1YJ91

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yj9100
2QEXZ 1VQ91 3CCRZ 3CXCZ 2QA41 1YJN1 1QVFY 1N8R2 1VQLZ 1N8R1 3I551 1Q822 3CCV1 1VQ4Z 1Q821 1VQ71 1JJ2Z 1VQKZ 3CCJZ 1NJI1 1YIJ1 2OTLZ 1YITZ 1M1K2 1VQMZ 3G4S1 1M1K1 3OW2Y 1S721 3CCMZ 1VQ5Z 3CD61 1VQNZ 1VQ81 1YJ9Z 3CCSZ 1Q7Y2 1Q7Y1 3CME1 3CC7Z 1VQP1 3G6E1 1QVGZ 1KC82 3CCE1 1KC81 3CC41 3G711 3CCR1 3I561 1YJWZ 3CCU1 1NJI2 1Q811 1VQ9Z 1K732 1VQO1 1K731 1YJNZ 2QA4Z 3CPWY 1KQSY 1QVFZ 3CC21 2OTJ1 3CCL1 3CCVZ 3CMA1 1W2BY 1VQ7Z 1KD12 1VQM1 1VQ61 1KD11 1YHQZ 3CCQZ 1YI21 1YJ91 2QEX1 3CXCY 3CPWZ 1VQL1 3CD6Z 3OW2Z 1VQ8Z 1Q812 1VQ41 3CMEZ 1K8A2 1K8A1 3G6EZ 3CCEZ 1VQK1 3CCJ1 3CC4Z 3G71Z 1M902 3I55Z 2OTL1 1M901 1YIT1 3I56Z 1K9M2 1K9M1 3CCUZ 3CCM1 1VQ51 1VQN1 1YIJZ 3CCS1 1VQOZ 3CC71 1YHQ1 3CCQ1 1QVGY 3G4SZ 3CC2Z 1KQSZ 2OTJZ 1Q862 1S72Z 3CCLZ 3CMAZ 1Q861 1W2BZ 1VQ6Z 1VQPZ 1JJ2Y 1YJW1 1YI2Z
chains in the Genus database with same CATH superfamily
1X0TA 1VQ91 4AYBA 3PO3S 1N8R1 3I551 3CCV1 4RVGA 1ZB9A 3S1RI 1FDIA 1NUIA 3HOZI 4NBAA 2O4HA 3GKQA 2QR1B 5T67A 1M1K1 3I4NI 3OW2Y 1K83I 2WAQA 4EWCA 5C3EI 3KIFA 1VQ81 3I4MI 5D1OA 1Q7Y1 3CC7Z 2PK7A 1VQP1 3PO2I 2KI7B 1QVGZ 1WCMI 2J6AA 3CCE1 3JAMb 1I50I 3CC41 3FQMA 4XX2A 3CCR1 4NOZA 2RIQA 4QTUA 2DE7A 3CCU1 2EGTA 4A3II 2I3CA 4NBEA 1Q811 5FLXb 1Q16A 1VQ9Z 1ML8A 2JNYA 2JMOA 1Y8CA 3CPWY 1KQSY 4A3MI 2V45A 3CCVZ 3TE5B 4HGYA 5C4XI 2R93I 1YHQZ 2KPIA 2M6NA 2V3VA 2OOYB 3CXCY 2QREB 4HH4A 3VTNA 3S14I 4MD7A 3CPWZ 3KIHA 1VQL1 2VPXA 1VQ8Z 4MD8A 3H3VJ 4A93I 3CCEZ 2LIYA 5AN9F 4DK1A 2QKDA 3CC4Z 2QRDB 1M901 1YIT1 1K9M2 3I07A 3MONA 4NBFA 2VUMI 3PO3I 3CCUZ 3CCM1 2F4MA 1VQN1 3MZLB 2NVQI 3NDJA 1YUKA 5IT9b 4A3BI 3U50C 3HOXI 3S1MI 3HOYI 1Q861 4NFRA 3S1NI 2P28A 2YADA 4BY7I 3JAMf 2K5RA 2JUBA 1JJ2Y 4TNUA 4E31A 4E2YA 1ZH1A 1YJN1 5FLXf 3VB9A 1QVFY 2JS4A 1PFTA 1VQLZ 3GTOI 5LL6f 2JIMA 1Q821 1VQ71 2R6MA 1JJ2Z 3HOUI 1RO0A 4RVHA 1VLAA 1YITZ 4RVDA 3G4S1 4NBGA 1S721 3CCMZ 1VQNZ 1YJ9Z 5C4JI 1TFIA 4NBBA 5CM2M 2E2HI 4RV9A 3D9XA 1KC81 4NB8A 3HOVI 4MD9A 3LUSA 3J7A4 4S1TA 5T64A 1NJI2 3NH4A 2GTIA 1K731 1YJNZ 1Y1VI 3CC21 5IT9f 2OTJ1 1Z03A 1VQ7Z 3J81b 3ESWA 1VQM1 1VQ61 1KD11 5D1OB 4NH1C 2JIOA 4CL1A 3TDHB 3NH8A 1WW9A 4RS4A 2RHBA 3IX0A 2W03A 4MRIA 3OW2Z 1K8A2 2V8KA 1QXFA 4NB9A 1VQK1 4QTTA 3CCJ1 3I55Z 2OTL1 4DQYB 3D6WA 1DL6A 3P5JB 3M3YI 3S15I 2E2JI 2HU9A 1VQ51 1L1OC 3CCQ1 3S2DI 1USPA 1USPB 3CC2Z 1KQSZ 2E2II 4BXXI 2OTJZ 4E33A 2OZKA 1SFOI 1Y1VS 1VQ6Z 4E32A 1VQPZ 4Y7NI 1YJW1 4A3LI 2G2KA 2V8JA 3F3PC 1TWGI 3CCRZ 3CXCZ 1TWAI 2RT9A 4E2WA 1N8R2 2WB1A 3VMIA 5A2Qb 2LEXA 3J81f 3BG1B 1VQKZ 1JWHC 3CCJZ 1NJI1 1YIJ1 2OTLZ 5T6BA 1X3ZA 4MONA 2JA7I 3VMHA 1M1K2 2IZ3A 3Q87A 1VQ5Z 1RNIA 3CD61 2E7ZA 4A3KI 4A3FI 1Q7Y2 2VF1A 1KRLA 1RQFA 1N2FA 3G6E1 1Z01A 3K7AI 2YU9I 3MZKB 2F4OA 3I561 2Y0SA 5C44I 1YJWZ 2IV2X 4NBHA 1R9TI 1VQO1 2BJOA 3RZOI 1QVFZ 3VMGA 2AYDA 3CMA1 1W2BY 2B63I 1ZB8A 4NBCA 1TWCI 3GCFA 4E2ZA 4A3GI 3IFUA 2QEX1 2RBLA 1AA6A 2Q4ZA 2H85A 4X6AI 4BBSI 4A3EI 2QRCB 4MXUA 3CD6Z 3S16I 2LFUA 1VQ41 3H0GI 3BG0B 3D2LA 3J80b 3G6EZ 5A2Qf 4DGLA 1M902 2VUGA 3F3FC 3I56Z 1TWFI 2JIPA 2AKLA 1K9M1 3EEDA 2V8IA 4Y52I 1I6HI 3CCS1 1WZNA 1VQOZ 1YHQ1 1QVGY 2PM9A 1WIIA 3G4SZ 4A3CI 1Q862 1S72Z 2Q51A 3CMAZ 3M4OI 2VPZA 2HF1A 3GTLI 3IR7A 5IP9I 5IP7I 2QEXZ 2R92I 2QA41 2NVXI 3S1QI 4A3JI 3GTMI 1Q822 3QWUA 4E30A 1VQ4Z 3IF8A 3HOWI 3S17I 2GU2A 2JA8I 2NVYI 2JA6I 4BBRI 1WJ2A 1Z02A 1TWHI 1VQMZ 2P3YA 2RPRA 3NH5A 4HGZA 3CQZI 2E9HA 3CCSZ 1RO4A 3CME1 1KC82 1I3QI 3J80f 3G711 3FQQA 2OOXB 2PMZA 3EERA 2JIQA 4A3DI 1QYPA 2QLVB 1K732 1P9NA 3GTPI 1S7MA 2QA4Z 3HKZA 3T4NB 2VPWA 4BY1I 2K3RA 3CCL1 2M48A 1KD12 3RZDI 3GTMS 1RLYA 3CCQZ 1NP6A 1YI21 1YJ91 3GTQI 1LQLA 3NFZA 5D1PA 1SIWA 1Q812 1X3WA 2DE6A 2IZ4A 1Y1WI 2DE5A 3NDIA 2W04A 3CMEZ 1K8A1 1FDOA 3S2HI 5FLMI 4NBDA 3G71Z 4RVFA 2JR6A 2O53A 4E2XA 2NVTI 2JIRA 3GTJI 1YUAA 1YIJZ 2ZAEB 3GTGI 1QF8A 4MH4A 2NAPA 3CC71 2R7ZI 2VPYA 3CCLZ 3GTKI 1W2BZ 2GTHA 1RO2A 3FKII 2JA5I 1YI2Z
chains in the Genus database with same CATH topology
1X0TA 1VQ91 4AYBA 3PO3S 1N8R1 3I551 3CCV1 4RVGA 1ZB9A 3S1RI 1NUIA 3HOZI 4NBAA 2O4HA 3GKQA 2QR1B 5T67A 1M1K1 3I4NI 3OW2Y 1K83I 2WAQA 4EWCA 5C3EI 3KIFA 1VQ81 3I4MI 5D1OA 1Q7Y1 3CC7Z 2PK7A 1VQP1 3PO2I 2KI7B 1QVGZ 1WCMI 2J6AA 3CCE1 3JAMb 1I50I 3CC41 3FQMA 4XX2A 3CCR1 4NOZA 2RIQA 4QTUA 2DE7A 3CCU1 2EGTA 4A3II 2I3CA 4NBEA 1Q811 5FLXb 1VQ9Z 1ML8A 2JMOA 2JNYA 3CPWY 1KQSY 4A3MI 3CCVZ 3TE5B 4HGYA 5C4XI 2R93I 1YHQZ 2KPIA 2M6NA 2OOYB 3CXCY 2QREB 4HH4A 3VTNA 3S14I 4MD7A 3CPWZ 3KIHA 1VQL1 1VQ8Z 4MD8A 3H3VJ 4A93I 3CCEZ 2LIYA 5AN9F 4DK1A 2QKDA 3CC4Z 2QRDB 1M901 1YIT1 1K9M2 3I07A 3MONA 4NBFA 2VUMI 3PO3I 3CCUZ 3CCM1 2F4MA 1VQN1 3MZLB 2NVQI 3NDJA 1YUKA 5IT9b 4A3BI 3U50C 3HOXI 3S1MI 3HOYI 1Q861 4NFRA 3S1NI 2P28A 2YADA 4BY7I 3JAMf 2K5RA 2JUBA 1JJ2Y 4TNUA 4E31A 4E2YA 1ZH1A 1YJN1 5FLXf 3VB9A 1QVFY 2JS4A 1PFTA 1VQLZ 3GTOI 5LL6f 1Q821 1VQ71 2R6MA 1JJ2Z 3HOUI 1RO0A 4RVHA 1VLAA 1YITZ 4RVDA 3G4S1 4NBGA 1S721 3CCMZ 1VQNZ 1YJ9Z 5C4JI 1TFIA 4NBBA 5CM2M 2E2HI 4RV9A 3D9XA 1KC81 4NB8A 3HOVI 4MD9A 3LUSA 3J7A4 4S1TA 5T64A 1NJI2 3NH4A 2GTIA 1K731 1YJNZ 1Y1VI 3CC21 5IT9f 2OTJ1 1Z03A 1VQ7Z 3J81b 3ESWA 1VQM1 1VQ61 1KD11 5D1OB 4NH1C 4CL1A 3TDHB 3NH8A 1WW9A 4RS4A 2RHBA 3IX0A 2W03A 4MRIA 3OW2Z 1K8A2 2V8KA 4NB9A 1VQK1 4QTTA 3CCJ1 3I55Z 2OTL1 4DQYB 3D6WA 1DL6A 3P5JB 3M3YI 3S15I 2E2JI 2HU9A 1VQ51 1L1OC 3CCQ1 3S2DI 1USPA 1USPB 3CC2Z 1KQSZ 2E2II 4BXXI 2OTJZ 4E33A 2OZKA 1SFOI 1Y1VS 1VQ6Z 4E32A 1VQPZ 4Y7NI 1YJW1 4A3LI 2G2KA 2V8JA 3F3PC 1TWGI 3CCRZ 3CXCZ 1TWAI 2RT9A 4E2WA 1N8R2 2WB1A 3VMIA 5A2Qb 3J81f 3BG1B 1VQKZ 1JWHC 3CCJZ 1NJI1 1YIJ1 2OTLZ 5T6BA 1X3ZA 4MONA 2JA7I 3VMHA 1M1K2 2IZ3A 3Q87A 1VQ5Z 1RNIA 3CD61 4A3KI 4A3FI 1Q7Y2 2VF1A 1KRLA 1RQFA 1N2FA 3G6E1 1Z01A 3K7AI 2YU9I 3MZKB 2F4OA 3I561 2Y0SA 5C44I 1YJWZ 4NBHA 1R9TI 1VQO1 2BJOA 3RZOI 1QVFZ 3VMGA 3CMA1 1W2BY 2B63I 1ZB8A 4NBCA 1TWCI 3GCFA 4E2ZA 4A3GI 3IFUA 2QEX1 2RBLA 2Q4ZA 2H85A 4X6AI 4BBSI 4A3EI 2QRCB 4MXUA 3CD6Z 3S16I 2LFUA 1VQ41 3H0GI 3BG0B 3J80b 3G6EZ 5A2Qf 4DGLA 1M902 2VUGA 3F3FC 3I56Z 1TWFI 2AKLA 1K9M1 3EEDA 2V8IA 4Y52I 1I6HI 3CCS1 1VQOZ 1YHQ1 1QVGY 2PM9A 1WIIA 3G4SZ 4A3CI 1Q862 1S72Z 2Q51A 3CMAZ 3M4OI 2HF1A 3GTLI 5IP9I 5IP7I 2QEXZ 2R92I 2QA41 2NVXI 3S1QI 4A3JI 3GTMI 1Q822 3QWUA 4E30A 1VQ4Z 3IF8A 3HOWI 3S17I 2GU2A 2JA8I 2NVYI 2JA6I 4BBRI 1Z02A 1TWHI 1VQMZ 2P3YA 2RPRA 3NH5A 4HGZA 3CQZI 2E9HA 3CCSZ 1RO4A 3CME1 1KC82 1I3QI 3J80f 3G711 3FQQA 2OOXB 2PMZA 3EERA 4A3DI 1QYPA 2QLVB 1K732 1P9NA 3GTPI 1S7MA 2QA4Z 3HKZA 3T4NB 4BY1I 2K3RA 3CCL1 2M48A 1KD12 3RZDI 3GTMS 1RLYA 3CCQZ 1NP6A 1YI21 1YJ91 3GTQI 1LQLA 3NFZA 5D1PA 1Q812 1X3WA 2DE6A 2IZ4A 1Y1WI 2DE5A 3NDIA 2W04A 3CMEZ 1K8A1 3S2HI 5FLMI 4NBDA 3G71Z 4RVFA 2JR6A 2O53A 4E2XA 2NVTI 3GTJI 1YUAA 1YIJZ 2ZAEB 3GTGI 1QF8A 4MH4A 3CC71 2R7ZI 3CCLZ 3GTKI 1W2BZ 2GTHA 1RO2A 3FKII 2JA5I 1YI2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Z;  1VQ9 1;  3CCR Z;  3CXC Z;  2QA4 1;  1YJN 1;  1QVF Y;  1N8R 2;  1VQL Z;  1N8R 1;  3I55 1;  1Q82 2;  3CCV 1;  1VQ4 Z;  1Q82 1;  1VQ7 1;  1JJ2 Z;  1VQK Z;  3CCJ Z;  1NJI 1;  1YIJ 1;  2OTL Z;  1YIT Z;  1M1K 2;  1VQM Z;  3G4S 1;  1M1K 1;  3OW2 Y;  1S72 1;  3CCM Z;  1VQ5 Z;  3CD6 1;  1VQN Z;  1VQ8 1;  1YJ9 Z;  3CCS Z;  1Q7Y 2;  1Q7Y 1;  3CME 1;  3CC7 Z;  1VQP 1;  3G6E 1;  1QVG Z;  1KC8 2;  3CCE 1;  1KC8 1;  3CC4 1;  3G71 1;  3CCR 1;  3I56 1;  1YJW Z;  3CCU 1;  1NJI 2;  1Q81 1;  1VQ9 Z;  1K73 2;  1VQO 1;  1K73 1;  1YJN Z;  2QA4 Z;  3CPW Y;  1KQS Y;  1QVF Z;  3CC2 1;  2OTJ 1;  3CCL 1;  3CCV Z;  3CMA 1;  1W2B Y;  1VQ7 Z;  1KD1 2;  1VQM 1;  1VQ6 1;  1KD1 1;  1YHQ Z;  3CCQ Z;  1YI2 1;  1YJ9 1;  2QEX 1;  3CXC Y;  3CPW Z;  1VQL 1;  3CD6 Z;  3OW2 Z;  1VQ8 Z;  1Q81 2;  1VQ4 1;  3CME Z;  1K8A 2;  1K8A 1;  3G6E Z;  3CCE Z;  1VQK 1;  3CCJ 1;  3CC4 Z;  3G71 Z;  1M90 2;  3I55 Z;  2OTL 1;  1M90 1;  1YIT 1;  3I56 Z;  1K9M 2;  1K9M 1;  3CCU Z;  3CCM 1;  1VQ5 1;  1VQN 1;  1YIJ Z;  3CCS 1;  1VQO Z;  3CC7 1;  1YHQ 1;  3CCQ 1;  1QVG Y;  3G4S Z;  3CC2 Z;  1KQS Z;  2OTJ Z;  1Q86 2;  1S72 Z;  3CCL Z;  3CMA Z;  1Q86 1;  1W2B Z;  1VQ6 Z;  1VQP Z;  1JJ2 Y;  1YJW 1;  1YI2 Z; 
#chains in the Genus database with same CATH topology
 1X0T A;  1VQ9 1;  4AYB A;  3PO3 S;  1N8R 1;  3I55 1;  3CCV 1;  4RVG A;  1ZB9 A;  3S1R I;  1FDI A;  1NUI A;  3HOZ I;  4NBA A;  2O4H A;  3GKQ A;  2QR1 B;  5T67 A;  1M1K 1;  3I4N I;  3OW2 Y;  1K83 I;  2WAQ A;  4EWC A;  5C3E I;  3KIF A;  1VQ8 1;  3I4M I;  5D1O A;  1Q7Y 1;  3CC7 Z;  2PK7 A;  1VQP 1;  3PO2 I;  2KI7 B;  1QVG Z;  1WCM I;  2J6A A;  3CCE 1;  3JAM b;  1I50 I;  3CC4 1;  3FQM A;  4XX2 A;  3CCR 1;  4NOZ A;  2RIQ A;  4QTU A;  2DE7 A;  3CCU 1;  2EGT A;  4A3I I;  2I3C A;  4NBE A;  1Q81 1;  5FLX b;  1Q16 A;  1VQ9 Z;  1ML8 A;  2JNY A;  2JMO A;  1Y8C A;  3CPW Y;  1KQS Y;  4A3M I;  2V45 A;  3CCV Z;  3TE5 B;  4HGY A;  5C4X I;  2R93 I;  1YHQ Z;  2KPI A;  2M6N A;  2V3V A;  2OOY B;  3CXC Y;  2QRE B;  4HH4 A;  3VTN A;  3S14 I;  4MD7 A;  3CPW Z;  3KIH A;  1VQL 1;  2VPX A;  1VQ8 Z;  4MD8 A;  3H3V J;  4A93 I;  3CCE Z;  2LIY A;  5AN9 F;  4DK1 A;  2QKD A;  3CC4 Z;  2QRD B;  1M90 1;  1YIT 1;  1K9M 2;  3I07 A;  3MON A;  4NBF A;  2VUM I;  3PO3 I;  3CCU Z;  3CCM 1;  2F4M A;  1VQN 1;  3MZL B;  2NVQ I;  3NDJ A;  1YUK A;  5IT9 b;  4A3B I;  3U50 C;  3HOX I;  3S1M I;  3HOY I;  1Q86 1;  4NFR A;  3S1N I;  2P28 A;  2YAD A;  4BY7 I;  3JAM f;  2K5R A;  2JUB A;  1JJ2 Y;  4TNU A;  4E31 A;  4E2Y A;  1ZH1 A;  1YJN 1;  5FLX f;  3VB9 A;  1QVF Y;  2JS4 A;  1PFT A;  1VQL Z;  3GTO I;  5LL6 f;  2JIM A;  1Q82 1;  1VQ7 1;  2R6M A;  1JJ2 Z;  3HOU I;  1RO0 A;  4RVH A;  1VLA A;  1YIT Z;  4RVD A;  3G4S 1;  4NBG A;  1S72 1;  3CCM Z;  1VQN Z;  1YJ9 Z;  5C4J I;  1TFI A;  4NBB A;  5CM2 M;  2E2H I;  4RV9 A;  3D9X A;  1KC8 1;  4NB8 A;  3HOV I;  4MD9 A;  3LUS A;  3J7A 4;  4S1T A;  5T64 A;  1NJI 2;  3NH4 A;  2GTI A;  1K73 1;  1YJN Z;  1Y1V I;  3CC2 1;  5IT9 f;  2OTJ 1;  1Z03 A;  1VQ7 Z;  3J81 b;  3ESW A;  1VQM 1;  1VQ6 1;  1KD1 1;  5D1O B;  4NH1 C;  2JIO A;  4CL1 A;  3TDH B;  3NH8 A;  1WW9 A;  4RS4 A;  2RHB A;  3IX0 A;  2W03 A;  4MRI A;  3OW2 Z;  1K8A 2;  2V8K A;  1QXF A;  4NB9 A;  1VQK 1;  4QTT A;  3CCJ 1;  3I55 Z;  2OTL 1;  4DQY B;  3D6W A;  1DL6 A;  3P5J B;  3M3Y I;  3S15 I;  2E2J I;  2HU9 A;  1VQ5 1;  1L1O C;  3CCQ 1;  3S2D I;  1USP A;  1USP B;  3CC2 Z;  1KQS Z;  2E2I I;  4BXX I;  2OTJ Z;  4E33 A;  2OZK A;  1SFO I;  1Y1V S;  1VQ6 Z;  4E32 A;  1VQP Z;  4Y7N I;  1YJW 1;  4A3L I;  2G2K A;  2V8J A;  3F3P C;  1TWG I;  3CCR Z;  3CXC Z;  1TWA I;  2RT9 A;  4E2W A;  1N8R 2;  2WB1 A;  3VMI A;  5A2Q b;  2LEX A;  3J81 f;  3BG1 B;  1VQK Z;  1JWH C;  3CCJ Z;  1NJI 1;  1YIJ 1;  2OTL Z;  5T6B A;  1X3Z A;  4MON A;  2JA7 I;  3VMH A;  1M1K 2;  2IZ3 A;  3Q87 A;  1VQ5 Z;  1RNI A;  3CD6 1;  2E7Z A;  4A3K I;  4A3F I;  1Q7Y 2;  2VF1 A;  1KRL A;  1RQF A;  1N2F A;  3G6E 1;  1Z01 A;  3K7A I;  2YU9 I;  3MZK B;  2F4O A;  3I56 1;  2Y0S A;  5C44 I;  1YJW Z;  2IV2 X;  4NBH A;  1R9T I;  1VQO 1;  2BJO A;  3RZO I;  1QVF Z;  3VMG A;  2AYD A;  3CMA 1;  1W2B Y;  2B63 I;  1ZB8 A;  4NBC A;  1TWC I;  3GCF A;  4E2Z A;  4A3G I;  3IFU A;  2QEX 1;  2RBL A;  1AA6 A;  2Q4Z A;  2H85 A;  4X6A I;  4BBS I;  4A3E I;  2QRC B;  4MXU A;  3CD6 Z;  3S16 I;  2LFU A;  1VQ4 1;  3H0G I;  3BG0 B;  3D2L A;  3J80 b;  3G6E Z;  5A2Q f;  4DGL A;  1M90 2;  2VUG A;  3F3F C;  3I56 Z;  1TWF I;  2JIP A;  2AKL A;  1K9M 1;  3EED A;  2V8I A;  4Y52 I;  1I6H I;  3CCS 1;  1WZN A;  1VQO Z;  1YHQ 1;  1QVG Y;  2PM9 A;  1WII A;  3G4S Z;  4A3C I;  1Q86 2;  1S72 Z;  2Q51 A;  3CMA Z;  3M4O I;  2VPZ A;  2HF1 A;  3GTL I;  3IR7 A;  5IP9 I;  5IP7 I;  2QEX Z;  2R92 I;  2QA4 1;  2NVX I;  3S1Q I;  4A3J I;  3GTM I;  1Q82 2;  3QWU A;  4E30 A;  1VQ4 Z;  3IF8 A;  3HOW I;  3S17 I;  2GU2 A;  2JA8 I;  2NVY I;  2JA6 I;  4BBR I;  1WJ2 A;  1Z02 A;  1TWH I;  1VQM Z;  2P3Y A;  2RPR A;  3NH5 A;  4HGZ A;  3CQZ I;  2E9H A;  3CCS Z;  1RO4 A;  3CME 1;  1KC8 2;  1I3Q I;  3J80 f;  3G71 1;  3FQQ A;  2OOX B;  2PMZ A;  3EER A;  2JIQ A;  4A3D I;  1QYP A;  2QLV B;  1K73 2;  1P9N A;  3GTP I;  1S7M A;  2QA4 Z;  3HKZ A;  3T4N B;  2VPW A;  4BY1 I;  2K3R A;  3CCL 1;  2M48 A;  1KD1 2;  3RZD I;  3GTM S;  1RLY A;  3CCQ Z;  1NP6 A;  1YI2 1;  1YJ9 1;  3GTQ I;  1LQL A;  3NFZ A;  5D1P A;  1SIW A;  1Q81 2;  1X3W A;  2DE6 A;  2IZ4 A;  1Y1W I;  2DE5 A;  3NDI A;  2W04 A;  3CME Z;  1K8A 1;  1FDO A;  3S2H I;  5FLM I;  4NBD A;  3G71 Z;  4RVF A;  2JR6 A;  2O53 A;  4E2X A;  2NVT I;  2JIR A;  3GTJ I;  1YUA A;  1YIJ Z;  2ZAE B;  3GTG I;  1QF8 A;  4MH4 A;  2NAP A;  3CC7 1;  2R7Z I;  2VPY A;  3CCL Z;  3GTK I;  1W2B Z;  2GTH A;  1RO2 A;  3FKI I;  2JA5 I;  1YI2 Z; 
#chains in the Genus database with same CATH homology
 1X0T A;  1VQ9 1;  4AYB A;  3PO3 S;  1N8R 1;  3I55 1;  3CCV 1;  4RVG A;  1ZB9 A;  3S1R I;  1NUI A;  3HOZ I;  4NBA A;  2O4H A;  3GKQ A;  2QR1 B;  5T67 A;  1M1K 1;  3I4N I;  3OW2 Y;  1K83 I;  2WAQ A;  4EWC A;  5C3E I;  3KIF A;  1VQ8 1;  3I4M I;  5D1O A;  1Q7Y 1;  3CC7 Z;  2PK7 A;  1VQP 1;  3PO2 I;  2KI7 B;  1QVG Z;  1WCM I;  2J6A A;  3CCE 1;  3JAM b;  1I50 I;  3CC4 1;  3FQM A;  4XX2 A;  3CCR 1;  4NOZ A;  2RIQ A;  4QTU A;  2DE7 A;  3CCU 1;  2EGT A;  4A3I I;  2I3C A;  4NBE A;  1Q81 1;  5FLX b;  1VQ9 Z;  1ML8 A;  2JMO A;  2JNY A;  3CPW Y;  1KQS Y;  4A3M I;  3CCV Z;  3TE5 B;  4HGY A;  5C4X I;  2R93 I;  1YHQ Z;  2KPI A;  2M6N A;  2OOY B;  3CXC Y;  2QRE B;  4HH4 A;  3VTN A;  3S14 I;  4MD7 A;  3CPW Z;  3KIH A;  1VQL 1;  1VQ8 Z;  4MD8 A;  3H3V J;  4A93 I;  3CCE Z;  2LIY A;  5AN9 F;  4DK1 A;  2QKD A;  3CC4 Z;  2QRD B;  1M90 1;  1YIT 1;  1K9M 2;  3I07 A;  3MON A;  4NBF A;  2VUM I;  3PO3 I;  3CCU Z;  3CCM 1;  2F4M A;  1VQN 1;  3MZL B;  2NVQ I;  3NDJ A;  1YUK A;  5IT9 b;  4A3B I;  3U50 C;  3HOX I;  3S1M I;  3HOY I;  1Q86 1;  4NFR A;  3S1N I;  2P28 A;  2YAD A;  4BY7 I;  3JAM f;  2K5R A;  2JUB A;  1JJ2 Y;  4TNU A;  4E31 A;  4E2Y A;  1ZH1 A;  1YJN 1;  5FLX f;  3VB9 A;  1QVF Y;  2JS4 A;  1PFT A;  1VQL Z;  3GTO I;  5LL6 f;  1Q82 1;  1VQ7 1;  2R6M A;  1JJ2 Z;  3HOU I;  1RO0 A;  4RVH A;  1VLA A;  1YIT Z;  4RVD A;  3G4S 1;  4NBG A;  1S72 1;  3CCM Z;  1VQN Z;  1YJ9 Z;  5C4J I;  1TFI A;  4NBB A;  5CM2 M;  2E2H I;  4RV9 A;  3D9X A;  1KC8 1;  4NB8 A;  3HOV I;  4MD9 A;  3LUS A;  3J7A 4;  4S1T A;  5T64 A;  1NJI 2;  3NH4 A;  2GTI A;  1K73 1;  1YJN Z;  1Y1V I;  3CC2 1;  5IT9 f;  2OTJ 1;  1Z03 A;  1VQ7 Z;  3J81 b;  3ESW A;  1VQM 1;  1VQ6 1;  1KD1 1;  5D1O B;  4NH1 C;  4CL1 A;  3TDH B;  3NH8 A;  1WW9 A;  4RS4 A;  2RHB A;  3IX0 A;  2W03 A;  4MRI A;  3OW2 Z;  1K8A 2;  2V8K A;  4NB9 A;  1VQK 1;  4QTT A;  3CCJ 1;  3I55 Z;  2OTL 1;  4DQY B;  3D6W A;  1DL6 A;  3P5J B;  3M3Y I;  3S15 I;  2E2J I;  2HU9 A;  1VQ5 1;  1L1O C;  3CCQ 1;  3S2D I;  1USP A;  1USP B;  3CC2 Z;  1KQS Z;  2E2I I;  4BXX I;  2OTJ Z;  4E33 A;  2OZK A;  1SFO I;  1Y1V S;  1VQ6 Z;  4E32 A;  1VQP Z;  4Y7N I;  1YJW 1;  4A3L I;  2G2K A;  2V8J A;  3F3P C;  1TWG I;  3CCR Z;  3CXC Z;  1TWA I;  2RT9 A;  4E2W A;  1N8R 2;  2WB1 A;  3VMI A;  5A2Q b;  3J81 f;  3BG1 B;  1VQK Z;  1JWH C;  3CCJ Z;  1NJI 1;  1YIJ 1;  2OTL Z;  5T6B A;  1X3Z A;  4MON A;  2JA7 I;  3VMH A;  1M1K 2;  2IZ3 A;  3Q87 A;  1VQ5 Z;  1RNI A;  3CD6 1;  4A3K I;  4A3F I;  1Q7Y 2;  2VF1 A;  1KRL A;  1RQF A;  1N2F A;  3G6E 1;  1Z01 A;  3K7A I;  2YU9 I;  3MZK B;  2F4O A;  3I56 1;  2Y0S A;  5C44 I;  1YJW Z;  4NBH A;  1R9T I;  1VQO 1;  2BJO A;  3RZO I;  1QVF Z;  3VMG A;  3CMA 1;  1W2B Y;  2B63 I;  1ZB8 A;  4NBC A;  1TWC I;  3GCF A;  4E2Z A;  4A3G I;  3IFU A;  2QEX 1;  2RBL A;  2Q4Z A;  2H85 A;  4X6A I;  4BBS I;  4A3E I;  2QRC B;  4MXU A;  3CD6 Z;  3S16 I;  2LFU A;  1VQ4 1;  3H0G I;  3BG0 B;  3J80 b;  3G6E Z;  5A2Q f;  4DGL A;  1M90 2;  2VUG A;  3F3F C;  3I56 Z;  1TWF I;  2AKL A;  1K9M 1;  3EED A;  2V8I A;  4Y52 I;  1I6H I;  3CCS 1;  1VQO Z;  1YHQ 1;  1QVG Y;  2PM9 A;  1WII A;  3G4S Z;  4A3C I;  1Q86 2;  1S72 Z;  2Q51 A;  3CMA Z;  3M4O I;  2HF1 A;  3GTL I;  5IP9 I;  5IP7 I;  2QEX Z;  2R92 I;  2QA4 1;  2NVX I;  3S1Q I;  4A3J I;  3GTM I;  1Q82 2;  3QWU A;  4E30 A;  1VQ4 Z;  3IF8 A;  3HOW I;  3S17 I;  2GU2 A;  2JA8 I;  2NVY I;  2JA6 I;  4BBR I;  1Z02 A;  1TWH I;  1VQM Z;  2P3Y A;  2RPR A;  3NH5 A;  4HGZ A;  3CQZ I;  2E9H A;  3CCS Z;  1RO4 A;  3CME 1;  1KC8 2;  1I3Q I;  3J80 f;  3G71 1;  3FQQ A;  2OOX B;  2PMZ A;  3EER A;  4A3D I;  1QYP A;  2QLV B;  1K73 2;  1P9N A;  3GTP I;  1S7M A;  2QA4 Z;  3HKZ A;  3T4N B;  4BY1 I;  2K3R A;  3CCL 1;  2M48 A;  1KD1 2;  3RZD I;  3GTM S;  1RLY A;  3CCQ Z;  1NP6 A;  1YI2 1;  1YJ9 1;  3GTQ I;  1LQL A;  3NFZ A;  5D1P A;  1Q81 2;  1X3W A;  2DE6 A;  2IZ4 A;  1Y1W I;  2DE5 A;  3NDI A;  2W04 A;  3CME Z;  1K8A 1;  3S2H I;  5FLM I;  4NBD A;  3G71 Z;  4RVF A;  2JR6 A;  2O53 A;  4E2X A;  2NVT I;  3GTJ I;  1YUA A;  1YIJ Z;  2ZAE B;  3GTG I;  1QF8 A;  4MH4 A;  3CC7 1;  2R7Z I;  3CCL Z;  3GTK I;  1W2B Z;  2GTH A;  1RO2 A;  3FKI I;  2JA5 I;  1YI2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...