NBDA 2HF1A 1VQP1 3CCQZ 3D6WA 3G6E1 3G71Z 4A3II 3CMAZ 2QA4Z 1I3QI 4HGZA 1VQKZ 5C3EI 4RVHA 2JUBA 2WAQA 1VQK1 3I561 2M48A 1YIT1 3CCEZ 5FLXb 5IP9I 1X3ZA 2JS4A 4A3BI 1YJWZ 1TWHI 2OTLZ 4E32A 4Y7NI 4E30A 2E2HI 2E2II 1L1OC 4QTUA 2O53A 2HU9A 3CC2Z 1ZB8A 1S72Z 4NB8A 2BJOA 1Z01A 2IZ4A 1KC82 1YHQZ 3CCRZ 4RVFA 4A3FI 3OW2Y 3CCR1 1RQFA 1Q7Y2 4HH4A 1N8R1 1R9TI 5D1OA 1Y1WI 4CL1A 1RLYA 3CXCY 3KIFA 4NBGA 2RPRA 4MRIA 1VQ8Z 3KIHA 1M902 1VQ81 1NJI1 1M1K1 4MD9A 3J81f 1RO0A 3J7A4 2R93I 1K732 3T4NB 4A3GI 3MZLB 3OW2Z 4MH4A 1I6HI 2GTIA 2K5RA 3IFUA 1YIJ1 4NBCA 1ML8A 3CXCZ 3J81b 2LIYA 1JJ2Y 3CCS1 1NUIA 1YUKA 2JA8I 2B63I 1Q862 3NDIA 1K9M2 3PO3S 5AN9F 1VQ7Z 3CCL1 3S15I 4QTTA 2QEX1 2V8KA 5FLMI 1VQN1 3NDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBE A;  1YUA A;  2F4O A;  2DE5 A;  2AKL A;  3HOY I;  3LUS A;  4BBS I;  1Y1V S;  4NBD A;  1LQL A;  2HF1 A;  3HOV I;  1TWC I;  3D6W A;  4A3I I;  2P3Y A;  4NB9 A;  3S1M I;  2VUM I;  5IP7 I;  1I3Q I;  3GTQ I;  4NBF A;  1TWF I;  2NVX I;  5C3E I;  2YU9 I;  4Y52 I;  3GCF A;  4BBR I;  2R7Z I;  4X6A I;  3H0G I;  4BY1 I;  2E2J I;  3RZO I;  3VMG A;  3GTJ I;  1ZB9 A;  3HOU I;  4NBA A;  1X3W A;  1X3Z A;  5IP9 I;  3S16 I;  4A3J I;  2JS4 A;  5C4X I;  4NBH A;  4A3B I;  1WW9 A;  1TWH I;  2NVT I;  3FKI I;  3HOX I;  2JR6 A;  4Y7N I;  1WCM I;  2NVQ I;  2DE7 A;  2J6A A;  3M3Y I;  2E2H I;  4BY7 I;  3S1Q I;  2E2I I;  3I4M I;  1L1O C;  1TWA I;  4QTU A;  3U50 C;  1TWG I;  4A3C I;  1ZB8 A;  5CM2 M;  1I50 I;  1QYP A;  5C44 I;  3GTO I;  3VMH A;  1K83 I;  4NB8 A;  2JA5 I;  3GTG I;  2NVY I;  2BJO A;  2F4M A;  3GTL I;  3HOZ I;  1PFT A;  3H3V J;  1USP B;  3S2H I;  4A3F I;  4XX2 A;  3EER A;  3PO3 I;  4A3M I;  2JA6 I;  1R9T I;  1Y1W I;  2R92 I;  2RBL A;  3GKQ A;  1RLY A;  1RO4 A;  2KPI A;  4NBG A;  3GTM I;  2JNY A;  3HOW I;  1USP A;  1VLA A;  3I07 A;  1Y1V I;  1TFI A;  3GTM S;  3GTP I;  2R93 I;  3VB9 A;  3RZD I;  3M4O I;  3S1N I;  1SFO I;  4A3G I;  2JA7 I;  4MH4 A;  1I6H I;  4BXX I;  1DL6 A;  4A3E I;  2K5R A;  4A93 I;  4NBC A;  1ML8 A;  3VMI A;  4A3D I;  1NUI A;  3Q87 A;  3K7A I;  2JA8 I;  2B63 I;  2PK7 A;  4NBB A;  2DE6 A;  3I4N I;  4A3L I;  5C4J I;  1N2F A;  3CQZ I;  3S1R I;  3PO3 S;  3S17 I;  3S15 I;  4NOZ A;  4QTT A;  3S2D I;  3PO2 I;  3S14 I;  3GTK I;  5FLM I;  3ESW A;  4A3K I; 
#chains in the Genus database with same CATH topology
 1K8A 1;  4NBE A;  1S7M A;  2G2K A;  4MON A;  2DE5 A;  2KI7 B;  3LUS A;  1JJ2 Z;  2OZK A;  1RNI A;  1FDI A;  1LQL A;  3J80 f;  3CC4 1;  3D9X A;  3F3F C;  3S1M I;  2V8J A;  2AYD A;  3BG1 B;  5IP7 I;  1TWF I;  2NVX I;  4TNU A;  4Y52 I;  4MXU A;  3J80 b;  1YJN 1;  3JAM f;  1SIW A;  1ZB9 A;  1YJ9 Z;  1X3W A;  3EED A;  3S16 I;  1VQM 1;  1YJ9 1;  4RVD A;  4NBH A;  3CCV Z;  4E2W A;  1Q81 1;  4E31 A;  2NVT I;  2LFU A;  5FLX f;  2NVQ I;  3CCQ 1;  3G71 1;  1Z03 A;  3CMA 1;  2QA4 1;  1TWA I;  4A3C I;  2QRE B;  5CM2 M;  1I50 I;  3CCE 1;  3NH8 A;  3VMH A;  3G4S Z;  1K83 I;  2JA5 I;  1QVG Y;  3P5J B;  1P9N A;  1VQO Z;  3S2H I;  2Q51 A;  3MZK B;  4XX2 A;  1VQO 1;  1RO2 A;  4A3M I;  1YJW 1;  4RS4 A;  2R92 I;  2OTL 1;  3GKQ A;  1AA6 A;  3CME Z;  1USP A;  1VQ4 Z;  1Y1V I;  1KC8 1;  1QVG Z;  3CC2 1;  3MON A;  1WJ2 A;  5A2Q f;  1S72 1;  3M4O I;  2QR1 B;  2GTH A;  3S1N I;  1DL6 A;  3NH4 A;  1Q16 A;  4A93 I;  5T64 A;  3VMI A;  1YHQ 1;  1JWH C;  5A2Q b;  1M90 1;  2JIQ A;  3CC7 Z;  2PK7 A;  1K73 1;  3I4N I;  3I55 Z;  3S1R I;  4NOZ A;  3S14 I;  1Q82 1;  3GTK I;  1VQ6 Z;  4A3K I;  2VF1 A;  1VQ6 1;  1KD1 1;  4DK1 A;  2EGT A;  2YU9 I;  3GCF A;  4BBR I;  2R7Z I;  4X6A I;  3H0G I;  2V45 A;  2E9H A;  2V8I A;  3GTJ I;  1VQ7 1;  4NBA A;  4DGL A;  4A3J I;  5D1P A;  2H85 A;  5C4X I;  1WW9 A;  1W2B Y;  3CCJ Z;  3FKI I;  3IF8 A;  3FQM A;  3HOX I;  2JR6 A;  3FQQ A;  3CCJ 1;  1WCM I;  2DE7 A;  2J6A A;  4E33 A;  4DQY B;  3S1Q I;  2QLV B;  4EWC A;  1VQ5 Z;  3CCM Z;  2QRC B;  1TWG I;  1NP6 A;  1QYP A;  5C44 I;  2W03 A;  3GTO I;  5D1O B;  1Y8C A;  2OOY B;  1Z02 A;  3GTL I;  3H3V J;  1W2B Z;  2Y0S A;  3CCU Z;  2IZ3 A;  2QKD A;  4RVG A;  3CCU 1;  3CCV 1;  2JMO A;  2JIM A;  3PO3 I;  4HGY A;  2RBL A;  3GTM I;  2JNY A;  2RT9 A;  2K3R A;  3HOW I;  3I07 A;  1TFI A;  2OTJ Z;  3QWU A;  2OTJ 1;  1QVF Y;  2VUG A;  3VB9 A;  1SFO I;  1X0T A;  2R6M A;  3G4S 1;  2RHB A;  2JA7 I;  4BXX I;  3G6E Z;  2OOX B;  5T6B A;  1VQ9 Z;  3K7A I;  2NAP A;  3I56 Z;  1VQ9 1;  1Q81 2;  1YIT Z;  4A3L I;  2DE6 A;  4NFR A;  5C4J I;  1N2F A;  3CQZ I;  3CME 1;  3IX0 A;  1QF8 A;  3CPW Y;  1QVF Z;  2GU2 A;  1VQ4 1;  2I3C A;  3ESW A;  1FDO A;  1Q7Y 1;  2ZAE B;  1YUA A;  3NFZ A;  3HOV I;  1TWC I;  2P3Y A;  4NB9 A;  5LL6 f;  2VUM I;  3GTQ I;  4NBF A;  3CPW Z;  2PM9 A;  2VPW A;  3CC7 1;  1VQL Z;  4BY1 I;  3I55 1;  1VQL 1;  2E2J I;  3RZO I;  2YAD A;  3VMG A;  5IT9 f;  3HOU I;  2W04 A;  4RV9 A;  2VPY A;  5T67 A;  4E2X A;  1Q86 1;  4MD7 A;  3NH5 A;  1K9M 1;  5IT9 b;  1KQS Y;  3M3Y I;  4BY7 I;  3I4M I;  1N8R 2;  1KRL A;  3U50 C;  4MD8 A;  2QRD B;  3GTG I;  2NVY I;  3VTN A;  2F4M A;  1YIJ Z;  3HOZ I;  1USP B;  2JIO A;  4E2Z A;  1Q82 2;  1NJI 2;  3CCS Z;  1M1K 2;  1KQS Z;  3EER A;  2M6N A;  2JA6 I;  2JIP A;  1KD1 2;  1ZH1 A;  3CD6 Z;  2WB1 A;  3HKZ A;  1RO4 A;  3CD6 1;  2KPI A;  1YI2 Z;  1QXF A;  1YI2 1;  3CCL Z;  1VQ5 1;  2QEX Z;  1VLA A;  1VQN Z;  3CCM 1;  2P28 A;  3GTM S;  2PMZ A;  2O4H A;  3F3P C;  3GTP I;  3RZD I;  4NH1 C;  4A3E I;  3CC4 Z;  4E2Y A;  1K8A 2;  4A3D I;  3Q87 A;  3TDH B;  1WII A;  4AYB A;  2Q4Z A;  4NBB A;  1YJN Z;  1WZN A;  2VPX A;  3TE5 B;  3S17 I;  3BG0 B;  4S1T A;  3S2D I;  3PO2 I;  1VQM Z;  1PFT A;  2RIQ A;  2F4O A;  2AKL A;  3HOY I;  4BBS I;  3JAM b;  1Y1V S;  1VQP Z;  4NBD A;  2HF1 A;  1VQP 1;  3CCQ Z;  3D6W A;  3G6E 1;  3G71 Z;  4A3I I;  3CMA Z;  2QA4 Z;  3IR7 A;  1I3Q I;  4HGZ A;  1VQK Z;  5C3E I;  4RVH A;  2JUB A;  2WAQ A;  1VQK 1;  3I56 1;  2M48 A;  1YIT 1;  3CCE Z;  2VPZ A;  5FLX b;  5IP9 I;  1X3Z A;  2JS4 A;  4A3B I;  1YJW Z;  1TWH I;  2OTL Z;  4E32 A;  4Y7N I;  4E30 A;  2E2H I;  2E2I I;  1L1O C;  4QTU A;  2O53 A;  2HU9 A;  3CC2 Z;  1ZB8 A;  1S72 Z;  2E7Z A;  2JIR A;  4NB8 A;  2BJO A;  1Z01 A;  2IZ4 A;  1KC8 2;  1YHQ Z;  3CCR Z;  4RVF A;  4A3F I;  3D2L A;  3OW2 Y;  3CCR 1;  1RQF A;  1Q7Y 2;  4HH4 A;  1N8R 1;  1R9T I;  5D1O A;  1Y1W I;  4CL1 A;  1RLY A;  3CXC Y;  3KIF A;  4NBG A;  2RPR A;  4MRI A;  2IV2 X;  1VQ8 Z;  3KIH A;  1M90 2;  1VQ8 1;  1NJI 1;  1M1K 1;  4MD9 A;  3J81 f;  1RO0 A;  3J7A 4;  2R93 I;  1K73 2;  3T4N B;  4A3G I;  3MZL B;  3OW2 Z;  4MH4 A;  1I6H I;  2GTI A;  2K5R A;  3IFU A;  1YIJ 1;  4NBC A;  1ML8 A;  2V3V A;  3J81 b;  2LIY A;  3CXC Z;  1JJ2 Y;  3CCS 1;  1NUI A;  1YUK A;  2JA8 I;  2B63 I;  1Q86 2;  3NDI A;  1K9M 2;  3PO3 S;  5AN9 F;  1VQ7 Z;  3CCL 1;  3S15 I;  4QTT A;  2LEX A;  2QEX 1;  2V8K A;  5FLM I;  1VQN 1;  3NDJ A; 
#chains in the Genus database with same CATH homology
 1K8A 1;  4NBE A;  1S7M A;  2G2K A;  4MON A;  2DE5 A;  2KI7 B;  3LUS A;  1JJ2 Z;  2OZK A;  1RNI A;  1LQL A;  3J80 f;  3CC4 1;  3D9X A;  3F3F C;  3S1M I;  2V8J A;  3BG1 B;  5IP7 I;  1TWF I;  2NVX I;  4TNU A;  4Y52 I;  4MXU A;  3J80 b;  1YJN 1;  3JAM f;  1ZB9 A;  1YJ9 Z;  1X3W A;  3EED A;  3S16 I;  1VQM 1;  1YJ9 1;  4RVD A;  4NBH A;  3CCV Z;  4E2W A;  1Q81 1;  4E31 A;  2NVT I;  2LFU A;  5FLX f;  2NVQ I;  3CCQ 1;  3G71 1;  1Z03 A;  3CMA 1;  2QA4 1;  1TWA I;  4A3C I;  2QRE B;  5CM2 M;  1I50 I;  3CCE 1;  3NH8 A;  3VMH A;  3G4S Z;  1K83 I;  2JA5 I;  1QVG Y;  3P5J B;  1P9N A;  1VQO Z;  3S2H I;  2Q51 A;  3MZK B;  4XX2 A;  1VQO 1;  1RO2 A;  4A3M I;  1YJW 1;  4RS4 A;  2R92 I;  2OTL 1;  3GKQ A;  3CME Z;  1USP A;  1VQ4 Z;  1Y1V I;  1KC8 1;  1QVG Z;  3CC2 1;  3MON A;  5A2Q f;  1S72 1;  3M4O I;  2QR1 B;  2GTH A;  3S1N I;  1DL6 A;  3NH4 A;  4A93 I;  5T64 A;  3VMI A;  1YHQ 1;  1JWH C;  5A2Q b;  1M90 1;  3CC7 Z;  2PK7 A;  1K73 1;  3I4N I;  3I55 Z;  3S1R I;  4NOZ A;  3S14 I;  1Q82 1;  3GTK I;  1VQ6 Z;  4A3K I;  2VF1 A;  1VQ6 1;  1KD1 1;  4DK1 A;  2EGT A;  2YU9 I;  3GCF A;  4BBR I;  2R7Z I;  4X6A I;  3H0G I;  2E9H A;  2V8I A;  3GTJ I;  1VQ7 1;  4NBA A;  4DGL A;  4A3J I;  5D1P A;  2H85 A;  5C4X I;  1WW9 A;  1W2B Y;  3CCJ Z;  3FKI I;  3IF8 A;  3FQM A;  3HOX I;  2JR6 A;  3FQQ A;  3CCJ 1;  1WCM I;  2DE7 A;  2J6A A;  4E33 A;  4DQY B;  3S1Q I;  2QLV B;  4EWC A;  1VQ5 Z;  3CCM Z;  2QRC B;  1TWG I;  1NP6 A;  1QYP A;  5C44 I;  2W03 A;  3GTO I;  5D1O B;  2OOY B;  1Z02 A;  3GTL I;  3H3V J;  1W2B Z;  2Y0S A;  3CCU Z;  2IZ3 A;  2QKD A;  4RVG A;  3CCU 1;  3CCV 1;  2JMO A;  3PO3 I;  4HGY A;  2RBL A;  3GTM I;  2JNY A;  2RT9 A;  2K3R A;  3HOW I;  3I07 A;  1TFI A;  2OTJ Z;  3QWU A;  2OTJ 1;  1QVF Y;  2VUG A;  3VB9 A;  1SFO I;  1X0T A;  2R6M A;  3G4S 1;  2RHB A;  2JA7 I;  4BXX I;  3G6E Z;  2OOX B;  5T6B A;  1VQ9 Z;  3K7A I;  3I56 Z;  1VQ9 1;  1Q81 2;  1YIT Z;  4A3L I;  2DE6 A;  4NFR A;  5C4J I;  1N2F A;  3CQZ I;  3CME 1;  3IX0 A;  1QF8 A;  3CPW Y;  1QVF Z;  2GU2 A;  1VQ4 1;  2I3C A;  3ESW A;  1Q7Y 1;  2ZAE B;  1YUA A;  3NFZ A;  3HOV I;  1TWC I;  2P3Y A;  4NB9 A;  5LL6 f;  2VUM I;  3GTQ I;  4NBF A;  3CPW Z;  2PM9 A;  4BY1 I;  3CC7 1;  1VQL Z;  3I55 1;  1VQL 1;  2E2J I;  3RZO I;  2YAD A;  3VMG A;  5IT9 f;  3HOU I;  2W04 A;  4RV9 A;  5T67 A;  4E2X A;  1Q86 1;  4MD7 A;  3NH5 A;  1K9M 1;  5IT9 b;  1KQS Y;  3M3Y I;  4BY7 I;  3I4M I;  1N8R 2;  1KRL A;  3U50 C;  4MD8 A;  2QRD B;  3GTG I;  2NVY I;  3VTN A;  2F4M A;  1YIJ Z;  3HOZ I;  1USP B;  4E2Z A;  1Q82 2;  1NJI 2;  3CCS Z;  1M1K 2;  1KQS Z;  3EER A;  2M6N A;  2JA6 I;  1KD1 2;  1ZH1 A;  3CD6 Z;  2WB1 A;  3HKZ A;  1RO4 A;  3CD6 1;  2KPI A;  1YI2 Z;  1YI2 1;  3CCL Z;  1VQ5 1;  2QEX Z;  1VLA A;  1VQN Z;  3CCM 1;  2P28 A;  3GTM S;  2PMZ A;  2O4H A;  3F3P C;  3GTP I;  3RZD I;  4NH1 C;  4A3E I;  3CC4 Z;  4E2Y A;  1K8A 2;  4A3D I;  3Q87 A;  3TDH B;  1WII A;  4AYB A;  2Q4Z A;  4NBB A;  1YJN Z;  3TE5 B;  3S17 I;  3BG0 B;  4S1T A;  3S2D I;  3PO2 I;  1VQM Z;  1PFT A;  2RIQ A;  2F4O A;  2AKL A;  3HOY I;  4BBS I;  3JAM b;  1Y1V S;  1VQP Z;  4NBD A;  2HF1 A;  1VQP 1;  3CCQ Z;  3D6W A;  3G6E 1;  3G71 Z;  4A3I I;  3CMA Z;  2QA4 Z;  1I3Q I;  4HGZ A;  1VQK Z;  5C3E I;  4RVH A;  2JUB A;  2WAQ A;  1VQK 1;  3I56 1;  2M48 A;  1YIT 1;  3CCE Z;  5FLX b;  5IP9 I;  1X3Z A;  2JS4 A;  4A3B I;  1YJW Z;  1TWH I;  2OTL Z;  4E32 A;  4Y7N I;  4E30 A;  2E2H I;  2E2I I;  1L1O C;  4QTU A;  2O53 A;  2HU9 A;  3CC2 Z;  1ZB8 A;  1S72 Z;  4NB8 A;  2BJO A;  1Z01 A;  2IZ4 A;  1KC8 2;  1YHQ Z;  3CCR Z;  4RVF A;  4A3F I;  3OW2 Y;  3CCR 1;  1RQF A;  1Q7Y 2;  4HH4 A;  1N8R 1;  1R9T I;  5D1O A;  1Y1W I;  4CL1 A;  1RLY A;  3CXC Y;  3KIF A;  4NBG A;  2RPR A;  4MRI A;  1VQ8 Z;  3KIH A;  1M90 2;  1VQ8 1;  1NJI 1;  1M1K 1;  4MD9 A;  3J81 f;  1RO0 A;  3J7A 4;  2R93 I;  1K73 2;  3T4N B;  4A3G I;  3MZL B;  3OW2 Z;  4MH4 A;  1I6H I;  2GTI A;  2K5R A;  3IFU A;  1YIJ 1;  4NBC A;  1ML8 A;  3CXC Z;  3J81 b;  2LIY A;  1JJ2 Y;  3CCS 1;  1NUI A;  1YUK A;  2JA8 I;  2B63 I;  1Q86 2;  3NDI A;  1K9M 2;  3PO3 S;  5AN9 F;  1VQ7 Z;  3CCL 1;  3S15 I;  4QTT A;  2QEX 1;  2V8K A;  5FLM I;  1VQN 1;  3NDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...