3K7AI

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
118
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEASPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 9
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI02
5C3EI 1WW9A 3S1MI 1I3QI 4A3DI 4A3CI 4MH4A 4A3FI 2JA8I 2JNYA 3GTPI 3U50C 3S16I 2JA7I 3S1QI 3HOYI 2NVXI 3GTGI 5FLMI 5C44I 2BJOA 1N2FA 3PO2I 5CM2M 4NBFA 1Y1WI 4NB9A 4XX2A 1X3WA 5IP9I 3FKII 3VB9A 1RO4A 2E2II 3S2HI 2PK7A 2R93I 4BBRI 3RZOI 4BBSI 3RZDI 1TWFI 3Q87A 1LQLA 2JR6A 1WCMI 4NBCA 4BY7I 4NBAA 1L1OC 3S1RI 4BY1I 3PO3I 4NBBA 2F4OA 1SFOI 1TWGI 3I4MI 3GTQI 2DE7A 1K83I 1ZB9A 4A3BI 5C4JI 2R92I 4NBHA 3GTJI 3D6WA 3GTLI 2J6AA 2P3YA 3M4OI 3LUSA 1R9TI 2DE5A 2F4MA 3EERA 3HOWI 3HOZI 1Y1VS 1ML8A 5C4XI 4QTUA 4A3JI 4A3MI 2RBLA 1TWAI 2KPIA 3H0GI 3S1NI 4A3EI 3K7AI 4A3KI 4A3II 2VUMI 4A3LI 4NBDA 2NVTI 4QTTA 3HOVI 4NBEA 3VMIA 4Y52I 1USPA 3HOXI 2B63I 5IP7I 1TWHI 3S2DI 2K5RA 3CQZI 3VMGA 3I07A 3GTMS 1TFIA 3GTOI 1RLYA 3S15I 1VLAA 1QYPA 3S14I 2YU9I 1Y1VI 4BXXI 1I6HI 2JA6I 4NOZA 3PO3S 2E2JI 1TWCI 4NB8A 3ESWA 2NVYI 1NUIA 1ZB8A 3GKQA 4NBGA 2E2HI 2NVQI 3M3YI 3VMHA 1PFTA 3I4NI 3H3VJ 4Y7NI 3GCFA 3HOUI 1USPB 2R7ZI 4A93I 4X6AI 2JS4A 1I50I 2JA5I 1YUAA 1X3ZA 3GTKI 2AKLA 3GTMI 3S17I 1DL6A 4A3GI 2HF1A 2DE6A
chains in the Genus database with same CATH superfamily
5C3EI 1YJW1 4A3DI 2IV2X 4A3FI 2JA8I 2PM9A 1VQM1 3U50C 2QEXZ 4RVHA 2NVXI 1VQN1 3CCE1 4TNUA 2OOXB 4XX2A 5IP9I 3CC41 2OTJ1 3VB9A 2E2II 2QRDB 4BBSI 3CCU1 3Q87A 2O4HA 1WCMI 2QA41 3PO3I 1S72Z 4MD7A 2F4OA 3CC7Z 1K83I 1ZB9A 4A3BI 1NP6A 3GTLI 4AYBA 3M4OI 2ZAEB 2V8JA 3HOWI 4MD8A 4HGYA 1ML8A 2QEX1 3CCQ1 4A3MI 1TWAI 3H0GI 3S1NI 3P5JB 4MD9A 2LIYA 1Q862 2VUMI 4NBDA 2NVTI 1VQ61 1X0TA 2OOYB 1K9M1 2VPWA 5IP7I 3S15I 5FLXb 4MXUA 1JJ2Y 1YUKA 1JJ2Z 4RS4A 3CCS1 1KQSZ 2YU9I 1Y1VI 1S7MA 3G4S1 3JAMb 2NAPA 4NB8A 1QVGZ 4RVGA 3I561 2NVYI 1YI21 3GKQA 3VMHA 2R6MA 1K731 1YIT1 1YJWZ 1VQ41 3MZLB 4Y7NI 2R7ZI 3D2LA 5T64A 4MONA 2VPZA 1VQMZ 1I50I 2AKLA 4DQYB 1DL6A 2QRCB 2OTL1 2QKDA 1Z03A 3J81f 1VQNZ 1Y8CA 3CCL1 1KRLA 1WW9A 2GU2A 1I3QI 3CCEZ 4A3CI 4MH4A 1VQO1 3CC4Z 2OTJZ 1VQL1 2JA7I 1YHQ1 1WZNA 3CCUZ 3TDHB 3GTGI 2VUGA 1K9M2 2BJOA 4E31A 3PO2I 5CM2M 1Y1WI 2QA4Z 1X3WA 3FKII 3NDJA 3F3FC 3EEDA 1TWFI 1LQLA 2QREB 2QLVB 4NBCA 1Q861 1TWGI 3CCQZ 1VQ8Z 5C4JI 4NBHA 1M901 2J6AA 3LUSA 1K732 1R9TI 3KIHA 2Q4ZA 3HOZI 4E32A 3CCV1 2YADA 1VQ6Z 3CD61 3G6E1 5C4XI 4QTUA 2RBLA 1Q812 1M1K2 3CCSZ 3HOVI 3VMIA 1WIIA 3G4SZ 3IX0A 3S2DI 2GTHA 3FQQA 3I56Z 1TFIA 1RNIA 1YI2Z 3QWUA 2Y0SA 2JIPA 4MRIA 2JUBA 3J80f 1YITZ 1YIJ1 2KI7B 1VQ81 1VQ4Z 3CPWY 4NOZA 3I551 1I6HI 5D1OA 3PO3S 3NFZA 2VPXA 1RO2A 3NH4A 1NUIA 1VQ91 2E2HI 1AA6A 2OTLZ 3IFUA 3I4NI 3CCLZ 3H3VJ 2E7ZA 3GCFA 1M902 1VQOZ 3G711 4S1TA 4X6AI 1FDIA 1VQLZ 1ZH1A 1YHQZ 5D1PA 3HKZA 1VQ51 1RO0A 2P3YA 1K8A1 2LFUA 2W03A 5D1OB 3OW2Y 3OW2Z 1YJ91 3GTPI 2W04A 4NH1C 3S16I 2QR1B 3D9XA 3HOYI 1Q7Y1 5FLMI 2V8IA 4RVDA 1W2BY 3CMA1 1W2BZ 1YJN1 2E9HA 2V45A 3S2HI 5LL6f 3RZDI 4E2WA 1Q811 5T6BA 3IR7A 1M1K1 1Q822 1Q16A 1L1OC 3CCVZ 3S1RI 4BY1I 2M48A 3CD6Z 3G6EZ 3MONA 3I4MI 3FQMA 2DE7A 2WAQA 3J81b 1VQ71 3D6WA 3CME1 3BG0B 2DE5A 3IF8A 3CCJ1 3NH5A 2F4MA 1NJI2 3EERA 2RIQA 4NFRA 4EWCA 1SIWA 4A3JI 2VF1A 2KPIA 1K8A2 4A3EI 1VQP1 1KD11 4A3KI 4A3II 4QTTA 4NBEA 3KIFA 1YIJZ 2VPYA 1USPA 3I55Z 2B63I 2V8KA 1Z01A 2K5RA 1Q7Y2 3VMGA 1JWHC 3I07A 3GTMS 1RLYA 1Z02A 1VQ9Z 1P9NA 1VLAA 3CCR1 3S14I 4DGLA 2E2JI 1TWCI 2JIRA 3G71Z 2JIOA 4HH4A 1ZB8A 4NBGA 2NVQI 3M3YI 1QF8A 1VQ5Z 2HU9A 3TE5B 1VQK1 1USPB 3T4NB 2M6NA 4HGZA 1YJ9Z 2JA5I 1X3ZA 3CC21 3VTNA 1QXFA 4A3GI 2HF1A 3S1MI 3CPWZ 1Q821 1KC82 2V3VA 3CMAZ 4RVFA 3CCM1 1YJNZ 2JNYA 1KD12 2IZ3A 2K3RA 3S1QI 3NH8A 1FDOA 2H85A 4E30A 5C44I 2JIMA 3J80b 1N2FA 1NJI1 4NBFA 1N8R1 4NB9A 4E33A 3F3PC 2EGTA 1RO4A 2PK7A 2R93I 2GTIA 4BBRI 3RZOI 1QVFY 1VQ7Z 1QVFZ 3CMEZ 2JR6A 3CCJZ 4BY7I 5FLXf 4NBAA 2RT9A 2Q51A 2RHBA 4NBBA 3CXCY 1SFOI 3CXCZ 2P28A 3GTQI 2R92I 1WJ2A 3JAMf 3GTJI 5IT9f 2LEXA 2RPRA 1VQPZ 2JIQA 5AN9F 1Y1VS 2O53A 1KQSY 1S721 3CC71 3BG1B 4RV9A 1QVGY 5IT9b 5A2Qf 3K7AI 4A3LI 2WB1A 2OZKA 3CCRZ 4E2ZA 4Y52I 3HOXI 1TWHI 3CQZI 2IZ4A 5A2Qb 3GTOI 5T67A 1N8R2 1QYPA 4BXXI 1KC81 1VQKZ 2JA6I 4DK1A 3ESWA 2PMZA 2AYDA 4E2YA 3CC2Z 2G2KA 1PFTA 3J7A4 3NDIA 3MZKB 3HOUI 3CCMZ 4A93I 2JS4A 2JMOA 1YUAA 3GTKI 1RQFA 3GTMI 4E2XA 2I3CA 3S17I 4CL1A 2DE6A
chains in the Genus database with same CATH topology
5C3EI 1YJW1 4A3DI 4A3FI 2JA8I 2PM9A 1VQM1 3U50C 2QEXZ 4RVHA 2NVXI 1VQN1 3CCE1 4TNUA 2OOXB 4XX2A 5IP9I 3CC41 2OTJ1 3VB9A 2E2II 2QRDB 4BBSI 3CCU1 3Q87A 2O4HA 1WCMI 2QA41 3PO3I 1S72Z 4MD7A 2F4OA 3CC7Z 1K83I 1ZB9A 4A3BI 1NP6A 3GTLI 4AYBA 3M4OI 2ZAEB 2V8JA 3HOWI 4MD8A 4HGYA 1ML8A 2QEX1 3CCQ1 4A3MI 1TWAI 3H0GI 3S1NI 3P5JB 4MD9A 2LIYA 1Q862 2VUMI 4NBDA 2NVTI 1VQ61 1X0TA 2OOYB 1K9M1 5IP7I 3S15I 5FLXb 4MXUA 1JJ2Y 1YUKA 1JJ2Z 4RS4A 3CCS1 1KQSZ 2YU9I 1Y1VI 1S7MA 3G4S1 3JAMb 4NB8A 1QVGZ 4RVGA 3I561 2NVYI 1YI21 3GKQA 3VMHA 2R6MA 1K731 1YIT1 1YJWZ 1VQ41 3MZLB 4Y7NI 2R7ZI 5T64A 4MONA 1VQMZ 1I50I 2AKLA 4DQYB 1DL6A 2QRCB 2OTL1 2QKDA 1Z03A 3J81f 1VQNZ 3CCL1 1KRLA 1WW9A 2GU2A 1I3QI 3CCEZ 4A3CI 4MH4A 1VQO1 3CC4Z 2OTJZ 1VQL1 2JA7I 1YHQ1 3CCUZ 3TDHB 3GTGI 2VUGA 1K9M2 2BJOA 4E31A 3PO2I 5CM2M 1Y1WI 2QA4Z 1X3WA 3FKII 3NDJA 3F3FC 3EEDA 1TWFI 1LQLA 2QREB 2QLVB 4NBCA 1Q861 1TWGI 3CCQZ 1VQ8Z 5C4JI 4NBHA 1M901 2J6AA 3LUSA 1K732 1R9TI 3KIHA 2Q4ZA 3HOZI 4E32A 3CCV1 2YADA 1VQ6Z 3CD61 3G6E1 5C4XI 4QTUA 2RBLA 1Q812 1M1K2 3CCSZ 3HOVI 3VMIA 1WIIA 3G4SZ 3IX0A 3S2DI 2GTHA 3FQQA 3I56Z 1TFIA 1RNIA 1YI2Z 3QWUA 2Y0SA 4MRIA 2JUBA 3J80f 1YITZ 1YIJ1 2KI7B 1VQ81 1VQ4Z 3CPWY 4NOZA 3I551 1I6HI 5D1OA 3PO3S 3NFZA 1RO2A 3NH4A 1NUIA 1VQ91 2E2HI 2OTLZ 3IFUA 3I4NI 3CCLZ 3H3VJ 3GCFA 1M902 1VQOZ 3G711 4S1TA 4X6AI 1VQLZ 1ZH1A 1YHQZ 5D1PA 3HKZA 1VQ51 1RO0A 2P3YA 1K8A1 2LFUA 2W03A 5D1OB 3OW2Y 3OW2Z 1YJ91 3GTPI 2W04A 4NH1C 3S16I 2QR1B 3D9XA 3HOYI 1Q7Y1 5FLMI 2V8IA 4RVDA 1W2BY 3CMA1 1W2BZ 1YJN1 2E9HA 3S2HI 5LL6f 3RZDI 4E2WA 1Q811 5T6BA 1M1K1 1Q822 1L1OC 3CCVZ 3S1RI 4BY1I 2M48A 3CD6Z 3G6EZ 3MONA 3I4MI 3FQMA 2DE7A 2WAQA 3J81b 1VQ71 3D6WA 3CME1 3BG0B 2DE5A 3IF8A 3CCJ1 3NH5A 2F4MA 1NJI2 3EERA 2RIQA 4NFRA 4EWCA 4A3JI 2VF1A 2KPIA 1K8A2 4A3EI 1VQP1 1KD11 4A3KI 4A3II 4QTTA 4NBEA 3KIFA 1YIJZ 1USPA 3I55Z 2B63I 2V8KA 1Z01A 2K5RA 1Q7Y2 3VMGA 1JWHC 3I07A 3GTMS 1RLYA 1Z02A 1VQ9Z 1P9NA 1VLAA 3CCR1 3S14I 4DGLA 2E2JI 1TWCI 3G71Z 4HH4A 1ZB8A 4NBGA 2NVQI 3M3YI 1QF8A 1VQ5Z 2HU9A 3TE5B 1VQK1 1USPB 3T4NB 2M6NA 4HGZA 1YJ9Z 2JA5I 1X3ZA 3CC21 3VTNA 4A3GI 2HF1A 3S1MI 3CPWZ 1Q821 1KC82 3CMAZ 4RVFA 3CCM1 1YJNZ 2JNYA 1KD12 2IZ3A 2K3RA 3S1QI 3NH8A 2H85A 4E30A 5C44I 3J80b 1N2FA 1NJI1 4NBFA 1N8R1 4NB9A 4E33A 3F3PC 2EGTA 1RO4A 2PK7A 2R93I 2GTIA 4BBRI 3RZOI 1QVFY 1VQ7Z 1QVFZ 3CMEZ 2JR6A 3CCJZ 4BY7I 5FLXf 4NBAA 2RT9A 2Q51A 2RHBA 4NBBA 3CXCY 1SFOI 3CXCZ 2P28A 3GTQI 2R92I 3JAMf 3GTJI 5IT9f 2RPRA 1VQPZ 5AN9F 1Y1VS 2O53A 1KQSY 1S721 3CC71 3BG1B 4RV9A 1QVGY 5IT9b 5A2Qf 3K7AI 4A3LI 2WB1A 2OZKA 3CCRZ 4E2ZA 4Y52I 3HOXI 1TWHI 3CQZI 2IZ4A 5A2Qb 3GTOI 5T67A 1N8R2 1QYPA 4BXXI 1KC81 1VQKZ 2JA6I 4DK1A 3ESWA 2PMZA 4E2YA 3CC2Z 2G2KA 1PFTA 3J7A4 3NDIA 3MZKB 3HOUI 3CCMZ 4A93I 2JS4A 2JMOA 1YUAA 3GTKI 1RQFA 3GTMI 4E2XA 2I3CA 3S17I 4CL1A 2DE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E I;  1WW9 A;  3S1M I;  1I3Q I;  4A3D I;  4A3C I;  4MH4 A;  4A3F I;  2JA8 I;  2JNY A;  3GTP I;  3U50 C;  3S16 I;  2JA7 I;  3S1Q I;  3HOY I;  2NVX I;  3GTG I;  5FLM I;  5C44 I;  2BJO A;  1N2F A;  3PO2 I;  5CM2 M;  4NBF A;  1Y1W I;  4NB9 A;  4XX2 A;  1X3W A;  5IP9 I;  3FKI I;  3VB9 A;  1RO4 A;  2E2I I;  3S2H I;  2PK7 A;  2R93 I;  4BBR I;  3RZO I;  4BBS I;  3RZD I;  1TWF I;  3Q87 A;  1LQL A;  2JR6 A;  1WCM I;  4NBC A;  4BY7 I;  4NBA A;  1L1O C;  3S1R I;  4BY1 I;  3PO3 I;  4NBB A;  2F4O A;  1SFO I;  1TWG I;  3I4M I;  3GTQ I;  2DE7 A;  1K83 I;  1ZB9 A;  4A3B I;  5C4J I;  2R92 I;  4NBH A;  3GTJ I;  3D6W A;  3GTL I;  2J6A A;  2P3Y A;  3M4O I;  3LUS A;  1R9T I;  2DE5 A;  2F4M A;  3EER A;  3HOW I;  3HOZ I;  1Y1V S;  1ML8 A;  5C4X I;  4QTU A;  4A3J I;  4A3M I;  2RBL A;  1TWA I;  2KPI A;  3H0G I;  3S1N I;  4A3E I;  3K7A I;  4A3K I;  4A3I I;  2VUM I;  4A3L I;  4NBD A;  2NVT I;  4QTT A;  3HOV I;  4NBE A;  3VMI A;  4Y52 I;  1USP A;  3HOX I;  2B63 I;  5IP7 I;  1TWH I;  3S2D I;  2K5R A;  3CQZ I;  3VMG A;  3I07 A;  3GTM S;  1TFI A;  3GTO I;  1RLY A;  3S15 I;  1VLA A;  1QYP A;  3S14 I;  2YU9 I;  1Y1V I;  4BXX I;  1I6H I;  2JA6 I;  4NOZ A;  3PO3 S;  2E2J I;  1TWC I;  4NB8 A;  3ESW A;  2NVY I;  1NUI A;  1ZB8 A;  3GKQ A;  4NBG A;  2E2H I;  2NVQ I;  3M3Y I;  3VMH A;  1PFT A;  3I4N I;  3H3V J;  4Y7N I;  3GCF A;  3HOU I;  1USP B;  2R7Z I;  4A93 I;  4X6A I;  2JS4 A;  1I50 I;  2JA5 I;  1YUA A;  1X3Z A;  3GTK I;  2AKL A;  3GTM I;  3S17 I;  1DL6 A;  4A3G I;  2HF1 A;  2DE6 A; 
#chains in the Genus database with same CATH topology
 5C3E I;  1YJW 1;  4A3D I;  2IV2 X;  4A3F I;  2JA8 I;  2PM9 A;  1VQM 1;  3U50 C;  2QEX Z;  4RVH A;  2NVX I;  1VQN 1;  3CCE 1;  4TNU A;  2OOX B;  4XX2 A;  5IP9 I;  3CC4 1;  2OTJ 1;  3VB9 A;  2E2I I;  2QRD B;  4BBS I;  3CCU 1;  3Q87 A;  2O4H A;  1WCM I;  2QA4 1;  3PO3 I;  1S72 Z;  4MD7 A;  2F4O A;  3CC7 Z;  1K83 I;  1ZB9 A;  4A3B I;  1NP6 A;  3GTL I;  4AYB A;  3M4O I;  2ZAE B;  2V8J A;  3HOW I;  4MD8 A;  4HGY A;  1ML8 A;  2QEX 1;  3CCQ 1;  4A3M I;  1TWA I;  3H0G I;  3S1N I;  3P5J B;  4MD9 A;  2LIY A;  1Q86 2;  2VUM I;  4NBD A;  2NVT I;  1VQ6 1;  1X0T A;  2OOY B;  1K9M 1;  2VPW A;  5IP7 I;  3S15 I;  5FLX b;  4MXU A;  1JJ2 Y;  1YUK A;  1JJ2 Z;  4RS4 A;  3CCS 1;  1KQS Z;  2YU9 I;  1Y1V I;  1S7M A;  3G4S 1;  3JAM b;  2NAP A;  4NB8 A;  1QVG Z;  4RVG A;  3I56 1;  2NVY I;  1YI2 1;  3GKQ A;  3VMH A;  2R6M A;  1K73 1;  1YIT 1;  1YJW Z;  1VQ4 1;  3MZL B;  4Y7N I;  2R7Z I;  3D2L A;  5T64 A;  4MON A;  2VPZ A;  1VQM Z;  1I50 I;  2AKL A;  4DQY B;  1DL6 A;  2QRC B;  2OTL 1;  2QKD A;  1Z03 A;  3J81 f;  1VQN Z;  1Y8C A;  3CCL 1;  1KRL A;  1WW9 A;  2GU2 A;  1I3Q I;  3CCE Z;  4A3C I;  4MH4 A;  1VQO 1;  3CC4 Z;  2OTJ Z;  1VQL 1;  2JA7 I;  1YHQ 1;  1WZN A;  3CCU Z;  3TDH B;  3GTG I;  2VUG A;  1K9M 2;  2BJO A;  4E31 A;  3PO2 I;  5CM2 M;  1Y1W I;  2QA4 Z;  1X3W A;  3FKI I;  3NDJ A;  3F3F C;  3EED A;  1TWF I;  1LQL A;  2QRE B;  2QLV B;  4NBC A;  1Q86 1;  1TWG I;  3CCQ Z;  1VQ8 Z;  5C4J I;  4NBH A;  1M90 1;  2J6A A;  3LUS A;  1K73 2;  1R9T I;  3KIH A;  2Q4Z A;  3HOZ I;  4E32 A;  3CCV 1;  2YAD A;  1VQ6 Z;  3CD6 1;  3G6E 1;  5C4X I;  4QTU A;  2RBL A;  1Q81 2;  1M1K 2;  3CCS Z;  3HOV I;  3VMI A;  1WII A;  3G4S Z;  3IX0 A;  3S2D I;  2GTH A;  3FQQ A;  3I56 Z;  1TFI A;  1RNI A;  1YI2 Z;  3QWU A;  2Y0S A;  2JIP A;  4MRI A;  2JUB A;  3J80 f;  1YIT Z;  1YIJ 1;  2KI7 B;  1VQ8 1;  1VQ4 Z;  3CPW Y;  4NOZ A;  3I55 1;  1I6H I;  5D1O A;  3PO3 S;  3NFZ A;  2VPX A;  1RO2 A;  3NH4 A;  1NUI A;  1VQ9 1;  2E2H I;  1AA6 A;  2OTL Z;  3IFU A;  3I4N I;  3CCL Z;  3H3V J;  2E7Z A;  3GCF A;  1M90 2;  1VQO Z;  3G71 1;  4S1T A;  4X6A I;  1FDI A;  1VQL Z;  1ZH1 A;  1YHQ Z;  5D1P A;  3HKZ A;  1VQ5 1;  1RO0 A;  2P3Y A;  1K8A 1;  2LFU A;  2W03 A;  5D1O B;  3OW2 Y;  3OW2 Z;  1YJ9 1;  3GTP I;  2W04 A;  4NH1 C;  3S16 I;  2QR1 B;  3D9X A;  3HOY I;  1Q7Y 1;  5FLM I;  2V8I A;  4RVD A;  1W2B Y;  3CMA 1;  1W2B Z;  1YJN 1;  2E9H A;  2V45 A;  3S2H I;  5LL6 f;  3RZD I;  4E2W A;  1Q81 1;  5T6B A;  3IR7 A;  1M1K 1;  1Q82 2;  1Q16 A;  1L1O C;  3CCV Z;  3S1R I;  4BY1 I;  2M48 A;  3CD6 Z;  3G6E Z;  3MON A;  3I4M I;  3FQM A;  2DE7 A;  2WAQ A;  3J81 b;  1VQ7 1;  3D6W A;  3CME 1;  3BG0 B;  2DE5 A;  3IF8 A;  3CCJ 1;  3NH5 A;  2F4M A;  1NJI 2;  3EER A;  2RIQ A;  4NFR A;  4EWC A;  1SIW A;  4A3J I;  2VF1 A;  2KPI A;  1K8A 2;  4A3E I;  1VQP 1;  1KD1 1;  4A3K I;  4A3I I;  4QTT A;  4NBE A;  3KIF A;  1YIJ Z;  2VPY A;  1USP A;  3I55 Z;  2B63 I;  2V8K A;  1Z01 A;  2K5R A;  1Q7Y 2;  3VMG A;  1JWH C;  3I07 A;  3GTM S;  1RLY A;  1Z02 A;  1VQ9 Z;  1P9N A;  1VLA A;  3CCR 1;  3S14 I;  4DGL A;  2E2J I;  1TWC I;  2JIR A;  3G71 Z;  2JIO A;  4HH4 A;  1ZB8 A;  4NBG A;  2NVQ I;  3M3Y I;  1QF8 A;  1VQ5 Z;  2HU9 A;  3TE5 B;  1VQK 1;  1USP B;  3T4N B;  2M6N A;  4HGZ A;  1YJ9 Z;  2JA5 I;  1X3Z A;  3CC2 1;  3VTN A;  1QXF A;  4A3G I;  2HF1 A;  3S1M I;  3CPW Z;  1Q82 1;  1KC8 2;  2V3V A;  3CMA Z;  4RVF A;  3CCM 1;  1YJN Z;  2JNY A;  1KD1 2;  2IZ3 A;  2K3R A;  3S1Q I;  3NH8 A;  1FDO A;  2H85 A;  4E30 A;  5C44 I;  2JIM A;  3J80 b;  1N2F A;  1NJI 1;  4NBF A;  1N8R 1;  4NB9 A;  4E33 A;  3F3P C;  2EGT A;  1RO4 A;  2PK7 A;  2R93 I;  2GTI A;  4BBR I;  3RZO I;  1QVF Y;  1VQ7 Z;  1QVF Z;  3CME Z;  2JR6 A;  3CCJ Z;  4BY7 I;  5FLX f;  4NBA A;  2RT9 A;  2Q51 A;  2RHB A;  4NBB A;  3CXC Y;  1SFO I;  3CXC Z;  2P28 A;  3GTQ I;  2R92 I;  1WJ2 A;  3JAM f;  3GTJ I;  5IT9 f;  2LEX A;  2RPR A;  1VQP Z;  2JIQ A;  5AN9 F;  1Y1V S;  2O53 A;  1KQS Y;  1S72 1;  3CC7 1;  3BG1 B;  4RV9 A;  1QVG Y;  5IT9 b;  5A2Q f;  3K7A I;  4A3L I;  2WB1 A;  2OZK A;  3CCR Z;  4E2Z A;  4Y52 I;  3HOX I;  1TWH I;  3CQZ I;  2IZ4 A;  5A2Q b;  3GTO I;  5T67 A;  1N8R 2;  1QYP A;  4BXX I;  1KC8 1;  1VQK Z;  2JA6 I;  4DK1 A;  3ESW A;  2PMZ A;  2AYD A;  4E2Y A;  3CC2 Z;  2G2K A;  1PFT A;  3J7A 4;  3NDI A;  3MZK B;  3HOU I;  3CCM Z;  4A93 I;  2JS4 A;  2JMO A;  1YUA A;  3GTK I;  1RQF A;  3GTM I;  4E2X A;  2I3C A;  3S17 I;  4CL1 A;  2DE6 A; 
#chains in the Genus database with same CATH homology
 5C3E I;  1YJW 1;  4A3D I;  4A3F I;  2JA8 I;  2PM9 A;  1VQM 1;  3U50 C;  2QEX Z;  4RVH A;  2NVX I;  1VQN 1;  3CCE 1;  4TNU A;  2OOX B;  4XX2 A;  5IP9 I;  3CC4 1;  2OTJ 1;  3VB9 A;  2E2I I;  2QRD B;  4BBS I;  3CCU 1;  3Q87 A;  2O4H A;  1WCM I;  2QA4 1;  3PO3 I;  1S72 Z;  4MD7 A;  2F4O A;  3CC7 Z;  1K83 I;  1ZB9 A;  4A3B I;  1NP6 A;  3GTL I;  4AYB A;  3M4O I;  2ZAE B;  2V8J A;  3HOW I;  4MD8 A;  4HGY A;  1ML8 A;  2QEX 1;  3CCQ 1;  4A3M I;  1TWA I;  3H0G I;  3S1N I;  3P5J B;  4MD9 A;  2LIY A;  1Q86 2;  2VUM I;  4NBD A;  2NVT I;  1VQ6 1;  1X0T A;  2OOY B;  1K9M 1;  5IP7 I;  3S15 I;  5FLX b;  4MXU A;  1JJ2 Y;  1YUK A;  1JJ2 Z;  4RS4 A;  3CCS 1;  1KQS Z;  2YU9 I;  1Y1V I;  1S7M A;  3G4S 1;  3JAM b;  4NB8 A;  1QVG Z;  4RVG A;  3I56 1;  2NVY I;  1YI2 1;  3GKQ A;  3VMH A;  2R6M A;  1K73 1;  1YIT 1;  1YJW Z;  1VQ4 1;  3MZL B;  4Y7N I;  2R7Z I;  5T64 A;  4MON A;  1VQM Z;  1I50 I;  2AKL A;  4DQY B;  1DL6 A;  2QRC B;  2OTL 1;  2QKD A;  1Z03 A;  3J81 f;  1VQN Z;  3CCL 1;  1KRL A;  1WW9 A;  2GU2 A;  1I3Q I;  3CCE Z;  4A3C I;  4MH4 A;  1VQO 1;  3CC4 Z;  2OTJ Z;  1VQL 1;  2JA7 I;  1YHQ 1;  3CCU Z;  3TDH B;  3GTG I;  2VUG A;  1K9M 2;  2BJO A;  4E31 A;  3PO2 I;  5CM2 M;  1Y1W I;  2QA4 Z;  1X3W A;  3FKI I;  3NDJ A;  3F3F C;  3EED A;  1TWF I;  1LQL A;  2QRE B;  2QLV B;  4NBC A;  1Q86 1;  1TWG I;  3CCQ Z;  1VQ8 Z;  5C4J I;  4NBH A;  1M90 1;  2J6A A;  3LUS A;  1K73 2;  1R9T I;  3KIH A;  2Q4Z A;  3HOZ I;  4E32 A;  3CCV 1;  2YAD A;  1VQ6 Z;  3CD6 1;  3G6E 1;  5C4X I;  4QTU A;  2RBL A;  1Q81 2;  1M1K 2;  3CCS Z;  3HOV I;  3VMI A;  1WII A;  3G4S Z;  3IX0 A;  3S2D I;  2GTH A;  3FQQ A;  3I56 Z;  1TFI A;  1RNI A;  1YI2 Z;  3QWU A;  2Y0S A;  4MRI A;  2JUB A;  3J80 f;  1YIT Z;  1YIJ 1;  2KI7 B;  1VQ8 1;  1VQ4 Z;  3CPW Y;  4NOZ A;  3I55 1;  1I6H I;  5D1O A;  3PO3 S;  3NFZ A;  1RO2 A;  3NH4 A;  1NUI A;  1VQ9 1;  2E2H I;  2OTL Z;  3IFU A;  3I4N I;  3CCL Z;  3H3V J;  3GCF A;  1M90 2;  1VQO Z;  3G71 1;  4S1T A;  4X6A I;  1VQL Z;  1ZH1 A;  1YHQ Z;  5D1P A;  3HKZ A;  1VQ5 1;  1RO0 A;  2P3Y A;  1K8A 1;  2LFU A;  2W03 A;  5D1O B;  3OW2 Y;  3OW2 Z;  1YJ9 1;  3GTP I;  2W04 A;  4NH1 C;  3S16 I;  2QR1 B;  3D9X A;  3HOY I;  1Q7Y 1;  5FLM I;  2V8I A;  4RVD A;  1W2B Y;  3CMA 1;  1W2B Z;  1YJN 1;  2E9H A;  3S2H I;  5LL6 f;  3RZD I;  4E2W A;  1Q81 1;  5T6B A;  1M1K 1;  1Q82 2;  1L1O C;  3CCV Z;  3S1R I;  4BY1 I;  2M48 A;  3CD6 Z;  3G6E Z;  3MON A;  3I4M I;  3FQM A;  2DE7 A;  2WAQ A;  3J81 b;  1VQ7 1;  3D6W A;  3CME 1;  3BG0 B;  2DE5 A;  3IF8 A;  3CCJ 1;  3NH5 A;  2F4M A;  1NJI 2;  3EER A;  2RIQ A;  4NFR A;  4EWC A;  4A3J I;  2VF1 A;  2KPI A;  1K8A 2;  4A3E I;  1VQP 1;  1KD1 1;  4A3K I;  4A3I I;  4QTT A;  4NBE A;  3KIF A;  1YIJ Z;  1USP A;  3I55 Z;  2B63 I;  2V8K A;  1Z01 A;  2K5R A;  1Q7Y 2;  3VMG A;  1JWH C;  3I07 A;  3GTM S;  1RLY A;  1Z02 A;  1VQ9 Z;  1P9N A;  1VLA A;  3CCR 1;  3S14 I;  4DGL A;  2E2J I;  1TWC I;  3G71 Z;  4HH4 A;  1ZB8 A;  4NBG A;  2NVQ I;  3M3Y I;  1QF8 A;  1VQ5 Z;  2HU9 A;  3TE5 B;  1VQK 1;  1USP B;  3T4N B;  2M6N A;  4HGZ A;  1YJ9 Z;  2JA5 I;  1X3Z A;  3CC2 1;  3VTN A;  4A3G I;  2HF1 A;  3S1M I;  3CPW Z;  1Q82 1;  1KC8 2;  3CMA Z;  4RVF A;  3CCM 1;  1YJN Z;  2JNY A;  1KD1 2;  2IZ3 A;  2K3R A;  3S1Q I;  3NH8 A;  2H85 A;  4E30 A;  5C44 I;  3J80 b;  1N2F A;  1NJI 1;  4NBF A;  1N8R 1;  4NB9 A;  4E33 A;  3F3P C;  2EGT A;  1RO4 A;  2PK7 A;  2R93 I;  2GTI A;  4BBR I;  3RZO I;  1QVF Y;  1VQ7 Z;  1QVF Z;  3CME Z;  2JR6 A;  3CCJ Z;  4BY7 I;  5FLX f;  4NBA A;  2RT9 A;  2Q51 A;  2RHB A;  4NBB A;  3CXC Y;  1SFO I;  3CXC Z;  2P28 A;  3GTQ I;  2R92 I;  3JAM f;  3GTJ I;  5IT9 f;  2RPR A;  1VQP Z;  5AN9 F;  1Y1V S;  2O53 A;  1KQS Y;  1S72 1;  3CC7 1;  3BG1 B;  4RV9 A;  1QVG Y;  5IT9 b;  5A2Q f;  3K7A I;  4A3L I;  2WB1 A;  2OZK A;  3CCR Z;  4E2Z A;  4Y52 I;  3HOX I;  1TWH I;  3CQZ I;  2IZ4 A;  5A2Q b;  3GTO I;  5T67 A;  1N8R 2;  1QYP A;  4BXX I;  1KC8 1;  1VQK Z;  2JA6 I;  4DK1 A;  3ESW A;  2PMZ A;  4E2Y A;  3CC2 Z;  2G2K A;  1PFT A;  3J7A 4;  3NDI A;  3MZK B;  3HOU I;  3CCM Z;  4A93 I;  2JS4 A;  2JMO A;  1YUA A;  3GTK I;  1RQF A;  3GTM I;  4E2X A;  2I3C A;  3S17 I;  4CL1 A;  2DE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...