3K7AI

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
118
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEASPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 9
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI02
3I4MI 4NBGA 4NBDA 5FLMI 4XX2A 1PFTA 3HOUI 3S2DI 2F4MA 1QYPA 2KPIA 4NBHA 4A3DI 3GTKI 1USPA 1LQLA 2P3YA 2AKLA 2E2HI 3K7AI 1I6HI 3S1RI 4BY1I 3I4NI 4NBFA 1TWCI 1TWAI 5C44I 4QTTA 3D6WA 5C3EI 4NBBA 1TWFI 4NB9A 3GTMS 4BBRI 1X3WA 3GCFA 3GTJI 3S1QI 3LUSA 4Y7NI 4NBEA 2R7ZI 1I3QI 4A3JI 1RLYA 1N2FA 3RZDI 2JR6A 3PO3I 2E2II 1L1OC 2DE5A 3S1NI 3EERA 1Y1VS 3S2HI 3M4OI 3H0GI 2DE6A 4NBCA 1TFIA 1WCMI 3M3YI 2NVTI 3PO2I 4NOZA 4A3LI 2VUMI 5IP9I 1Y1VI 3GTPI 3RZOI 3S15I 4BXXI 1TWGI 2K5RA 1DL6A 2JA7I 1RO4A 5C4JI 3GTMI 1Y1WI 3VMGA 3HOVI 1NUIA 1TWHI 3S16I 3VMIA 2JNYA 4BBSI 4NBAA 3GTGI 3I07A 2NVXI 2R92I 1X3ZA 2JS4A 2E2JI 2HF1A 2JA8I 1K83I 3HOWI 2J6AA 4NB8A 4A3BI 4A3GI 3GTQI 5CM2M 1VLAA 1R9TI 4A3II 3S1MI 3VB9A 1I50I 1USPB 2DE7A 1ZB8A 4Y52I 3VMHA 4X6AI 3HOYI 4A3MI 5IP7I 3HOXI 1SFOI 1YUAA 4A3FI 3S17I 3GKQA 2PK7A 2NVQI 5C4XI 1WW9A 2R93I 3PO3S 2B63I 4BY7I 3GTLI 3HOZI 3S14I 3U50C 2BJOA 2JA6I 3CQZI 2RBLA 4QTUA 2F4OA 4A3CI 4MH4A 2NVYI 3ESWA 3GTOI 4A3EI 2YU9I 3H3VJ 4A3KI 2JA5I 1ZB9A 3Q87A 4A93I 1ML8A 3FKII
chains in the Genus database with same CATH superfamily
4NBGA 5FLMI 1PFTA 2QEX1 3IF8A 3HOUI 1VQ6Z 1QXFA 3P5JB 3CCL1 2QLVB 4A3DI 3FQQA 2LFUA 1Z01A 3G4SZ 3NDJA 3NH4A 3BG1B 2GU2A 3K7AI 4BY1I 4E2YA 3CMEZ 4MD7A 2QREB 3CPWZ 1VQO1 1TWAI 1Q822 2OTL1 2VPXA 2VF1A 4NBBA 1X3WA 3GCFA 2W04A 4E2WA 1YJNZ 4HGYA 4E31A 2JR6A 1KQSZ 1VQLZ 1FDOA 3H0GI 3CCU1 1VQL1 3I55Z 1Y1VI 2Q51A 3GTMI 2NAPA 4E32A 1YIJZ 1TWHI 1SIWA 1RNIA 2PMZA 1K8A2 2RHBA 4MXUA 3EEDA 3I07A 2NVXI 1WIIA 2JA8I 3HOWI 3BG0B 1YI21 4NB8A 2V45A 4A3II 3CCSZ 1K8A1 4E33A 3VB9A 1QVGY 1K9M2 1QVGZ 3F3PC 4RVHA 3VMHA 3HOYI 3HOXI 1M1K1 3T4NB 1YHQ1 1Q862 3S17I 2PK7A 3G4S1 1FDIA 2R93I 1VQ61 1M902 2BJOA 3G71Z 3TE5B 3CXCZ 1X0TA 1KC82 1YIJ1 3CC2Z 5AN9F 2ZAEB 2M48A 1Q7Y1 4A93I 4HH4A 1S721 1ML8A 2E9HA 1M901 1YJW1 4NFRA 3S2DI 1W2BZ 4TNUA 3CXCY 2KPIA 1QF8A 1KRLA 2JUBA 3CCM1 1YJWZ 1USPA 3GTKI 2P3YA 1S7MA 3NH5A 1Z03A 3CCR1 1QVFZ 3S1RI 2R6MA 2OTJZ 3I4NI 4NBFA 5T64A 5C44I 5C3EI 1K9M1 3CME1 4BBRI 1VQ91 1VQOZ 3LUSA 4Y7NI 4E2ZA 1I3QI 4A3JI 3HKZA 1N8R1 2QKDA 3PO3I 1JWHC 1L1OC 2VPYA 1KD11 1Y1VS 3CMAZ 2IZ4A 1VQ41 1VQ71 3PO2I 4A3LI 2V3VA 1YI2Z 1VQ9Z 3G711 3RZOI 3S15I 1YJN1 3J81f 1RO4A 2JA7I 1VQ5Z 3I56Z 3VMGA 1NUIA 1KD12 2Q4ZA 2JNYA 2OZKA 2AYDA 2JS4A 1VQKZ 3D2LA 2IV2X 3CCQ1 2J6AA 4RVDA 3CCLZ 4A3BI 5CM2M 2YADA 1YUKA 3S1MI 3MZLB 3CCV1 1I50I 1USPB 2QA41 2EGTA 2DE7A 1ZB8A 4A3MI 1YUAA 5T6BA 3CD61 2VPZA 2JIOA 2O53A 1VQMZ 1WW9A 3PO3S 2B63I 5T67A 4BY7I 3HOZI 5D1OA 2KI7B 1RQFA 2OTJ1 3U50C 3J81b 3CQZI 2RBLA 2F4OA 4A3CI 4MH4A 2JIQA 2JIRA 3KIFA 4A3KI 3CCE1 4S1TA 3CC7Z 2GTIA 2QRDB 3NDIA 3TDHB 4XX2A 2F4MA 5LL6f 3IR7A 3JAMb 3CD6Z 2JIMA 1LQLA 1VQ51 3CMA1 3J80f 5A2Qb 3G6E1 4EWCA 3D6WA 3QWUA 4NB9A 2QRCB 2H85A 2O4HA 3CCEZ 1YJ91 3CC71 1KQSY 4E2XA 2R7ZI 4DQYB 2E2II 2DE5A 3S1NI 3EERA 3CCS1 1W2BY 1TFIA 3M3YI 2NVTI 3I561 3CPWY 3GTPI 1DL6A 2Y0SA 4RS4A 4E30A 4MONA 2QA4Z 5FLXf 4NBAA 2R92I 2HF1A 2WB1A 1YJ9Z 1Q7Y2 3CC21 1VQM1 3GTQI 4RV9A 1R9TI 3JAMf 2OOXB 1VQ81 5IT9b 1Q812 2QR1B 4NH1C 1Y8CA 2GTHA 4X6AI 1SFOI 5IP7I 3GKQA 3CCVZ 4RVFA 3CC4Z 1M1K2 2OTLZ 3J7A4 5A2Qf 3F3FC 4MD8A 1NP6A 4DGLA 3OW2Z 1NJI1 2V8JA 2JIPA 1Q811 1JJ2Y 1KC81 2K3RA 2JA6I 1YITZ 4QTUA 1RO2A 2OOYB 2IZ3A 3ESWA 1ZH1A 3GTOI 2JA5I 1N8R2 2G2KA 3FKII 3I4MI 4NBDA 2V8IA 1QYPA 4HGZA 4NBHA 4MD9A 5D1OB 3CCRZ 2HU9A 1Q861 3OW2Y 5FLXb 1K731 2AKLA 2E2HI 4AYBA 2VUGA 1I6HI 4RVGA 1VQ4Z 1TWCI 4QTTA 3CCJ1 3GTMS 1TWFI 3IFUA 1VQK1 1JJ2Z 2V8KA 3GTJI 1Z02A 3S1QI 4DK1A 3CCQZ 4NBEA 3NFZA 5IT9f 1K732 3RZDI 1RLYA 1N2FA 3VTNA 1WZNA 2LEXA 1NJI2 3S2HI 1VQ8Z 3M4OI 2E7ZA 2DE6A 1AA6A 4NBCA 1WCMI 1RO0A 4NOZA 2VUMI 3D9XA 5IP9I 1YHQZ 2VPWA 4BXXI 1TWGI 2K5RA 3CCUZ 1QVFY 5C4JI 1Y1WI 3I551 3HOVI 3S16I 2P28A 3VMIA 2RT9A 3G6EZ 4MRIA 3FQMA 4BBSI 1S72Z 3IX0A 3GTGI 5D1PA 1X3ZA 2E2JI 1VQN1 3CC41 1K83I 4A3GI 2JMOA 2LIYA 1VLAA 2RIQA 1VQPZ 1Q821 2M6NA 3MONA 1VQ7Z 4Y52I 3NH8A 3CCMZ 4A3FI 1VQNZ 3J80b 3CCJZ 1YIT1 2NVQI 5C4XI 4CL1A 1Q16A 1P9NA 2QEXZ 3GTLI 3KIHA 3S14I 2I3CA 2WAQA 3MZKB 2W03A 2RPRA 2PM9A 2NVYI 4A3EI 2YU9I 3H3VJ 1ZB9A 3Q87A 1WJ2A 1VQP1
chains in the Genus database with same CATH topology
4NBGA 5FLMI 1PFTA 2QEX1 3IF8A 3HOUI 1VQ6Z 3P5JB 3CCL1 2QLVB 4A3DI 3FQQA 2LFUA 1Z01A 3G4SZ 3NDJA 3NH4A 3BG1B 2GU2A 3K7AI 4BY1I 4E2YA 3CMEZ 4MD7A 2QREB 3CPWZ 1VQO1 1TWAI 1Q822 2OTL1 2VF1A 4NBBA 1X3WA 3GCFA 2W04A 4E2WA 1YJNZ 4HGYA 4E31A 2JR6A 1KQSZ 1VQLZ 3H0GI 3CCU1 1VQL1 3I55Z 1Y1VI 2Q51A 3GTMI 4E32A 1YIJZ 1TWHI 1RNIA 2PMZA 1K8A2 2RHBA 4MXUA 3EEDA 3I07A 2NVXI 1WIIA 2JA8I 3HOWI 3BG0B 1YI21 4NB8A 4A3II 3CCSZ 1K8A1 4E33A 3VB9A 1QVGY 1K9M2 1QVGZ 3F3PC 4RVHA 3VMHA 3HOYI 3HOXI 1M1K1 3T4NB 1YHQ1 1Q862 3S17I 2PK7A 3G4S1 2R93I 1VQ61 1M902 2BJOA 3G71Z 3TE5B 3CXCZ 1X0TA 1KC82 1YIJ1 3CC2Z 5AN9F 2ZAEB 2M48A 1Q7Y1 4A93I 4HH4A 1S721 1ML8A 2E9HA 1M901 1YJW1 4NFRA 3S2DI 1W2BZ 4TNUA 3CXCY 2KPIA 1QF8A 1KRLA 2JUBA 3CCM1 1YJWZ 1USPA 3GTKI 2P3YA 1S7MA 3NH5A 1Z03A 3CCR1 1QVFZ 3S1RI 2R6MA 2OTJZ 3I4NI 4NBFA 5T64A 5C44I 5C3EI 1K9M1 3CME1 4BBRI 1VQ91 1VQOZ 3LUSA 4Y7NI 4E2ZA 1I3QI 4A3JI 3HKZA 1N8R1 2QKDA 3PO3I 1JWHC 1L1OC 1KD11 1Y1VS 3CMAZ 2IZ4A 1VQ41 1VQ71 3PO2I 4A3LI 1YI2Z 1VQ9Z 3G711 3RZOI 3S15I 1YJN1 3J81f 1RO4A 2JA7I 1VQ5Z 3I56Z 3VMGA 1NUIA 1KD12 2Q4ZA 2JNYA 2OZKA 2JS4A 1VQKZ 3CCQ1 2J6AA 4RVDA 3CCLZ 4A3BI 5CM2M 2YADA 1YUKA 3S1MI 3MZLB 3CCV1 1I50I 1USPB 2QA41 2EGTA 2DE7A 1ZB8A 4A3MI 1YUAA 5T6BA 3CD61 2O53A 1VQMZ 1WW9A 3PO3S 2B63I 5T67A 4BY7I 3HOZI 5D1OA 2KI7B 1RQFA 2OTJ1 3U50C 3J81b 3CQZI 2RBLA 2F4OA 4A3CI 4MH4A 3KIFA 4A3KI 3CCE1 4S1TA 3CC7Z 2GTIA 2QRDB 3NDIA 3TDHB 4XX2A 2F4MA 5LL6f 3JAMb 3CD6Z 1LQLA 1VQ51 3CMA1 3J80f 5A2Qb 3G6E1 4EWCA 3D6WA 3QWUA 4NB9A 2QRCB 2H85A 2O4HA 3CCEZ 1YJ91 3CC71 1KQSY 4E2XA 2R7ZI 4DQYB 2E2II 2DE5A 3S1NI 3EERA 3CCS1 1W2BY 1TFIA 3M3YI 2NVTI 3I561 3CPWY 3GTPI 1DL6A 2Y0SA 4RS4A 4E30A 4MONA 2QA4Z 5FLXf 4NBAA 2R92I 2HF1A 2WB1A 1YJ9Z 1Q7Y2 3CC21 1VQM1 3GTQI 4RV9A 1R9TI 3JAMf 2OOXB 1VQ81 5IT9b 1Q812 2QR1B 4NH1C 2GTHA 4X6AI 1SFOI 5IP7I 3GKQA 3CCVZ 4RVFA 3CC4Z 1M1K2 2OTLZ 3J7A4 5A2Qf 3F3FC 4MD8A 1NP6A 4DGLA 3OW2Z 1NJI1 2V8JA 1Q811 1JJ2Y 1KC81 2K3RA 2JA6I 1YITZ 4QTUA 1RO2A 2OOYB 2IZ3A 3ESWA 1ZH1A 3GTOI 2JA5I 1N8R2 2G2KA 3FKII 3I4MI 4NBDA 2V8IA 1QYPA 4HGZA 4NBHA 4MD9A 5D1OB 3CCRZ 2HU9A 1Q861 3OW2Y 5FLXb 1K731 2AKLA 2E2HI 4AYBA 2VUGA 1I6HI 4RVGA 1VQ4Z 1TWCI 4QTTA 3CCJ1 3GTMS 1TWFI 3IFUA 1VQK1 1JJ2Z 2V8KA 3GTJI 1Z02A 3S1QI 4DK1A 3CCQZ 4NBEA 3NFZA 5IT9f 1K732 3RZDI 1RLYA 1N2FA 3VTNA 1NJI2 3S2HI 1VQ8Z 3M4OI 2DE6A 4NBCA 1WCMI 1RO0A 4NOZA 2VUMI 3D9XA 5IP9I 1YHQZ 4BXXI 1TWGI 2K5RA 3CCUZ 1QVFY 5C4JI 1Y1WI 3I551 3HOVI 3S16I 2P28A 3VMIA 2RT9A 3G6EZ 4MRIA 3FQMA 4BBSI 1S72Z 3IX0A 3GTGI 5D1PA 1X3ZA 2E2JI 1VQN1 3CC41 1K83I 4A3GI 2JMOA 2LIYA 1VLAA 2RIQA 1VQPZ 1Q821 2M6NA 3MONA 1VQ7Z 4Y52I 3NH8A 3CCMZ 4A3FI 1VQNZ 3J80b 3CCJZ 1YIT1 2NVQI 5C4XI 4CL1A 1P9NA 2QEXZ 3GTLI 3KIHA 3S14I 2I3CA 2WAQA 3MZKB 2W03A 2RPRA 2PM9A 2NVYI 4A3EI 2YU9I 3H3VJ 1ZB9A 3Q87A 1VQP1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4M I;  4NBG A;  4NBD A;  5FLM I;  4XX2 A;  1PFT A;  3HOU I;  3S2D I;  2F4M A;  1QYP A;  2KPI A;  4NBH A;  4A3D I;  3GTK I;  1USP A;  1LQL A;  2P3Y A;  2AKL A;  2E2H I;  3K7A I;  1I6H I;  3S1R I;  4BY1 I;  3I4N I;  4NBF A;  1TWC I;  1TWA I;  5C44 I;  4QTT A;  3D6W A;  5C3E I;  4NBB A;  1TWF I;  4NB9 A;  3GTM S;  4BBR I;  1X3W A;  3GCF A;  3GTJ I;  3S1Q I;  3LUS A;  4Y7N I;  4NBE A;  2R7Z I;  1I3Q I;  4A3J I;  1RLY A;  1N2F A;  3RZD I;  2JR6 A;  3PO3 I;  2E2I I;  1L1O C;  2DE5 A;  3S1N I;  3EER A;  1Y1V S;  3S2H I;  3M4O I;  3H0G I;  2DE6 A;  4NBC A;  1TFI A;  1WCM I;  3M3Y I;  2NVT I;  3PO2 I;  4NOZ A;  4A3L I;  2VUM I;  5IP9 I;  1Y1V I;  3GTP I;  3RZO I;  3S15 I;  4BXX I;  1TWG I;  2K5R A;  1DL6 A;  2JA7 I;  1RO4 A;  5C4J I;  3GTM I;  1Y1W I;  3VMG A;  3HOV I;  1NUI A;  1TWH I;  3S16 I;  3VMI A;  2JNY A;  4BBS I;  4NBA A;  3GTG I;  3I07 A;  2NVX I;  2R92 I;  1X3Z A;  2JS4 A;  2E2J I;  2HF1 A;  2JA8 I;  1K83 I;  3HOW I;  2J6A A;  4NB8 A;  4A3B I;  4A3G I;  3GTQ I;  5CM2 M;  1VLA A;  1R9T I;  4A3I I;  3S1M I;  3VB9 A;  1I50 I;  1USP B;  2DE7 A;  1ZB8 A;  4Y52 I;  3VMH A;  4X6A I;  3HOY I;  4A3M I;  5IP7 I;  3HOX I;  1SFO I;  1YUA A;  4A3F I;  3S17 I;  3GKQ A;  2PK7 A;  2NVQ I;  5C4X I;  1WW9 A;  2R93 I;  3PO3 S;  2B63 I;  4BY7 I;  3GTL I;  3HOZ I;  3S14 I;  3U50 C;  2BJO A;  2JA6 I;  3CQZ I;  2RBL A;  4QTU A;  2F4O A;  4A3C I;  4MH4 A;  2NVY I;  3ESW A;  3GTO I;  4A3E I;  2YU9 I;  3H3V J;  4A3K I;  2JA5 I;  1ZB9 A;  3Q87 A;  4A93 I;  1ML8 A;  3FKI I; 
#chains in the Genus database with same CATH topology
 4NBG A;  5FLM I;  1PFT A;  2QEX 1;  3IF8 A;  3HOU I;  1VQ6 Z;  1QXF A;  3P5J B;  3CCL 1;  2QLV B;  4A3D I;  3FQQ A;  2LFU A;  1Z01 A;  3G4S Z;  3NDJ A;  3NH4 A;  3BG1 B;  2GU2 A;  3K7A I;  4BY1 I;  4E2Y A;  3CME Z;  4MD7 A;  2QRE B;  3CPW Z;  1VQO 1;  1TWA I;  1Q82 2;  2OTL 1;  2VPX A;  2VF1 A;  4NBB A;  1X3W A;  3GCF A;  2W04 A;  4E2W A;  1YJN Z;  4HGY A;  4E31 A;  2JR6 A;  1KQS Z;  1VQL Z;  1FDO A;  3H0G I;  3CCU 1;  1VQL 1;  3I55 Z;  1Y1V I;  2Q51 A;  3GTM I;  2NAP A;  4E32 A;  1YIJ Z;  1TWH I;  1SIW A;  1RNI A;  2PMZ A;  1K8A 2;  2RHB A;  4MXU A;  3EED A;  3I07 A;  2NVX I;  1WII A;  2JA8 I;  3HOW I;  3BG0 B;  1YI2 1;  4NB8 A;  2V45 A;  4A3I I;  3CCS Z;  1K8A 1;  4E33 A;  3VB9 A;  1QVG Y;  1K9M 2;  1QVG Z;  3F3P C;  4RVH A;  3VMH A;  3HOY I;  3HOX I;  1M1K 1;  3T4N B;  1YHQ 1;  1Q86 2;  3S17 I;  2PK7 A;  3G4S 1;  1FDI A;  2R93 I;  1VQ6 1;  1M90 2;  2BJO A;  3G71 Z;  3TE5 B;  3CXC Z;  1X0T A;  1KC8 2;  1YIJ 1;  3CC2 Z;  5AN9 F;  2ZAE B;  2M48 A;  1Q7Y 1;  4A93 I;  4HH4 A;  1S72 1;  1ML8 A;  2E9H A;  1M90 1;  1YJW 1;  4NFR A;  3S2D I;  1W2B Z;  4TNU A;  3CXC Y;  2KPI A;  1QF8 A;  1KRL A;  2JUB A;  3CCM 1;  1YJW Z;  1USP A;  3GTK I;  2P3Y A;  1S7M A;  3NH5 A;  1Z03 A;  3CCR 1;  1QVF Z;  3S1R I;  2R6M A;  2OTJ Z;  3I4N I;  4NBF A;  5T64 A;  5C44 I;  5C3E I;  1K9M 1;  3CME 1;  4BBR I;  1VQ9 1;  1VQO Z;  3LUS A;  4Y7N I;  4E2Z A;  1I3Q I;  4A3J I;  3HKZ A;  1N8R 1;  2QKD A;  3PO3 I;  1JWH C;  1L1O C;  2VPY A;  1KD1 1;  1Y1V S;  3CMA Z;  2IZ4 A;  1VQ4 1;  1VQ7 1;  3PO2 I;  4A3L I;  2V3V A;  1YI2 Z;  1VQ9 Z;  3G71 1;  3RZO I;  3S15 I;  1YJN 1;  3J81 f;  1RO4 A;  2JA7 I;  1VQ5 Z;  3I56 Z;  3VMG A;  1NUI A;  1KD1 2;  2Q4Z A;  2JNY A;  2OZK A;  2AYD A;  2JS4 A;  1VQK Z;  3D2L A;  2IV2 X;  3CCQ 1;  2J6A A;  4RVD A;  3CCL Z;  4A3B I;  5CM2 M;  2YAD A;  1YUK A;  3S1M I;  3MZL B;  3CCV 1;  1I50 I;  1USP B;  2QA4 1;  2EGT A;  2DE7 A;  1ZB8 A;  4A3M I;  1YUA A;  5T6B A;  3CD6 1;  2VPZ A;  2JIO A;  2O53 A;  1VQM Z;  1WW9 A;  3PO3 S;  2B63 I;  5T67 A;  4BY7 I;  3HOZ I;  5D1O A;  2KI7 B;  1RQF A;  2OTJ 1;  3U50 C;  3J81 b;  3CQZ I;  2RBL A;  2F4O A;  4A3C I;  4MH4 A;  2JIQ A;  2JIR A;  3KIF A;  4A3K I;  3CCE 1;  4S1T A;  3CC7 Z;  2GTI A;  2QRD B;  3NDI A;  3TDH B;  4XX2 A;  2F4M A;  5LL6 f;  3IR7 A;  3JAM b;  3CD6 Z;  2JIM A;  1LQL A;  1VQ5 1;  3CMA 1;  3J80 f;  5A2Q b;  3G6E 1;  4EWC A;  3D6W A;  3QWU A;  4NB9 A;  2QRC B;  2H85 A;  2O4H A;  3CCE Z;  1YJ9 1;  3CC7 1;  1KQS Y;  4E2X A;  2R7Z I;  4DQY B;  2E2I I;  2DE5 A;  3S1N I;  3EER A;  3CCS 1;  1W2B Y;  1TFI A;  3M3Y I;  2NVT I;  3I56 1;  3CPW Y;  3GTP I;  1DL6 A;  2Y0S A;  4RS4 A;  4E30 A;  4MON A;  2QA4 Z;  5FLX f;  4NBA A;  2R92 I;  2HF1 A;  2WB1 A;  1YJ9 Z;  1Q7Y 2;  3CC2 1;  1VQM 1;  3GTQ I;  4RV9 A;  1R9T I;  3JAM f;  2OOX B;  1VQ8 1;  5IT9 b;  1Q81 2;  2QR1 B;  4NH1 C;  1Y8C A;  2GTH A;  4X6A I;  1SFO I;  5IP7 I;  3GKQ A;  3CCV Z;  4RVF A;  3CC4 Z;  1M1K 2;  2OTL Z;  3J7A 4;  5A2Q f;  3F3F C;  4MD8 A;  1NP6 A;  4DGL A;  3OW2 Z;  1NJI 1;  2V8J A;  2JIP A;  1Q81 1;  1JJ2 Y;  1KC8 1;  2K3R A;  2JA6 I;  1YIT Z;  4QTU A;  1RO2 A;  2OOY B;  2IZ3 A;  3ESW A;  1ZH1 A;  3GTO I;  2JA5 I;  1N8R 2;  2G2K A;  3FKI I;  3I4M I;  4NBD A;  2V8I A;  1QYP A;  4HGZ A;  4NBH A;  4MD9 A;  5D1O B;  3CCR Z;  2HU9 A;  1Q86 1;  3OW2 Y;  5FLX b;  1K73 1;  2AKL A;  2E2H I;  4AYB A;  2VUG A;  1I6H I;  4RVG A;  1VQ4 Z;  1TWC I;  4QTT A;  3CCJ 1;  3GTM S;  1TWF I;  3IFU A;  1VQK 1;  1JJ2 Z;  2V8K A;  3GTJ I;  1Z02 A;  3S1Q I;  4DK1 A;  3CCQ Z;  4NBE A;  3NFZ A;  5IT9 f;  1K73 2;  3RZD I;  1RLY A;  1N2F A;  3VTN A;  1WZN A;  2LEX A;  1NJI 2;  3S2H I;  1VQ8 Z;  3M4O I;  2E7Z A;  2DE6 A;  1AA6 A;  4NBC A;  1WCM I;  1RO0 A;  4NOZ A;  2VUM I;  3D9X A;  5IP9 I;  1YHQ Z;  2VPW A;  4BXX I;  1TWG I;  2K5R A;  3CCU Z;  1QVF Y;  5C4J I;  1Y1W I;  3I55 1;  3HOV I;  3S16 I;  2P28 A;  3VMI A;  2RT9 A;  3G6E Z;  4MRI A;  3FQM A;  4BBS I;  1S72 Z;  3IX0 A;  3GTG I;  5D1P A;  1X3Z A;  2E2J I;  1VQN 1;  3CC4 1;  1K83 I;  4A3G I;  2JMO A;  2LIY A;  1VLA A;  2RIQ A;  1VQP Z;  1Q82 1;  2M6N A;  3MON A;  1VQ7 Z;  4Y52 I;  3NH8 A;  3CCM Z;  4A3F I;  1VQN Z;  3J80 b;  3CCJ Z;  1YIT 1;  2NVQ I;  5C4X I;  4CL1 A;  1Q16 A;  1P9N A;  2QEX Z;  3GTL I;  3KIH A;  3S14 I;  2I3C A;  2WAQ A;  3MZK B;  2W03 A;  2RPR A;  2PM9 A;  2NVY I;  4A3E I;  2YU9 I;  3H3V J;  1ZB9 A;  3Q87 A;  1WJ2 A;  1VQP 1; 
#chains in the Genus database with same CATH homology
 4NBG A;  5FLM I;  1PFT A;  2QEX 1;  3IF8 A;  3HOU I;  1VQ6 Z;  3P5J B;  3CCL 1;  2QLV B;  4A3D I;  3FQQ A;  2LFU A;  1Z01 A;  3G4S Z;  3NDJ A;  3NH4 A;  3BG1 B;  2GU2 A;  3K7A I;  4BY1 I;  4E2Y A;  3CME Z;  4MD7 A;  2QRE B;  3CPW Z;  1VQO 1;  1TWA I;  1Q82 2;  2OTL 1;  2VF1 A;  4NBB A;  1X3W A;  3GCF A;  2W04 A;  4E2W A;  1YJN Z;  4HGY A;  4E31 A;  2JR6 A;  1KQS Z;  1VQL Z;  3H0G I;  3CCU 1;  1VQL 1;  3I55 Z;  1Y1V I;  2Q51 A;  3GTM I;  4E32 A;  1YIJ Z;  1TWH I;  1RNI A;  2PMZ A;  1K8A 2;  2RHB A;  4MXU A;  3EED A;  3I07 A;  2NVX I;  1WII A;  2JA8 I;  3HOW I;  3BG0 B;  1YI2 1;  4NB8 A;  4A3I I;  3CCS Z;  1K8A 1;  4E33 A;  3VB9 A;  1QVG Y;  1K9M 2;  1QVG Z;  3F3P C;  4RVH A;  3VMH A;  3HOY I;  3HOX I;  1M1K 1;  3T4N B;  1YHQ 1;  1Q86 2;  3S17 I;  2PK7 A;  3G4S 1;  2R93 I;  1VQ6 1;  1M90 2;  2BJO A;  3G71 Z;  3TE5 B;  3CXC Z;  1X0T A;  1KC8 2;  1YIJ 1;  3CC2 Z;  5AN9 F;  2ZAE B;  2M48 A;  1Q7Y 1;  4A93 I;  4HH4 A;  1S72 1;  1ML8 A;  2E9H A;  1M90 1;  1YJW 1;  4NFR A;  3S2D I;  1W2B Z;  4TNU A;  3CXC Y;  2KPI A;  1QF8 A;  1KRL A;  2JUB A;  3CCM 1;  1YJW Z;  1USP A;  3GTK I;  2P3Y A;  1S7M A;  3NH5 A;  1Z03 A;  3CCR 1;  1QVF Z;  3S1R I;  2R6M A;  2OTJ Z;  3I4N I;  4NBF A;  5T64 A;  5C44 I;  5C3E I;  1K9M 1;  3CME 1;  4BBR I;  1VQ9 1;  1VQO Z;  3LUS A;  4Y7N I;  4E2Z A;  1I3Q I;  4A3J I;  3HKZ A;  1N8R 1;  2QKD A;  3PO3 I;  1JWH C;  1L1O C;  1KD1 1;  1Y1V S;  3CMA Z;  2IZ4 A;  1VQ4 1;  1VQ7 1;  3PO2 I;  4A3L I;  1YI2 Z;  1VQ9 Z;  3G71 1;  3RZO I;  3S15 I;  1YJN 1;  3J81 f;  1RO4 A;  2JA7 I;  1VQ5 Z;  3I56 Z;  3VMG A;  1NUI A;  1KD1 2;  2Q4Z A;  2JNY A;  2OZK A;  2JS4 A;  1VQK Z;  3CCQ 1;  2J6A A;  4RVD A;  3CCL Z;  4A3B I;  5CM2 M;  2YAD A;  1YUK A;  3S1M I;  3MZL B;  3CCV 1;  1I50 I;  1USP B;  2QA4 1;  2EGT A;  2DE7 A;  1ZB8 A;  4A3M I;  1YUA A;  5T6B A;  3CD6 1;  2O53 A;  1VQM Z;  1WW9 A;  3PO3 S;  2B63 I;  5T67 A;  4BY7 I;  3HOZ I;  5D1O A;  2KI7 B;  1RQF A;  2OTJ 1;  3U50 C;  3J81 b;  3CQZ I;  2RBL A;  2F4O A;  4A3C I;  4MH4 A;  3KIF A;  4A3K I;  3CCE 1;  4S1T A;  3CC7 Z;  2GTI A;  2QRD B;  3NDI A;  3TDH B;  4XX2 A;  2F4M A;  5LL6 f;  3JAM b;  3CD6 Z;  1LQL A;  1VQ5 1;  3CMA 1;  3J80 f;  5A2Q b;  3G6E 1;  4EWC A;  3D6W A;  3QWU A;  4NB9 A;  2QRC B;  2H85 A;  2O4H A;  3CCE Z;  1YJ9 1;  3CC7 1;  1KQS Y;  4E2X A;  2R7Z I;  4DQY B;  2E2I I;  2DE5 A;  3S1N I;  3EER A;  3CCS 1;  1W2B Y;  1TFI A;  3M3Y I;  2NVT I;  3I56 1;  3CPW Y;  3GTP I;  1DL6 A;  2Y0S A;  4RS4 A;  4E30 A;  4MON A;  2QA4 Z;  5FLX f;  4NBA A;  2R92 I;  2HF1 A;  2WB1 A;  1YJ9 Z;  1Q7Y 2;  3CC2 1;  1VQM 1;  3GTQ I;  4RV9 A;  1R9T I;  3JAM f;  2OOX B;  1VQ8 1;  5IT9 b;  1Q81 2;  2QR1 B;  4NH1 C;  2GTH A;  4X6A I;  1SFO I;  5IP7 I;  3GKQ A;  3CCV Z;  4RVF A;  3CC4 Z;  1M1K 2;  2OTL Z;  3J7A 4;  5A2Q f;  3F3F C;  4MD8 A;  1NP6 A;  4DGL A;  3OW2 Z;  1NJI 1;  2V8J A;  1Q81 1;  1JJ2 Y;  1KC8 1;  2K3R A;  2JA6 I;  1YIT Z;  4QTU A;  1RO2 A;  2OOY B;  2IZ3 A;  3ESW A;  1ZH1 A;  3GTO I;  2JA5 I;  1N8R 2;  2G2K A;  3FKI I;  3I4M I;  4NBD A;  2V8I A;  1QYP A;  4HGZ A;  4NBH A;  4MD9 A;  5D1O B;  3CCR Z;  2HU9 A;  1Q86 1;  3OW2 Y;  5FLX b;  1K73 1;  2AKL A;  2E2H I;  4AYB A;  2VUG A;  1I6H I;  4RVG A;  1VQ4 Z;  1TWC I;  4QTT A;  3CCJ 1;  3GTM S;  1TWF I;  3IFU A;  1VQK 1;  1JJ2 Z;  2V8K A;  3GTJ I;  1Z02 A;  3S1Q I;  4DK1 A;  3CCQ Z;  4NBE A;  3NFZ A;  5IT9 f;  1K73 2;  3RZD I;  1RLY A;  1N2F A;  3VTN A;  1NJI 2;  3S2H I;  1VQ8 Z;  3M4O I;  2DE6 A;  4NBC A;  1WCM I;  1RO0 A;  4NOZ A;  2VUM I;  3D9X A;  5IP9 I;  1YHQ Z;  4BXX I;  1TWG I;  2K5R A;  3CCU Z;  1QVF Y;  5C4J I;  1Y1W I;  3I55 1;  3HOV I;  3S16 I;  2P28 A;  3VMI A;  2RT9 A;  3G6E Z;  4MRI A;  3FQM A;  4BBS I;  1S72 Z;  3IX0 A;  3GTG I;  5D1P A;  1X3Z A;  2E2J I;  1VQN 1;  3CC4 1;  1K83 I;  4A3G I;  2JMO A;  2LIY A;  1VLA A;  2RIQ A;  1VQP Z;  1Q82 1;  2M6N A;  3MON A;  1VQ7 Z;  4Y52 I;  3NH8 A;  3CCM Z;  4A3F I;  1VQN Z;  3J80 b;  3CCJ Z;  1YIT 1;  2NVQ I;  5C4X I;  4CL1 A;  1P9N A;  2QEX Z;  3GTL I;  3KIH A;  3S14 I;  2I3C A;  2WAQ A;  3MZK B;  2W03 A;  2RPR A;  2PM9 A;  2NVY I;  4A3E I;  2YU9 I;  3H3V J;  1ZB9 A;  3Q87 A;  1VQP 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...