1YJ91

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yj9100
1W2BZ 3CXCY 3CCU1 1YJW1 3G4S1 1K8A2 1VQ71 1YJWZ 1Q812 2QA41 1NJI1 3CCVZ 1W2BY 3CC71 3G711 1KC82 2OTL1 1M1K1 3I551 3CCM1 1VQNZ 3CC7Z 3G71Z 3CCEZ 1YIJZ 1VQKZ 1K9M1 1S721 3CCL1 1S72Z 1Q861 1N8R1 1YITZ 1VQO1 1YHQ1 3CCLZ 1QVGZ 1KD11 3CCV1 1VQPZ 1JJ2Z 3CC2Z 1VQOZ 1YHQZ 1Q7Y2 1VQN1 1VQ41 3CD6Z 3CCE1 1VQ61 1VQ4Z 1Q821 1YIJ1 1VQK1 1VQ6Z 1K731 1VQM1 1QVGY 3CCSZ 1VQ9Z 1VQMZ 1VQ81 1YIT1 3CCQZ 1JJ2Y 1QVFZ 1VQ8Z 1VQP1 1NJI2 3CMA1 3CC21 1YI21 3CCJ1 1VQLZ 1YJN1 3CMAZ 1YI2Z 1M1K2 3CD61 1YJ9Z 3CCJZ 3OW2Z 1YJNZ 3CME1 1KC81 1KQSZ 3CC4Z 1K9M2 3CMEZ 1M901 1QVFY 3CCS1 1VQ91 3CPWZ 3CCQ1 1Q862 1N8R2 3CCUZ 3I561 1KD12 3CCR1 2OTJ1 1VQL1 3CXCZ 3G4SZ 3OW2Y 2QEX1 1VQ7Z 3I56Z 3G6E1 1K8A1 3CCRZ 2OTJZ 1YJ91 1KQSY 2QEXZ 2QA4Z 3G6EZ 1VQ51 1Q811 1Q822 3CC41 1Q7Y1 1M902 3CPWY 2OTLZ 1VQ5Z 1K732 3I55Z 3CCMZ
chains in the Genus database with same CATH superfamily
3NH5A 1AA6A 4E33A 2JIMA 2JIRA 2M48A 4DGLA 3HOUI 4A3MI 1YJW1 2RHBA 1VQ71 3RZDI 5CM2M 5LL6f 3KIHA 2BJOA 4MRIA 1Q812 2QA41 3VB9A 1NJI1 1W2BY 2QREB 2WB1A 2VPZA 1M1K1 4NBFA 3JAMf 3TE5B 3CCM1 4A3GI 3G71Z 3FQMA 4A3CI 3NH8A 3GTJI 2O4HA 3S2HI 1YIJZ 2VUGA 2G2KA 5C44I 2JA8I 4DK1A 3CCL1 1S72Z 1YITZ 1WJ2A 3H0GI 3MZLB 4QTUA 2JA7I 2W04A 4A3LI 3MONA 2OOYB 4HGZA 1VQPZ 1JJ2Z 3CC2Z 1VQOZ 1YHQZ 1YUKA 3GTMS 2GU2A 4A3II 1VQ61 3EERA 1Z03A 1RLYA 4DQYB 1VLAA 1Q821 1YIJ1 4MD7A 2HF1A 2QRDB 4A93I 1VQM1 3J81b 1KRLA 2OZKA 1VQ9Z 3TDHB 1YIT1 3CCQZ 1VQ8Z 1VQP1 3CC21 2NVXI 2R92I 1ZH1A 2RT9A 3CMAZ 3U50C 4BY7I 2HU9A 2P3YA 1TFIA 2NVTI 3CME1 3K7AI 2VPYA 1K9M2 1RQFA 1LQLA 1VQ91 3CPWZ 3CCQ1 1TWHI 1N8R2 3M3YI 2ZAEB 2JIQA 2V3VA 1NUIA 2Q51A 3G4SZ 4NH1C 2YADA 3NFZA 4HGYA 3CCRZ 1TWCI 1NP6A 1KQSY 1USPA 1SFOI 2QEXZ 1VQ51 3EEDA 3S1NI 4NBAA 1M902 2IZ3A 4RV9A 1K732 1Q16A 4X6AI 3HKZA 1YUAA 3BG0B 3J81f 3CXCY 1ZB8A 3G4S1 4HH4A 1R9TI 2NVYI 1YJWZ 4S1TA 3NDJA 1DL6A 3VMIA 1TWAI 1KC82 3Q87A 3FQQA 3NH4A 4MONA 3I4MI 3CCEZ 4E2YA 3D9XA 2KPIA 5C3EI 2NVQI 2VUMI 1K9M1 3HOYI 2AKLA 2Q4ZA 4RVHA 4E32A 1N8R1 3CCLZ 4NBGA 5D1OB 4NBCA 5FLMI 1VQ41 1FDIA 3CD6Z 3CCE1 4BXXI 3H3VJ 1VQ6Z 1I50I 1K731 4NBDA 2F4OA 1TWGI 5AN9F 2R6MA 2V8IA 3F3PC 5IT9f 3VTNA 1VQMZ 5T6BA 3HOZI 1JJ2Y 1QVFZ 3MZKB 5FLXb 2R93I 3GTKI 3CCJ1 4RVDA 1VQLZ 3RZOI 3HOXI 1YJN1 3CD61 3PO2I 5IP9I 3OW2Z 2E2JI 1RO4A 4E2XA 1TWFI 2J6AA 2QRCB 1KC81 3KIFA 3CC4Z 5D1OA 3CMEZ 2DE5A 5C4XI 1USPB 2E9HA 4NBBA 5T64A 2LIYA 2QKDA 3CCUZ 1KD12 3S17I 2OTJ1 1VQL1 2E2HI 1I6HI 3GTPI 4RVFA 2Y0SA 3GTLI 3PO3I 2K3RA 2PM9A 1Q811 3NDIA 2GTIA 3J80b 3CC41 4E2WA 3CPWY 2OTLZ 1VQ5Z 3I55Z 4NB8A 2E7ZA 1ML8A 2YU9I 1JWHC 4A3JI 2WAQA 2DE7A 4NFRA 3CCU1 1N2FA 1WIIA 1K8A2 2IZ4A 4XX2A 1Z02A 2LEXA 3D6WA 4NBEA 4Y52I 5FLXf 2RIQA 3ESWA 2VPWA 3CCVZ 3HOVI 2W03A 3CC71 1QYPA 2VPXA 2OTL1 1WW9A 4NBHA 3I551 1RO0A 3M4OI 5D1PA 5IP7I 2PK7A 1QXFA 2RBLA 3S15I 3T4NB 1X3ZA 5IT9b 4TNUA 3P5JB 3S1QI 4E2ZA 1QVGZ 1KD11 3IR7A 3CCV1 2VF1A 3PO3S 3S2DI 1Q7Y2 5T67A 3J80f 1VQ4Z 3S14I 3S16I 1I3QI 4A3KI 2O53A 1RNIA 2JA5I 4CL1A 2LFUA 3CCSZ 3J7A4 1YI21 3S1RI 1Z01A 2GTHA 1YJ9Z 3CCJZ 3GCFA 1WZNA 2M6NA 1YJNZ 3D2LA 3VMGA 3BG1B 2OOXB 1M901 1QVFY 3CCS1 2JIOA 2K5RA 1Q862 4BY1I 1QF8A 4NOZA 1PFTA 4RVGA 3I561 2B63I 3CQZI 1Y8CA 3OW2Y 1SIWA 2JNYA 5C4JI 3G6E1 1L1OC 4A3EI 2OTJZ 1YJ91 1Q7Y1 4Y7NI 1W2BZ 4A3FI 2JUBA 4EWCA 4A3DI 1Y1WI 4MD8A 4RS4A 3G711 3I4NI 1ZB9A 2NAPA 1VQNZ 3CC7Z 1Y1VI 1WCMI 1P9NA 1K83I 3I07A 2JIPA 2JR6A 1VQKZ 1X3WA 1S721 3VMHA 1Q861 4E30A 2P28A 1VQO1 1YHQ1 2JS4A 3F3FC 3QWUA 4E31A 4NB9A 2DE6A 1VQN1 5A2Qb 1FDOA 3GTQI 1VQK1 2PMZA 1QVGY 2JA6I 4AYBA 3HOWI 2RPRA 1VQ81 1RO2A 3GTOI 2QR1B 2H85A 1NJI2 3CMA1 3LUSA 1M1K2 1YI2Z 2I3CA 3GTGI 2F4MA 4MH4A 1X0TA 2KI7B 2IV2X 2V8KA 3JAMb 3IX0A 1Y1VS 4QTTA 2EGTA 1KQSZ 3GKQA 4BBRI 3S1MI 2JMOA 2E2II 3IF8A 4BBSI 2AYDA 4MD9A 3CCR1 2QLVB 3CXCZ 2QEX1 3FKII 3I56Z 1VQ7Z 1K8A1 4MXUA 2R7ZI 2QA4Z 3G6EZ 1S7MA 3GTMI 4A3BI 1Q822 3IFUA 2V8JA 5A2Qf 3CCMZ 2V45A
chains in the Genus database with same CATH topology
3NH5A 4E33A 2M48A 4DGLA 3HOUI 4A3MI 1YJW1 2RHBA 1VQ71 3RZDI 5CM2M 5LL6f 3KIHA 2BJOA 4MRIA 1Q812 2QA41 3VB9A 1NJI1 1W2BY 2QREB 2WB1A 1M1K1 4NBFA 3JAMf 3TE5B 3CCM1 4A3GI 3G71Z 3FQMA 4A3CI 3NH8A 3GTJI 2O4HA 3S2HI 1YIJZ 2VUGA 2G2KA 5C44I 2JA8I 4DK1A 3CCL1 1S72Z 1YITZ 3H0GI 3MZLB 4QTUA 2JA7I 2W04A 4A3LI 3MONA 2OOYB 4HGZA 1VQPZ 1JJ2Z 3CC2Z 1VQOZ 1YHQZ 1YUKA 3GTMS 2GU2A 4A3II 1VQ61 3EERA 1Z03A 1RLYA 4DQYB 1VLAA 1Q821 1YIJ1 4MD7A 2HF1A 2QRDB 4A93I 1VQM1 3J81b 1KRLA 2OZKA 1VQ9Z 3TDHB 1YIT1 3CCQZ 1VQ8Z 1VQP1 3CC21 2NVXI 2R92I 1ZH1A 2RT9A 3CMAZ 3U50C 4BY7I 2HU9A 2P3YA 1TFIA 2NVTI 3CME1 3K7AI 1K9M2 1RQFA 1LQLA 1VQ91 3CPWZ 3CCQ1 1TWHI 1N8R2 3M3YI 2ZAEB 1NUIA 2Q51A 4NH1C 3G4SZ 2YADA 3NFZA 4HGYA 3CCRZ 1TWCI 1NP6A 1KQSY 1USPA 1SFOI 2QEXZ 1VQ51 3EEDA 3S1NI 4NBAA 1M902 2IZ3A 4RV9A 1K732 4X6AI 3HKZA 1YUAA 3BG0B 3J81f 3CXCY 1ZB8A 3G4S1 4HH4A 1R9TI 2NVYI 1YJWZ 4S1TA 3NDJA 1DL6A 3VMIA 1TWAI 1KC82 3Q87A 3FQQA 3NH4A 4MONA 3I4MI 3CCEZ 4E2YA 3D9XA 2KPIA 5C3EI 2NVQI 2VUMI 1K9M1 3HOYI 2AKLA 2Q4ZA 4RVHA 4E32A 1N8R1 3CCLZ 4NBGA 5D1OB 4NBCA 5FLMI 1VQ41 3CD6Z 3CCE1 4BXXI 3H3VJ 1VQ6Z 1I50I 1K731 4NBDA 2F4OA 1TWGI 5AN9F 2R6MA 2V8IA 3F3PC 5IT9f 3VTNA 1VQMZ 5T6BA 3HOZI 1JJ2Y 1QVFZ 3MZKB 5FLXb 2R93I 3GTKI 3CCJ1 4RVDA 1VQLZ 3RZOI 3HOXI 1YJN1 3CD61 3PO2I 5IP9I 3OW2Z 2E2JI 1RO4A 4E2XA 1TWFI 2J6AA 2QRCB 1KC81 3KIFA 3CC4Z 5D1OA 3CMEZ 2DE5A 5C4XI 1USPB 2E9HA 4NBBA 5T64A 2LIYA 2QKDA 3CCUZ 1KD12 3S17I 2OTJ1 1VQL1 2E2HI 1I6HI 3GTPI 4RVFA 2Y0SA 3GTLI 3PO3I 2K3RA 2PM9A 1Q811 3NDIA 2GTIA 3J80b 3CC41 4E2WA 3CPWY 2OTLZ 1VQ5Z 3I55Z 4NB8A 1ML8A 2YU9I 1JWHC 4A3JI 2WAQA 2DE7A 4NFRA 3CCU1 1N2FA 1WIIA 1K8A2 2IZ4A 4XX2A 1Z02A 3D6WA 4NBEA 4Y52I 5FLXf 2RIQA 3ESWA 3CCVZ 3HOVI 2W03A 3CC71 1QYPA 2OTL1 1WW9A 4NBHA 3I551 1RO0A 3M4OI 5D1PA 5IP7I 2PK7A 2RBLA 3S15I 3T4NB 1X3ZA 5IT9b 4TNUA 3P5JB 3S1QI 4E2ZA 1QVGZ 1KD11 3CCV1 2VF1A 3PO3S 3S2DI 1Q7Y2 5T67A 3J80f 1VQ4Z 3S14I 3S16I 1I3QI 4A3KI 2O53A 1RNIA 2JA5I 4CL1A 2LFUA 3CCSZ 3J7A4 1YI21 3S1RI 1Z01A 2GTHA 1YJ9Z 3CCJZ 3GCFA 2M6NA 1YJNZ 3VMGA 3BG1B 2OOXB 1M901 1QVFY 3CCS1 2K5RA 1Q862 4BY1I 1QF8A 4NOZA 1PFTA 4RVGA 3I561 2B63I 3CQZI 3OW2Y 2JNYA 5C4JI 3G6E1 1L1OC 4A3EI 2OTJZ 1YJ91 1Q7Y1 4Y7NI 1W2BZ 4A3FI 2JUBA 4EWCA 4A3DI 1Y1WI 4MD8A 4RS4A 3G711 3I4NI 1ZB9A 1VQNZ 3CC7Z 1Y1VI 1WCMI 1P9NA 1K83I 3I07A 2JR6A 1VQKZ 1X3WA 1S721 3VMHA 1Q861 4E30A 2P28A 1VQO1 1YHQ1 2JS4A 3F3FC 3QWUA 4E31A 4NB9A 2DE6A 1VQN1 5A2Qb 3GTQI 1VQK1 2PMZA 1QVGY 2JA6I 4AYBA 3HOWI 2RPRA 1VQ81 1RO2A 3GTOI 2QR1B 2H85A 1NJI2 3CMA1 3LUSA 1M1K2 1YI2Z 2I3CA 3GTGI 2F4MA 4MH4A 2KI7B 1X0TA 2V8KA 3JAMb 3IX0A 1Y1VS 4QTTA 2EGTA 1KQSZ 3GKQA 4BBRI 3S1MI 2JMOA 2E2II 3IF8A 4BBSI 4MD9A 3CCR1 2QLVB 3CXCZ 1VQ7Z 2QEX1 3FKII 3I56Z 1K8A1 4MXUA 2R7ZI 2QA4Z 3G6EZ 1S7MA 3GTMI 4A3BI 1Q822 3IFUA 2V8JA 5A2Qf 3CCMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B Z;  3CXC Y;  3CCU 1;  1YJW 1;  3G4S 1;  1K8A 2;  1VQ7 1;  1YJW Z;  1Q81 2;  2QA4 1;  1NJI 1;  3CCV Z;  1W2B Y;  3CC7 1;  3G71 1;  1KC8 2;  2OTL 1;  1M1K 1;  3I55 1;  3CCM 1;  1VQN Z;  3CC7 Z;  3G71 Z;  3CCE Z;  1YIJ Z;  1VQK Z;  1K9M 1;  1S72 1;  3CCL 1;  1S72 Z;  1Q86 1;  1N8R 1;  1YIT Z;  1VQO 1;  1YHQ 1;  3CCL Z;  1QVG Z;  1KD1 1;  3CCV 1;  1VQP Z;  1JJ2 Z;  3CC2 Z;  1VQO Z;  1YHQ Z;  1Q7Y 2;  1VQN 1;  1VQ4 1;  3CD6 Z;  3CCE 1;  1VQ6 1;  1VQ4 Z;  1Q82 1;  1YIJ 1;  1VQK 1;  1VQ6 Z;  1K73 1;  1VQM 1;  1QVG Y;  3CCS Z;  1VQ9 Z;  1VQM Z;  1VQ8 1;  1YIT 1;  3CCQ Z;  1JJ2 Y;  1QVF Z;  1VQ8 Z;  1VQP 1;  1NJI 2;  3CMA 1;  3CC2 1;  1YI2 1;  3CCJ 1;  1VQL Z;  1YJN 1;  3CMA Z;  1YI2 Z;  1M1K 2;  3CD6 1;  1YJ9 Z;  3CCJ Z;  3OW2 Z;  1YJN Z;  3CME 1;  1KC8 1;  1KQS Z;  3CC4 Z;  1K9M 2;  3CME Z;  1M90 1;  1QVF Y;  3CCS 1;  1VQ9 1;  3CPW Z;  3CCQ 1;  1Q86 2;  1N8R 2;  3CCU Z;  3I56 1;  1KD1 2;  3CCR 1;  2OTJ 1;  1VQL 1;  3CXC Z;  3G4S Z;  3OW2 Y;  2QEX 1;  1VQ7 Z;  3I56 Z;  3G6E 1;  1K8A 1;  3CCR Z;  2OTJ Z;  1YJ9 1;  1KQS Y;  2QEX Z;  2QA4 Z;  3G6E Z;  1VQ5 1;  1Q81 1;  1Q82 2;  3CC4 1;  1Q7Y 1;  1M90 2;  3CPW Y;  2OTL Z;  1VQ5 Z;  1K73 2;  3I55 Z;  3CCM Z; 
#chains in the Genus database with same CATH topology
 3NH5 A;  1AA6 A;  4E33 A;  2JIM A;  2JIR A;  2M48 A;  4DGL A;  3HOU I;  4A3M I;  1YJW 1;  2RHB A;  1VQ7 1;  3RZD I;  5CM2 M;  5LL6 f;  3KIH A;  2BJO A;  4MRI A;  1Q81 2;  2QA4 1;  3VB9 A;  1NJI 1;  1W2B Y;  2QRE B;  2WB1 A;  2VPZ A;  1M1K 1;  4NBF A;  3JAM f;  3TE5 B;  3CCM 1;  4A3G I;  3G71 Z;  3FQM A;  4A3C I;  3NH8 A;  3GTJ I;  2O4H A;  3S2H I;  1YIJ Z;  2VUG A;  2G2K A;  5C44 I;  2JA8 I;  4DK1 A;  3CCL 1;  1S72 Z;  1YIT Z;  1WJ2 A;  3H0G I;  3MZL B;  4QTU A;  2JA7 I;  2W04 A;  4A3L I;  3MON A;  2OOY B;  4HGZ A;  1VQP Z;  1JJ2 Z;  3CC2 Z;  1VQO Z;  1YHQ Z;  1YUK A;  3GTM S;  2GU2 A;  4A3I I;  1VQ6 1;  3EER A;  1Z03 A;  1RLY A;  4DQY B;  1VLA A;  1Q82 1;  1YIJ 1;  4MD7 A;  2HF1 A;  2QRD B;  4A93 I;  1VQM 1;  3J81 b;  1KRL A;  2OZK A;  1VQ9 Z;  3TDH B;  1YIT 1;  3CCQ Z;  1VQ8 Z;  1VQP 1;  3CC2 1;  2NVX I;  2R92 I;  1ZH1 A;  2RT9 A;  3CMA Z;  3U50 C;  4BY7 I;  2HU9 A;  2P3Y A;  1TFI A;  2NVT I;  3CME 1;  3K7A I;  2VPY A;  1K9M 2;  1RQF A;  1LQL A;  1VQ9 1;  3CPW Z;  3CCQ 1;  1TWH I;  1N8R 2;  3M3Y I;  2ZAE B;  2JIQ A;  2V3V A;  1NUI A;  2Q51 A;  3G4S Z;  4NH1 C;  2YAD A;  3NFZ A;  4HGY A;  3CCR Z;  1TWC I;  1NP6 A;  1KQS Y;  1USP A;  1SFO I;  2QEX Z;  1VQ5 1;  3EED A;  3S1N I;  4NBA A;  1M90 2;  2IZ3 A;  4RV9 A;  1K73 2;  1Q16 A;  4X6A I;  3HKZ A;  1YUA A;  3BG0 B;  3J81 f;  3CXC Y;  1ZB8 A;  3G4S 1;  4HH4 A;  1R9T I;  2NVY I;  1YJW Z;  4S1T A;  3NDJ A;  1DL6 A;  3VMI A;  1TWA I;  1KC8 2;  3Q87 A;  3FQQ A;  3NH4 A;  4MON A;  3I4M I;  3CCE Z;  4E2Y A;  3D9X A;  2KPI A;  5C3E I;  2NVQ I;  2VUM I;  1K9M 1;  3HOY I;  2AKL A;  2Q4Z A;  4RVH A;  4E32 A;  1N8R 1;  3CCL Z;  4NBG A;  5D1O B;  4NBC A;  5FLM I;  1VQ4 1;  1FDI A;  3CD6 Z;  3CCE 1;  4BXX I;  3H3V J;  1VQ6 Z;  1I50 I;  1K73 1;  4NBD A;  2F4O A;  1TWG I;  5AN9 F;  2R6M A;  2V8I A;  3F3P C;  5IT9 f;  3VTN A;  1VQM Z;  5T6B A;  3HOZ I;  1JJ2 Y;  1QVF Z;  3MZK B;  5FLX b;  2R93 I;  3GTK I;  3CCJ 1;  4RVD A;  1VQL Z;  3RZO I;  3HOX I;  1YJN 1;  3CD6 1;  3PO2 I;  5IP9 I;  3OW2 Z;  2E2J I;  1RO4 A;  4E2X A;  1TWF I;  2J6A A;  2QRC B;  1KC8 1;  3KIF A;  3CC4 Z;  5D1O A;  3CME Z;  2DE5 A;  5C4X I;  1USP B;  2E9H A;  4NBB A;  5T64 A;  2LIY A;  2QKD A;  3CCU Z;  1KD1 2;  3S17 I;  2OTJ 1;  1VQL 1;  2E2H I;  1I6H I;  3GTP I;  4RVF A;  2Y0S A;  3GTL I;  3PO3 I;  2K3R A;  2PM9 A;  1Q81 1;  3NDI A;  2GTI A;  3J80 b;  3CC4 1;  4E2W A;  3CPW Y;  2OTL Z;  1VQ5 Z;  3I55 Z;  4NB8 A;  2E7Z A;  1ML8 A;  2YU9 I;  1JWH C;  4A3J I;  2WAQ A;  2DE7 A;  4NFR A;  3CCU 1;  1N2F A;  1WII A;  1K8A 2;  2IZ4 A;  4XX2 A;  1Z02 A;  2LEX A;  3D6W A;  4NBE A;  4Y52 I;  5FLX f;  2RIQ A;  3ESW A;  2VPW A;  3CCV Z;  3HOV I;  2W03 A;  3CC7 1;  1QYP A;  2VPX A;  2OTL 1;  1WW9 A;  4NBH A;  3I55 1;  1RO0 A;  3M4O I;  5D1P A;  5IP7 I;  2PK7 A;  1QXF A;  2RBL A;  3S15 I;  3T4N B;  1X3Z A;  5IT9 b;  4TNU A;  3P5J B;  3S1Q I;  4E2Z A;  1QVG Z;  1KD1 1;  3IR7 A;  3CCV 1;  2VF1 A;  3PO3 S;  3S2D I;  1Q7Y 2;  5T67 A;  3J80 f;  1VQ4 Z;  3S14 I;  3S16 I;  1I3Q I;  4A3K I;  2O53 A;  1RNI A;  2JA5 I;  4CL1 A;  2LFU A;  3CCS Z;  3J7A 4;  1YI2 1;  3S1R I;  1Z01 A;  2GTH A;  1YJ9 Z;  3CCJ Z;  3GCF A;  1WZN A;  2M6N A;  1YJN Z;  3D2L A;  3VMG A;  3BG1 B;  2OOX B;  1M90 1;  1QVF Y;  3CCS 1;  2JIO A;  2K5R A;  1Q86 2;  4BY1 I;  1QF8 A;  4NOZ A;  1PFT A;  4RVG A;  3I56 1;  2B63 I;  3CQZ I;  1Y8C A;  3OW2 Y;  1SIW A;  2JNY A;  5C4J I;  3G6E 1;  1L1O C;  4A3E I;  2OTJ Z;  1YJ9 1;  1Q7Y 1;  4Y7N I;  1W2B Z;  4A3F I;  2JUB A;  4EWC A;  4A3D I;  1Y1W I;  4MD8 A;  4RS4 A;  3G71 1;  3I4N I;  1ZB9 A;  2NAP A;  1VQN Z;  3CC7 Z;  1Y1V I;  1WCM I;  1P9N A;  1K83 I;  3I07 A;  2JIP A;  2JR6 A;  1VQK Z;  1X3W A;  1S72 1;  3VMH A;  1Q86 1;  4E30 A;  2P28 A;  1VQO 1;  1YHQ 1;  2JS4 A;  3F3F C;  3QWU A;  4E31 A;  4NB9 A;  2DE6 A;  1VQN 1;  5A2Q b;  1FDO A;  3GTQ I;  1VQK 1;  2PMZ A;  1QVG Y;  2JA6 I;  4AYB A;  3HOW I;  2RPR A;  1VQ8 1;  1RO2 A;  3GTO I;  2QR1 B;  2H85 A;  1NJI 2;  3CMA 1;  3LUS A;  1M1K 2;  1YI2 Z;  2I3C A;  3GTG I;  2F4M A;  4MH4 A;  1X0T A;  2KI7 B;  2IV2 X;  2V8K A;  3JAM b;  3IX0 A;  1Y1V S;  4QTT A;  2EGT A;  1KQS Z;  3GKQ A;  4BBR I;  3S1M I;  2JMO A;  2E2I I;  3IF8 A;  4BBS I;  2AYD A;  4MD9 A;  3CCR 1;  2QLV B;  3CXC Z;  2QEX 1;  3FKI I;  3I56 Z;  1VQ7 Z;  1K8A 1;  4MXU A;  2R7Z I;  2QA4 Z;  3G6E Z;  1S7M A;  3GTM I;  4A3B I;  1Q82 2;  3IFU A;  2V8J A;  5A2Q f;  3CCM Z;  2V45 A; 
#chains in the Genus database with same CATH homology
 3NH5 A;  4E33 A;  2M48 A;  4DGL A;  3HOU I;  4A3M I;  1YJW 1;  2RHB A;  1VQ7 1;  3RZD I;  5CM2 M;  5LL6 f;  3KIH A;  2BJO A;  4MRI A;  1Q81 2;  2QA4 1;  3VB9 A;  1NJI 1;  1W2B Y;  2QRE B;  2WB1 A;  1M1K 1;  4NBF A;  3JAM f;  3TE5 B;  3CCM 1;  4A3G I;  3G71 Z;  3FQM A;  4A3C I;  3NH8 A;  3GTJ I;  2O4H A;  3S2H I;  1YIJ Z;  2VUG A;  2G2K A;  5C44 I;  2JA8 I;  4DK1 A;  3CCL 1;  1S72 Z;  1YIT Z;  3H0G I;  3MZL B;  4QTU A;  2JA7 I;  2W04 A;  4A3L I;  3MON A;  2OOY B;  4HGZ A;  1VQP Z;  1JJ2 Z;  3CC2 Z;  1VQO Z;  1YHQ Z;  1YUK A;  3GTM S;  2GU2 A;  4A3I I;  1VQ6 1;  3EER A;  1Z03 A;  1RLY A;  4DQY B;  1VLA A;  1Q82 1;  1YIJ 1;  4MD7 A;  2HF1 A;  2QRD B;  4A93 I;  1VQM 1;  3J81 b;  1KRL A;  2OZK A;  1VQ9 Z;  3TDH B;  1YIT 1;  3CCQ Z;  1VQ8 Z;  1VQP 1;  3CC2 1;  2NVX I;  2R92 I;  1ZH1 A;  2RT9 A;  3CMA Z;  3U50 C;  4BY7 I;  2HU9 A;  2P3Y A;  1TFI A;  2NVT I;  3CME 1;  3K7A I;  1K9M 2;  1RQF A;  1LQL A;  1VQ9 1;  3CPW Z;  3CCQ 1;  1TWH I;  1N8R 2;  3M3Y I;  2ZAE B;  1NUI A;  2Q51 A;  4NH1 C;  3G4S Z;  2YAD A;  3NFZ A;  4HGY A;  3CCR Z;  1TWC I;  1NP6 A;  1KQS Y;  1USP A;  1SFO I;  2QEX Z;  1VQ5 1;  3EED A;  3S1N I;  4NBA A;  1M90 2;  2IZ3 A;  4RV9 A;  1K73 2;  4X6A I;  3HKZ A;  1YUA A;  3BG0 B;  3J81 f;  3CXC Y;  1ZB8 A;  3G4S 1;  4HH4 A;  1R9T I;  2NVY I;  1YJW Z;  4S1T A;  3NDJ A;  1DL6 A;  3VMI A;  1TWA I;  1KC8 2;  3Q87 A;  3FQQ A;  3NH4 A;  4MON A;  3I4M I;  3CCE Z;  4E2Y A;  3D9X A;  2KPI A;  5C3E I;  2NVQ I;  2VUM I;  1K9M 1;  3HOY I;  2AKL A;  2Q4Z A;  4RVH A;  4E32 A;  1N8R 1;  3CCL Z;  4NBG A;  5D1O B;  4NBC A;  5FLM I;  1VQ4 1;  3CD6 Z;  3CCE 1;  4BXX I;  3H3V J;  1VQ6 Z;  1I50 I;  1K73 1;  4NBD A;  2F4O A;  1TWG I;  5AN9 F;  2R6M A;  2V8I A;  3F3P C;  5IT9 f;  3VTN A;  1VQM Z;  5T6B A;  3HOZ I;  1JJ2 Y;  1QVF Z;  3MZK B;  5FLX b;  2R93 I;  3GTK I;  3CCJ 1;  4RVD A;  1VQL Z;  3RZO I;  3HOX I;  1YJN 1;  3CD6 1;  3PO2 I;  5IP9 I;  3OW2 Z;  2E2J I;  1RO4 A;  4E2X A;  1TWF I;  2J6A A;  2QRC B;  1KC8 1;  3KIF A;  3CC4 Z;  5D1O A;  3CME Z;  2DE5 A;  5C4X I;  1USP B;  2E9H A;  4NBB A;  5T64 A;  2LIY A;  2QKD A;  3CCU Z;  1KD1 2;  3S17 I;  2OTJ 1;  1VQL 1;  2E2H I;  1I6H I;  3GTP I;  4RVF A;  2Y0S A;  3GTL I;  3PO3 I;  2K3R A;  2PM9 A;  1Q81 1;  3NDI A;  2GTI A;  3J80 b;  3CC4 1;  4E2W A;  3CPW Y;  2OTL Z;  1VQ5 Z;  3I55 Z;  4NB8 A;  1ML8 A;  2YU9 I;  1JWH C;  4A3J I;  2WAQ A;  2DE7 A;  4NFR A;  3CCU 1;  1N2F A;  1WII A;  1K8A 2;  2IZ4 A;  4XX2 A;  1Z02 A;  3D6W A;  4NBE A;  4Y52 I;  5FLX f;  2RIQ A;  3ESW A;  3CCV Z;  3HOV I;  2W03 A;  3CC7 1;  1QYP A;  2OTL 1;  1WW9 A;  4NBH A;  3I55 1;  1RO0 A;  3M4O I;  5D1P A;  5IP7 I;  2PK7 A;  2RBL A;  3S15 I;  3T4N B;  1X3Z A;  5IT9 b;  4TNU A;  3P5J B;  3S1Q I;  4E2Z A;  1QVG Z;  1KD1 1;  3CCV 1;  2VF1 A;  3PO3 S;  3S2D I;  1Q7Y 2;  5T67 A;  3J80 f;  1VQ4 Z;  3S14 I;  3S16 I;  1I3Q I;  4A3K I;  2O53 A;  1RNI A;  2JA5 I;  4CL1 A;  2LFU A;  3CCS Z;  3J7A 4;  1YI2 1;  3S1R I;  1Z01 A;  2GTH A;  1YJ9 Z;  3CCJ Z;  3GCF A;  2M6N A;  1YJN Z;  3VMG A;  3BG1 B;  2OOX B;  1M90 1;  1QVF Y;  3CCS 1;  2K5R A;  1Q86 2;  4BY1 I;  1QF8 A;  4NOZ A;  1PFT A;  4RVG A;  3I56 1;  2B63 I;  3CQZ I;  3OW2 Y;  2JNY A;  5C4J I;  3G6E 1;  1L1O C;  4A3E I;  2OTJ Z;  1YJ9 1;  1Q7Y 1;  4Y7N I;  1W2B Z;  4A3F I;  2JUB A;  4EWC A;  4A3D I;  1Y1W I;  4MD8 A;  4RS4 A;  3G71 1;  3I4N I;  1ZB9 A;  1VQN Z;  3CC7 Z;  1Y1V I;  1WCM I;  1P9N A;  1K83 I;  3I07 A;  2JR6 A;  1VQK Z;  1X3W A;  1S72 1;  3VMH A;  1Q86 1;  4E30 A;  2P28 A;  1VQO 1;  1YHQ 1;  2JS4 A;  3F3F C;  3QWU A;  4E31 A;  4NB9 A;  2DE6 A;  1VQN 1;  5A2Q b;  3GTQ I;  1VQK 1;  2PMZ A;  1QVG Y;  2JA6 I;  4AYB A;  3HOW I;  2RPR A;  1VQ8 1;  1RO2 A;  3GTO I;  2QR1 B;  2H85 A;  1NJI 2;  3CMA 1;  3LUS A;  1M1K 2;  1YI2 Z;  2I3C A;  3GTG I;  2F4M A;  4MH4 A;  2KI7 B;  1X0T A;  2V8K A;  3JAM b;  3IX0 A;  1Y1V S;  4QTT A;  2EGT A;  1KQS Z;  3GKQ A;  4BBR I;  3S1M I;  2JMO A;  2E2I I;  3IF8 A;  4BBS I;  4MD9 A;  3CCR 1;  2QLV B;  3CXC Z;  1VQ7 Z;  2QEX 1;  3FKI I;  3I56 Z;  1K8A 1;  4MXU A;  2R7Z I;  2QA4 Z;  3G6E Z;  1S7M A;  3GTM I;  4A3B I;  1Q82 2;  3IFU A;  2V8J A;  5A2Q f;  3CCM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...