3K7AI

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
118
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEASPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 9
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3k7aI02
2F4OA 4A3II 5C44I 1X3ZA 3GKQA 2KPIA 3I4MI 1N2FA 2VUMI 2R93I 4BY7I 1TWHI 1WW9A 2R7ZI 2NVQI 4QTUA 3VB9A 2DE6A 3RZDI 1L1OC 2JA6I 4BBRI 2B63I 3HOWI 3EERA 3S16I 3VMGA 4A3JI 4XX2A 2DE7A 4QTTA 2E2II 5C4JI 3S2HI 4NBDA 1K83I 3H3VJ 2E2JI 1NUIA 2JR6A 3D6WA 2F4MA 3H0GI 2E2HI 3I07A 3M4OI 2DE5A 3GTKI 3RZOI 3I4NI 4A3LI 3VMHA 2JA7I 2NVXI 1RLYA 2JNYA 3ESWA 3HOVI 2AKLA 1ZB8A 3GTGI 2P3YA 3S14I 4NOZA 1WCMI 3LUSA 3S17I 1I3QI 4NBHA 1R9TI 2NVTI 5C3EI 1DL6A 1TWCI 1Y1VI 4A93I 4X6AI 2RBLA 1TFIA 3VMIA 1I6HI 4Y52I 1QYPA 4A3CI 4NBBA 3GTMI 4Y7NI 3GTLI 3GCFA 4NBCA 3PO3I 3U50C 2JA8I 2HF1A 4A3FI 1X3WA 3GTOI 1USPB 3S1RI 2J6AA 4MH4A 3GTPI 3HOXI 5IP7I 4A3GI 1PFTA 2JS4A 3S15I 1TWAI 3HOUI 3CQZI 4NBGA 2BJOA 2YU9I 3K7AI 4NBAA 3S1NI 4BBSI 2K5RA 5CM2M 3GTJI 4BXXI 4A3BI 5IP9I 1USPA 4NBFA 1VLAA 1YUAA 3HOZI 4A3KI 4NBEA 3M3YI 5C4XI 3Q87A 1Y1VS 4NB9A 3S1MI 3FKII 4A3EI 3S1QI 3HOYI 3GTMS 3PO2I 3PO3S 2PK7A 1TWGI 1LQLA 2JA5I 1RO4A 4A3MI 3S2DI 1Y1WI 1SFOI 4A3DI 2NVYI 1I50I 1ML8A 4NB8A 1TWFI 5FLMI 4BY1I 3GTQI 1ZB9A 2R92I
chains in the Genus database with same CATH superfamily
2JIRA 4A3II 1KQSZ 5T6BA 4E2XA 1Q822 2R6MA 2R93I 1TWHI 4S1TA 1VQMZ 1VQLZ 1WW9A 3NH4A 3J81f 3CC7Z 1K9M2 3I56Z 5T67A 2Q51A 3EERA 1VQ8Z 3VMGA 1Q812 4AYBA 2DE7A 1VQO1 1K83I 1KRLA 3I55Z 2OTJ1 2JR6A 2E2HI 3I07A 2DE5A 1YJW1 3CC21 1RLYA 3GTGI 4BBSI 1WCMI 1I3QI 2NVTI 1RO0A 5C3EI 3MZKB 4E33A 4E2YA 4Y52I 4A3CI 4NBBA 2M48A 1QVFZ 3J7A4 1Z02A 1YJ91 3GTOI 1USPB 2K3RA 1JJ2Y 1VQOZ 1FDOA 5D1PA 2GTHA 3QWUA 1QVGY 2VPYA 3CCU1 4NH1C 1YJWZ 3CC2Z 1VQNZ 5D1OB 4RV9A 1NJI1 3OW2Y 1AA6A 3HKZA 3GTJI 4A3BI 2GTIA 2EGTA 3HOZI 1KC82 4A3KI 4MD9A 2QLVB 2W03A 2O53A 2ZAEB 2JMOA 3S1MI 1K731 4RVHA 3CCM1 3PO3S 2JA5I 2V45A 4E31A 3CCUZ 3KIFA 1I50I 4NB8A 5T64A 3GTQI 2RHBA 3NDJA 5LL6f 1ZB9A 5IT9f 3F3FC 3CCS1 1Q862 2KPIA 2VUMI 3MZLB 2WB1A 2R7ZI 2NVQI 4QTUA 1S721 2AYDA 1WZNA 3CD61 3CPWY 3CCV1 1Z03A 3CCMZ 2JA6I 2E7ZA 4RS4A 1KD11 3CCQZ 1Q7Y1 3CCE1 3CMA1 1YJN1 1M901 4XX2A 3H3VJ 1QVGZ 1YIT1 3CCSZ 2JIOA 3G6E1 3M4OI 2G2KA 1VQ71 3RZOI 3I4NI 1VQ91 3OW2Z 3EEDA 3S14I 2AKLA 2P3YA 3S17I 4NOZA 4NBHA 2VF1A 3NH8A 3CD6Z 2E9HA 3CME1 1DL6A 1Y1VI 4X6AI 1TFIA 1VQ51 3GTMI 3CCEZ 1RQFA 3CMAZ 2HF1A 4A3FI 5FLXf 3GTPI 4A3GI 4HH4A 2QEX1 1YITZ 1K8A1 4E2ZA 3G6EZ 4NBGA 2BJOA 4DGLA 1VQ7Z 2YU9I 2VPWA 1Y8CA 1Q16A 4NBAA 3S1NI 2NAPA 2K5RA 3CC41 3NH5A 2LIYA 5A2Qb 1P9NA 3IX0A 4MD8A 1QXFA 2IV2X 4NBFA 1N8R1 1M1K1 1VQ5Z 2OTJZ 4HGZA 1Z01A 2V3VA 1X0TA 1TWGI 2Y0SA 2QEXZ 1Y1WI 1SFOI 3BG0B 2I3CA 1FDIA 3CC4Z 2F4OA 1WJ2A 5C44I 3CCL1 1X3ZA 3GKQA 3G4S1 1YI21 1Q821 3I4MI 2QRDB 1QF8A 4BY7I 1VQ41 2P28A 3J81b 1KQSY 1YJ9Z 2PMZA 2RIQA 1K9M1 1L1OC 4BBRI 2JIQA 2OOXB 2W04A 3G711 4A3JI 1Q811 4QTTA 2E2II 4NBDA 1NUIA 4CL1A 1YIJ1 1RNIA 4TNUA 3MONA 3G4SZ 3GTKI 4A3LI 3VMHA 2JA7I 1VQ4Z 2NVXI 1VQ61 3ESWA 1ZB8A 3S2HI 4EWCA 3VTNA 1VQP1 4A93I 2RBLA 3VMIA 1JJ2Z 2JIMA 3TDHB 2QA41 3GTLI 3GCFA 4NBCA 4MRIA 2JA8I 1VQM1 1VQL1 4RVFA 2JUBA 4MD7A 3S1RI 2WAQA 2J6AA 4NFRA 3FQMA 5IP7I 1QVFY 2M6NA 1PFTA 3JAMf 1YIJZ 2OZKA 1ZH1A 2O4HA 3P5JB 3CQZI 3D2LA 1W2BY 2LEXA 2RPRA 1S72Z 1NJI2 1VQ6Z 3CCVZ 3IFUA 1VQPZ 3IF8A 1USPA 2PM9A 1VLAA 2LFUA 3J80f 4NBEA 2QA4Z 3M3YI 1YJNZ 1KC81 1K732 1Y1VS 4NB9A 3FKII 1RO2A 4RVDA 3GTMS 2RT9A 5D1OA 4A3MI 3CXCY 4A3DI 1VQ9Z 4DK1A 1ML8A 2V8KA 2Q4ZA 2OTL1 4BY1I 2OOYB 5IT9b 2R92I 3CMEZ 3T4NB 1Q861 1N2FA 3CPWZ 1YUKA 5AN9F 1VQN1 3VB9A 2DE6A 3RZDI 2B63I 2KI7B 2VPXA 1KD12 2IZ4A 1Q7Y2 3HOWI 3S16I 1M902 5C4JI 1VQK1 2OTLZ 3NDIA 1YHQ1 3NFZA 2E2JI 1JWHC 2V8JA 3D6WA 2F4MA 4E2WA 3H0GI 3JAMb 1W2BZ 4E30A 3BG1B 2GU2A 2JNYA 3HOVI 3LUSA 1R9TI 1SIWA 1TWCI 1I6HI 3FQQA 1QYPA 2QR1B 4Y7NI 3IR7A 2JIPA 3PO3I 3U50C 3J80b 3D9XA 3CCJ1 1NP6A 1X3WA 2QKDA 5FLXb 1VQKZ 4MH4A 1YHQZ 3HOXI 3CCLZ 3CXCZ 1K8A2 2V8IA 2JS4A 3CCR1 1YI2Z 3S15I 1TWAI 3HOUI 3CCQ1 3TE5B 4MONA 3K7AI 5CM2M 3KIHA 2H85A 5A2Qf 2IZ3A 4BXXI 5IP9I 2HU9A 2QRCB 1N8R2 1M1K2 1YUAA 4MXUA 4E32A 3G71Z 3CC71 5C4XI 3Q87A 2VPZA 3CCJZ 4A3EI 4HGYA 3S1QI 3I561 3HOYI 1WIIA 2YADA 3PO2I 4DQYB 2PK7A 1LQLA 2VUGA 3CCRZ 1RO4A 2QREB 1VQ81 3S2DI 2NVYI 1S7MA 1TWFI 5FLMI 3I551 4RVGA 3F3PC
chains in the Genus database with same CATH topology
4A3II 1KQSZ 5T6BA 4E2XA 1Q822 2R6MA 2R93I 1TWHI 4S1TA 1VQMZ 1VQLZ 1WW9A 3NH4A 3J81f 3CC7Z 1K9M2 3I56Z 5T67A 2Q51A 3EERA 1VQ8Z 3VMGA 1Q812 4AYBA 2DE7A 1VQO1 1K83I 1KRLA 3I55Z 2OTJ1 2JR6A 2E2HI 3I07A 2DE5A 1YJW1 3CC21 1RLYA 3GTGI 4BBSI 1WCMI 1I3QI 2NVTI 1RO0A 5C3EI 3MZKB 4E33A 4E2YA 4Y52I 4A3CI 4NBBA 2M48A 1QVFZ 3J7A4 1Z02A 1YJ91 3GTOI 1USPB 2K3RA 1JJ2Y 1VQOZ 5D1PA 2GTHA 3QWUA 1QVGY 3CCU1 4NH1C 1YJWZ 3CC2Z 1VQNZ 5D1OB 4RV9A 1NJI1 3OW2Y 3HKZA 3GTJI 4A3BI 2GTIA 2EGTA 3HOZI 1KC82 4A3KI 4MD9A 2QLVB 2W03A 2O53A 2ZAEB 2JMOA 3S1MI 1K731 4RVHA 3CCM1 3PO3S 2JA5I 4E31A 3CCUZ 3KIFA 1I50I 4NB8A 5T64A 3GTQI 2RHBA 3NDJA 5LL6f 1ZB9A 5IT9f 3F3FC 3CCS1 1Q862 2KPIA 2VUMI 3MZLB 2WB1A 2R7ZI 2NVQI 4QTUA 1S721 3CD61 3CPWY 3CCV1 1Z03A 3CCMZ 2JA6I 4RS4A 1KD11 3CCQZ 1Q7Y1 3CCE1 3CMA1 1YJN1 1M901 4XX2A 3H3VJ 1QVGZ 1YIT1 3CCSZ 3M4OI 3G6E1 2G2KA 1VQ71 3RZOI 3I4NI 1VQ91 3OW2Z 3EEDA 3S14I 2AKLA 2P3YA 3S17I 4NOZA 4NBHA 2VF1A 3NH8A 3CD6Z 2E9HA 3CME1 1DL6A 1Y1VI 4X6AI 1TFIA 1VQ51 3GTMI 3CCEZ 1RQFA 3CMAZ 2HF1A 4A3FI 5FLXf 3GTPI 4A3GI 4HH4A 2QEX1 1YITZ 1K8A1 4E2ZA 3G6EZ 4NBGA 2BJOA 4DGLA 1VQ7Z 2YU9I 4NBAA 3S1NI 2K5RA 3CC41 3NH5A 2LIYA 5A2Qb 1P9NA 3IX0A 4MD8A 4NBFA 1N8R1 1M1K1 1VQ5Z 2OTJZ 4HGZA 1Z01A 1X0TA 1TWGI 2Y0SA 2QEXZ 1Y1WI 1SFOI 3BG0B 2I3CA 3CC4Z 2F4OA 5C44I 3CCL1 1X3ZA 3GKQA 3G4S1 1YI21 1Q821 3I4MI 2QRDB 1QF8A 4BY7I 1VQ41 2P28A 3J81b 1KQSY 1YJ9Z 2PMZA 2RIQA 1K9M1 1L1OC 4BBRI 2OOXB 2W04A 3G711 4A3JI 1Q811 4QTTA 2E2II 4NBDA 1NUIA 4CL1A 1YIJ1 1RNIA 4TNUA 3MONA 3G4SZ 3GTKI 4A3LI 3VMHA 2JA7I 1VQ4Z 2NVXI 1VQ61 3ESWA 1ZB8A 3S2HI 4EWCA 3VTNA 1VQP1 4A93I 2RBLA 3VMIA 1JJ2Z 3TDHB 2QA41 3GTLI 3GCFA 4NBCA 4MRIA 2JA8I 1VQM1 1VQL1 4RVFA 2JUBA 4MD7A 3S1RI 2WAQA 2J6AA 4NFRA 3FQMA 5IP7I 1QVFY 2M6NA 1PFTA 3JAMf 1YIJZ 2OZKA 1ZH1A 2O4HA 3P5JB 3CQZI 1W2BY 2RPRA 1S72Z 1NJI2 1VQ6Z 3CCVZ 3IFUA 1VQPZ 3IF8A 1USPA 2PM9A 1VLAA 2LFUA 3J80f 4NBEA 2QA4Z 3M3YI 1YJNZ 1KC81 1K732 1Y1VS 4NB9A 3FKII 1RO2A 4RVDA 3GTMS 2RT9A 5D1OA 4A3MI 3CXCY 4A3DI 1VQ9Z 4DK1A 1ML8A 2V8KA 2Q4ZA 2OTL1 4BY1I 2OOYB 5IT9b 2R92I 3CMEZ 3T4NB 1Q861 1N2FA 3CPWZ 1YUKA 5AN9F 1VQN1 3VB9A 2DE6A 3RZDI 2B63I 2KI7B 1KD12 2IZ4A 1Q7Y2 3HOWI 3S16I 1M902 5C4JI 1VQK1 2OTLZ 3NDIA 1YHQ1 3NFZA 2E2JI 1JWHC 2V8JA 3D6WA 2F4MA 4E2WA 3H0GI 3JAMb 1W2BZ 4E30A 3BG1B 2GU2A 2JNYA 3HOVI 3LUSA 1R9TI 1TWCI 1I6HI 3FQQA 1QYPA 2QR1B 4Y7NI 3PO3I 3U50C 3J80b 3D9XA 3CCJ1 1NP6A 1X3WA 2QKDA 5FLXb 1VQKZ 4MH4A 1YHQZ 3HOXI 3CCLZ 3CXCZ 1K8A2 2V8IA 2JS4A 3CCR1 1YI2Z 3S15I 1TWAI 3HOUI 3CCQ1 3TE5B 4MONA 3K7AI 5CM2M 3KIHA 2H85A 5A2Qf 2IZ3A 4BXXI 5IP9I 2HU9A 2QRCB 1N8R2 1M1K2 1YUAA 4MXUA 4E32A 3G71Z 3CC71 5C4XI 3Q87A 3CCJZ 4A3EI 4HGYA 3S1QI 3I561 3HOYI 1WIIA 2YADA 3PO2I 4DQYB 2PK7A 1LQLA 2VUGA 3CCRZ 1RO4A 2QREB 1VQ81 3S2DI 2NVYI 1S7MA 1TWFI 5FLMI 3I551 4RVGA 3F3PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4O A;  4A3I I;  5C44 I;  1X3Z A;  3GKQ A;  2KPI A;  3I4M I;  1N2F A;  2VUM I;  2R93 I;  4BY7 I;  1TWH I;  1WW9 A;  2R7Z I;  2NVQ I;  4QTU A;  3VB9 A;  2DE6 A;  3RZD I;  1L1O C;  2JA6 I;  4BBR I;  2B63 I;  3HOW I;  3EER A;  3S16 I;  3VMG A;  4A3J I;  4XX2 A;  2DE7 A;  4QTT A;  2E2I I;  5C4J I;  3S2H I;  4NBD A;  1K83 I;  3H3V J;  2E2J I;  1NUI A;  2JR6 A;  3D6W A;  2F4M A;  3H0G I;  2E2H I;  3I07 A;  3M4O I;  2DE5 A;  3GTK I;  3RZO I;  3I4N I;  4A3L I;  3VMH A;  2JA7 I;  2NVX I;  1RLY A;  2JNY A;  3ESW A;  3HOV I;  2AKL A;  1ZB8 A;  3GTG I;  2P3Y A;  3S14 I;  4NOZ A;  1WCM I;  3LUS A;  3S17 I;  1I3Q I;  4NBH A;  1R9T I;  2NVT I;  5C3E I;  1DL6 A;  1TWC I;  1Y1V I;  4A93 I;  4X6A I;  2RBL A;  1TFI A;  3VMI A;  1I6H I;  4Y52 I;  1QYP A;  4A3C I;  4NBB A;  3GTM I;  4Y7N I;  3GTL I;  3GCF A;  4NBC A;  3PO3 I;  3U50 C;  2JA8 I;  2HF1 A;  4A3F I;  1X3W A;  3GTO I;  1USP B;  3S1R I;  2J6A A;  4MH4 A;  3GTP I;  3HOX I;  5IP7 I;  4A3G I;  1PFT A;  2JS4 A;  3S15 I;  1TWA I;  3HOU I;  3CQZ I;  4NBG A;  2BJO A;  2YU9 I;  3K7A I;  4NBA A;  3S1N I;  4BBS I;  2K5R A;  5CM2 M;  3GTJ I;  4BXX I;  4A3B I;  5IP9 I;  1USP A;  4NBF A;  1VLA A;  1YUA A;  3HOZ I;  4A3K I;  4NBE A;  3M3Y I;  5C4X I;  3Q87 A;  1Y1V S;  4NB9 A;  3S1M I;  3FKI I;  4A3E I;  3S1Q I;  3HOY I;  3GTM S;  3PO2 I;  3PO3 S;  2PK7 A;  1TWG I;  1LQL A;  2JA5 I;  1RO4 A;  4A3M I;  3S2D I;  1Y1W I;  1SFO I;  4A3D I;  2NVY I;  1I50 I;  1ML8 A;  4NB8 A;  1TWF I;  5FLM I;  4BY1 I;  3GTQ I;  1ZB9 A;  2R92 I; 
#chains in the Genus database with same CATH topology
 2JIR A;  4A3I I;  1KQS Z;  5T6B A;  4E2X A;  1Q82 2;  2R6M A;  2R93 I;  1TWH I;  4S1T A;  1VQM Z;  1VQL Z;  1WW9 A;  3NH4 A;  3J81 f;  3CC7 Z;  1K9M 2;  3I56 Z;  5T67 A;  2Q51 A;  3EER A;  1VQ8 Z;  3VMG A;  1Q81 2;  4AYB A;  2DE7 A;  1VQO 1;  1K83 I;  1KRL A;  3I55 Z;  2OTJ 1;  2JR6 A;  2E2H I;  3I07 A;  2DE5 A;  1YJW 1;  3CC2 1;  1RLY A;  3GTG I;  4BBS I;  1WCM I;  1I3Q I;  2NVT I;  1RO0 A;  5C3E I;  3MZK B;  4E33 A;  4E2Y A;  4Y52 I;  4A3C I;  4NBB A;  2M48 A;  1QVF Z;  3J7A 4;  1Z02 A;  1YJ9 1;  3GTO I;  1USP B;  2K3R A;  1JJ2 Y;  1VQO Z;  1FDO A;  5D1P A;  2GTH A;  3QWU A;  1QVG Y;  2VPY A;  3CCU 1;  4NH1 C;  1YJW Z;  3CC2 Z;  1VQN Z;  5D1O B;  4RV9 A;  1NJI 1;  3OW2 Y;  1AA6 A;  3HKZ A;  3GTJ I;  4A3B I;  2GTI A;  2EGT A;  3HOZ I;  1KC8 2;  4A3K I;  4MD9 A;  2QLV B;  2W03 A;  2O53 A;  2ZAE B;  2JMO A;  3S1M I;  1K73 1;  4RVH A;  3CCM 1;  3PO3 S;  2JA5 I;  2V45 A;  4E31 A;  3CCU Z;  3KIF A;  1I50 I;  4NB8 A;  5T64 A;  3GTQ I;  2RHB A;  3NDJ A;  5LL6 f;  1ZB9 A;  5IT9 f;  3F3F C;  3CCS 1;  1Q86 2;  2KPI A;  2VUM I;  3MZL B;  2WB1 A;  2R7Z I;  2NVQ I;  4QTU A;  1S72 1;  2AYD A;  1WZN A;  3CD6 1;  3CPW Y;  3CCV 1;  1Z03 A;  3CCM Z;  2JA6 I;  2E7Z A;  4RS4 A;  1KD1 1;  3CCQ Z;  1Q7Y 1;  3CCE 1;  3CMA 1;  1YJN 1;  1M90 1;  4XX2 A;  3H3V J;  1QVG Z;  1YIT 1;  3CCS Z;  2JIO A;  3G6E 1;  3M4O I;  2G2K A;  1VQ7 1;  3RZO I;  3I4N I;  1VQ9 1;  3OW2 Z;  3EED A;  3S14 I;  2AKL A;  2P3Y A;  3S17 I;  4NOZ A;  4NBH A;  2VF1 A;  3NH8 A;  3CD6 Z;  2E9H A;  3CME 1;  1DL6 A;  1Y1V I;  4X6A I;  1TFI A;  1VQ5 1;  3GTM I;  3CCE Z;  1RQF A;  3CMA Z;  2HF1 A;  4A3F I;  5FLX f;  3GTP I;  4A3G I;  4HH4 A;  2QEX 1;  1YIT Z;  1K8A 1;  4E2Z A;  3G6E Z;  4NBG A;  2BJO A;  4DGL A;  1VQ7 Z;  2YU9 I;  2VPW A;  1Y8C A;  1Q16 A;  4NBA A;  3S1N I;  2NAP A;  2K5R A;  3CC4 1;  3NH5 A;  2LIY A;  5A2Q b;  1P9N A;  3IX0 A;  4MD8 A;  1QXF A;  2IV2 X;  4NBF A;  1N8R 1;  1M1K 1;  1VQ5 Z;  2OTJ Z;  4HGZ A;  1Z01 A;  2V3V A;  1X0T A;  1TWG I;  2Y0S A;  2QEX Z;  1Y1W I;  1SFO I;  3BG0 B;  2I3C A;  1FDI A;  3CC4 Z;  2F4O A;  1WJ2 A;  5C44 I;  3CCL 1;  1X3Z A;  3GKQ A;  3G4S 1;  1YI2 1;  1Q82 1;  3I4M I;  2QRD B;  1QF8 A;  4BY7 I;  1VQ4 1;  2P28 A;  3J81 b;  1KQS Y;  1YJ9 Z;  2PMZ A;  2RIQ A;  1K9M 1;  1L1O C;  4BBR I;  2JIQ A;  2OOX B;  2W04 A;  3G71 1;  4A3J I;  1Q81 1;  4QTT A;  2E2I I;  4NBD A;  1NUI A;  4CL1 A;  1YIJ 1;  1RNI A;  4TNU A;  3MON A;  3G4S Z;  3GTK I;  4A3L I;  3VMH A;  2JA7 I;  1VQ4 Z;  2NVX I;  1VQ6 1;  3ESW A;  1ZB8 A;  3S2H I;  4EWC A;  3VTN A;  1VQP 1;  4A93 I;  2RBL A;  3VMI A;  1JJ2 Z;  2JIM A;  3TDH B;  2QA4 1;  3GTL I;  3GCF A;  4NBC A;  4MRI A;  2JA8 I;  1VQM 1;  1VQL 1;  4RVF A;  2JUB A;  4MD7 A;  3S1R I;  2WAQ A;  2J6A A;  4NFR A;  3FQM A;  5IP7 I;  1QVF Y;  2M6N A;  1PFT A;  3JAM f;  1YIJ Z;  2OZK A;  1ZH1 A;  2O4H A;  3P5J B;  3CQZ I;  3D2L A;  1W2B Y;  2LEX A;  2RPR A;  1S72 Z;  1NJI 2;  1VQ6 Z;  3CCV Z;  3IFU A;  1VQP Z;  3IF8 A;  1USP A;  2PM9 A;  1VLA A;  2LFU A;  3J80 f;  4NBE A;  2QA4 Z;  3M3Y I;  1YJN Z;  1KC8 1;  1K73 2;  1Y1V S;  4NB9 A;  3FKI I;  1RO2 A;  4RVD A;  3GTM S;  2RT9 A;  5D1O A;  4A3M I;  3CXC Y;  4A3D I;  1VQ9 Z;  4DK1 A;  1ML8 A;  2V8K A;  2Q4Z A;  2OTL 1;  4BY1 I;  2OOY B;  5IT9 b;  2R92 I;  3CME Z;  3T4N B;  1Q86 1;  1N2F A;  3CPW Z;  1YUK A;  5AN9 F;  1VQN 1;  3VB9 A;  2DE6 A;  3RZD I;  2B63 I;  2KI7 B;  2VPX A;  1KD1 2;  2IZ4 A;  1Q7Y 2;  3HOW I;  3S16 I;  1M90 2;  5C4J I;  1VQK 1;  2OTL Z;  3NDI A;  1YHQ 1;  3NFZ A;  2E2J I;  1JWH C;  2V8J A;  3D6W A;  2F4M A;  4E2W A;  3H0G I;  3JAM b;  1W2B Z;  4E30 A;  3BG1 B;  2GU2 A;  2JNY A;  3HOV I;  3LUS A;  1R9T I;  1SIW A;  1TWC I;  1I6H I;  3FQQ A;  1QYP A;  2QR1 B;  4Y7N I;  3IR7 A;  2JIP A;  3PO3 I;  3U50 C;  3J80 b;  3D9X A;  3CCJ 1;  1NP6 A;  1X3W A;  2QKD A;  5FLX b;  1VQK Z;  4MH4 A;  1YHQ Z;  3HOX I;  3CCL Z;  3CXC Z;  1K8A 2;  2V8I A;  2JS4 A;  3CCR 1;  1YI2 Z;  3S15 I;  1TWA I;  3HOU I;  3CCQ 1;  3TE5 B;  4MON A;  3K7A I;  5CM2 M;  3KIH A;  2H85 A;  5A2Q f;  2IZ3 A;  4BXX I;  5IP9 I;  2HU9 A;  2QRC B;  1N8R 2;  1M1K 2;  1YUA A;  4MXU A;  4E32 A;  3G71 Z;  3CC7 1;  5C4X I;  3Q87 A;  2VPZ A;  3CCJ Z;  4A3E I;  4HGY A;  3S1Q I;  3I56 1;  3HOY I;  1WII A;  2YAD A;  3PO2 I;  4DQY B;  2PK7 A;  1LQL A;  2VUG A;  3CCR Z;  1RO4 A;  2QRE B;  1VQ8 1;  3S2D I;  2NVY I;  1S7M A;  1TWF I;  5FLM I;  3I55 1;  4RVG A;  3F3P C; 
#chains in the Genus database with same CATH homology
 4A3I I;  1KQS Z;  5T6B A;  4E2X A;  1Q82 2;  2R6M A;  2R93 I;  1TWH I;  4S1T A;  1VQM Z;  1VQL Z;  1WW9 A;  3NH4 A;  3J81 f;  3CC7 Z;  1K9M 2;  3I56 Z;  5T67 A;  2Q51 A;  3EER A;  1VQ8 Z;  3VMG A;  1Q81 2;  4AYB A;  2DE7 A;  1VQO 1;  1K83 I;  1KRL A;  3I55 Z;  2OTJ 1;  2JR6 A;  2E2H I;  3I07 A;  2DE5 A;  1YJW 1;  3CC2 1;  1RLY A;  3GTG I;  4BBS I;  1WCM I;  1I3Q I;  2NVT I;  1RO0 A;  5C3E I;  3MZK B;  4E33 A;  4E2Y A;  4Y52 I;  4A3C I;  4NBB A;  2M48 A;  1QVF Z;  3J7A 4;  1Z02 A;  1YJ9 1;  3GTO I;  1USP B;  2K3R A;  1JJ2 Y;  1VQO Z;  5D1P A;  2GTH A;  3QWU A;  1QVG Y;  3CCU 1;  4NH1 C;  1YJW Z;  3CC2 Z;  1VQN Z;  5D1O B;  4RV9 A;  1NJI 1;  3OW2 Y;  3HKZ A;  3GTJ I;  4A3B I;  2GTI A;  2EGT A;  3HOZ I;  1KC8 2;  4A3K I;  4MD9 A;  2QLV B;  2W03 A;  2O53 A;  2ZAE B;  2JMO A;  3S1M I;  1K73 1;  4RVH A;  3CCM 1;  3PO3 S;  2JA5 I;  4E31 A;  3CCU Z;  3KIF A;  1I50 I;  4NB8 A;  5T64 A;  3GTQ I;  2RHB A;  3NDJ A;  5LL6 f;  1ZB9 A;  5IT9 f;  3F3F C;  3CCS 1;  1Q86 2;  2KPI A;  2VUM I;  3MZL B;  2WB1 A;  2R7Z I;  2NVQ I;  4QTU A;  1S72 1;  3CD6 1;  3CPW Y;  3CCV 1;  1Z03 A;  3CCM Z;  2JA6 I;  4RS4 A;  1KD1 1;  3CCQ Z;  1Q7Y 1;  3CCE 1;  3CMA 1;  1YJN 1;  1M90 1;  4XX2 A;  3H3V J;  1QVG Z;  1YIT 1;  3CCS Z;  3M4O I;  3G6E 1;  2G2K A;  1VQ7 1;  3RZO I;  3I4N I;  1VQ9 1;  3OW2 Z;  3EED A;  3S14 I;  2AKL A;  2P3Y A;  3S17 I;  4NOZ A;  4NBH A;  2VF1 A;  3NH8 A;  3CD6 Z;  2E9H A;  3CME 1;  1DL6 A;  1Y1V I;  4X6A I;  1TFI A;  1VQ5 1;  3GTM I;  3CCE Z;  1RQF A;  3CMA Z;  2HF1 A;  4A3F I;  5FLX f;  3GTP I;  4A3G I;  4HH4 A;  2QEX 1;  1YIT Z;  1K8A 1;  4E2Z A;  3G6E Z;  4NBG A;  2BJO A;  4DGL A;  1VQ7 Z;  2YU9 I;  4NBA A;  3S1N I;  2K5R A;  3CC4 1;  3NH5 A;  2LIY A;  5A2Q b;  1P9N A;  3IX0 A;  4MD8 A;  4NBF A;  1N8R 1;  1M1K 1;  1VQ5 Z;  2OTJ Z;  4HGZ A;  1Z01 A;  1X0T A;  1TWG I;  2Y0S A;  2QEX Z;  1Y1W I;  1SFO I;  3BG0 B;  2I3C A;  3CC4 Z;  2F4O A;  5C44 I;  3CCL 1;  1X3Z A;  3GKQ A;  3G4S 1;  1YI2 1;  1Q82 1;  3I4M I;  2QRD B;  1QF8 A;  4BY7 I;  1VQ4 1;  2P28 A;  3J81 b;  1KQS Y;  1YJ9 Z;  2PMZ A;  2RIQ A;  1K9M 1;  1L1O C;  4BBR I;  2OOX B;  2W04 A;  3G71 1;  4A3J I;  1Q81 1;  4QTT A;  2E2I I;  4NBD A;  1NUI A;  4CL1 A;  1YIJ 1;  1RNI A;  4TNU A;  3MON A;  3G4S Z;  3GTK I;  4A3L I;  3VMH A;  2JA7 I;  1VQ4 Z;  2NVX I;  1VQ6 1;  3ESW A;  1ZB8 A;  3S2H I;  4EWC A;  3VTN A;  1VQP 1;  4A93 I;  2RBL A;  3VMI A;  1JJ2 Z;  3TDH B;  2QA4 1;  3GTL I;  3GCF A;  4NBC A;  4MRI A;  2JA8 I;  1VQM 1;  1VQL 1;  4RVF A;  2JUB A;  4MD7 A;  3S1R I;  2WAQ A;  2J6A A;  4NFR A;  3FQM A;  5IP7 I;  1QVF Y;  2M6N A;  1PFT A;  3JAM f;  1YIJ Z;  2OZK A;  1ZH1 A;  2O4H A;  3P5J B;  3CQZ I;  1W2B Y;  2RPR A;  1S72 Z;  1NJI 2;  1VQ6 Z;  3CCV Z;  3IFU A;  1VQP Z;  3IF8 A;  1USP A;  2PM9 A;  1VLA A;  2LFU A;  3J80 f;  4NBE A;  2QA4 Z;  3M3Y I;  1YJN Z;  1KC8 1;  1K73 2;  1Y1V S;  4NB9 A;  3FKI I;  1RO2 A;  4RVD A;  3GTM S;  2RT9 A;  5D1O A;  4A3M I;  3CXC Y;  4A3D I;  1VQ9 Z;  4DK1 A;  1ML8 A;  2V8K A;  2Q4Z A;  2OTL 1;  4BY1 I;  2OOY B;  5IT9 b;  2R92 I;  3CME Z;  3T4N B;  1Q86 1;  1N2F A;  3CPW Z;  1YUK A;  5AN9 F;  1VQN 1;  3VB9 A;  2DE6 A;  3RZD I;  2B63 I;  2KI7 B;  1KD1 2;  2IZ4 A;  1Q7Y 2;  3HOW I;  3S16 I;  1M90 2;  5C4J I;  1VQK 1;  2OTL Z;  3NDI A;  1YHQ 1;  3NFZ A;  2E2J I;  1JWH C;  2V8J A;  3D6W A;  2F4M A;  4E2W A;  3H0G I;  3JAM b;  1W2B Z;  4E30 A;  3BG1 B;  2GU2 A;  2JNY A;  3HOV I;  3LUS A;  1R9T I;  1TWC I;  1I6H I;  3FQQ A;  1QYP A;  2QR1 B;  4Y7N I;  3PO3 I;  3U50 C;  3J80 b;  3D9X A;  3CCJ 1;  1NP6 A;  1X3W A;  2QKD A;  5FLX b;  1VQK Z;  4MH4 A;  1YHQ Z;  3HOX I;  3CCL Z;  3CXC Z;  1K8A 2;  2V8I A;  2JS4 A;  3CCR 1;  1YI2 Z;  3S15 I;  1TWA I;  3HOU I;  3CCQ 1;  3TE5 B;  4MON A;  3K7A I;  5CM2 M;  3KIH A;  2H85 A;  5A2Q f;  2IZ3 A;  4BXX I;  5IP9 I;  2HU9 A;  2QRC B;  1N8R 2;  1M1K 2;  1YUA A;  4MXU A;  4E32 A;  3G71 Z;  3CC7 1;  5C4X I;  3Q87 A;  3CCJ Z;  4A3E I;  4HGY A;  3S1Q I;  3I56 1;  3HOY I;  1WII A;  2YAD A;  3PO2 I;  4DQY B;  2PK7 A;  1LQL A;  2VUG A;  3CCR Z;  1RO4 A;  2QRE B;  1VQ8 1;  3S2D I;  2NVY I;  1S7M A;  1TWF I;  5FLM I;  3I55 1;  4RVG A;  3F3P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...