1YJ91

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yj9100
3CC41 3CCV1 3CCMZ 1VQ8Z 1YIT1 1N8R1 2QEXZ 1Q822 1VQN1 2OTJ1 1Q812 1Q862 3CCU1 3CCS1 2OTLZ 3CD6Z 3CCSZ 1VQL1 2QEX1 1JJ2Y 1KQSZ 3CCRZ 1VQPZ 1M901 3I551 1QVGZ 3CCVZ 3CC4Z 1KC82 3I561 1K9M2 3G6E1 3I55Z 1Q821 1VQP1 1YJ91 3CCR1 3G711 1KQSY 1M902 1Q7Y2 1VQKZ 1VQLZ 1K9M1 1VQ9Z 3CCQZ 2OTL1 3CD61 3CXCY 1QVGY 1VQ41 3CCJZ 3CCE1 3CC21 1VQNZ 1YJW1 1YITZ 1NJI1 1KC81 1JJ2Z 1YI2Z 1VQO1 3G4SZ 1QVFY 1S721 3CMAZ 3OW2Z 1W2BZ 1YJNZ 1Q7Y1 1VQ51 1NJI2 3CC71 3CCL1 1VQMZ 1VQM1 3CPWZ 1QVFZ 3CMEZ 1VQ61 1S72Z 1YHQZ 1K8A2 1VQ6Z 1YIJZ 1YHQ1 2QA4Z 1VQ71 3OW2Y 1W2BY 1KD11 3CCQ1 1K732 1M1K1 1YJN1 1K8A1 3CMA1 1YJ9Z 2QA41 1VQ7Z 3CC7Z 1YIJ1 3G6EZ 3CXCZ 1YJWZ 1VQOZ 1YI21 3CCEZ 3CCJ1 1KD12 3CME1 3CC2Z 1K731 1VQ91 1M1K2 1VQ4Z 3CCUZ 1Q861 2OTJZ 3CCLZ 3G71Z 1VQK1 1N8R2 3CCM1 1VQ5Z 1VQ81 1Q811 3CPWY 3G4S1 3I56Z
chains in the Genus database with same CATH superfamily
3CCV1 5C3EI 3CCMZ 3I4NI 2BJOA 1Q822 3J7A4 1Q862 1KRLA 4BY1I 2OTLZ 3CCSZ 2QEX1 1JJ2Y 1ZH1A 2RT9A 1VQPZ 3I551 3BG1B 1QVGZ 3I561 1K9M2 3I55Z 1VQP1 5C4XI 1KQSY 3G711 3D2LA 1M902 3HKZA 3MONA 1SFOI 2OTL1 1Z02A 2RIQA 1YJW1 2E2JI 1KC81 2HU9A 1VQO1 4MONA 1S721 3CMAZ 1VQ51 4QTUA 5C4JI 1S7MA 1YUAA 3GCFA 2DE7A 2W03A 2E2HI 2OOYB 3CPWZ 2V8IA 5FLMI 1S72Z 2DE6A 2F4OA 1JWHC 1N2FA 2EGTA 4RV9A 1YIJZ 4A3JI 4A3II 2O4HA 1WZNA 3HOUI 2HF1A 2QRDB 4NBFA 2QR1B 3P5JB 3OW2Y 1W2BY 3GKQA 1KD11 2P3YA 1YJN1 3VB9A 2QA41 1VQ7Z 3S16I 2PMZA 3I07A 3D9XA 2JA8I 3CXCZ 4HH4A 3KIHA 2R6MA 3GTPI 3Q87A 1YI21 3CCEZ 2V3VA 1KD12 4BY7I 3EEDA 2K5RA 3MZLB 4MD7A 1AA6A 1FDOA 5D1OA 1VQK1 2LEXA 3CCM1 3CC41 1NUIA 3VMIA 3IR7A 1YIT1 1N8R1 4A3LI 3S17I 2WB1A 1FDIA 1Q812 1PFTA 3CCU1 1I6HI 2J6AA 2JUBA 5D1PA 1VQL1 1KQSZ 3IF8A 4NB9A 2H85A 4DK1A 4QTTA 2ZAEB 3HOYI 3CC4Z 2RPRA 3G6E1 4A3CI 4NBEA 1YJ91 3CCR1 4NBDA 5A2Qf 5CM2M 1DL6A 1Q7Y2 1VQKZ 1WW9A 3CCQZ 1VQ9Z 2GU2A 3CD61 3PO3S 2V8KA 3NFZA 1RNIA 4MD9A 4DGLA 1VQNZ 2PK7A 3S15I 1X3ZA 1YI2Z 2GTIA 3PO2I 4MH4A 1NJI2 3TE5B 2VUMI 4BBSI 1TWFI 4DQYB 5FLXb 1TWAI 2JIQA 1TWGI 1SIWA 3CMEZ 1Z03A 1VQ61 2GTHA 4NBCA 1K8A2 2RBLA 1ZB8A 1VQ6Z 3U50C 1K83I 3KIFA 4RVHA 3H3VJ 2JA5I 1L1OC 3GTQI 3IFUA 3GTOI 1RO2A 1K732 3NH8A 1M1K1 2KI7B 4E2YA 1RO4A 3NH4A 4E2ZA 4EWCA 1Y1VS 3HOXI 4XX2A 3J81b 1VQOZ 3K7AI 2QLVB 3VTNA 2JA6I 3S2DI 2K3RA 2LIYA 1K731 1VQ91 2VF1A 1I3QI 2OTJZ 3CCLZ 1Y8CA 2W04A 3GTMS 1RLYA 1QYPA 3GTKI 4A3DI 2VPZA 1VQ81 3CQZI 2IV2X 4CL1A 3CPWY 3G4S1 3I56Z 2IZ4A 2QKDA 1WIIA 1Z01A 4A3GI 2R93I 2KPIA 3CCS1 2NVXI 3IX0A 3I4MI 2NVYI 2I3CA 2QRCB 2YU9I 3NDJA 1ML8A 3CCVZ 3GTLI 1KC82 2R92I 1Q821 4Y52I 3ESWA 1Y1WI 3VMGA 3F3FC 4S1TA 3M4OI 3LUSA 3CXCY 1LQLA 1TWCI 3M3YI 1VQ41 4HGZA 3CCE1 2E2II 3CC21 2M6NA 1NJI1 3QWUA 3G4SZ 4MXUA 1QVFY 4A3EI 3J80b 2DE5A 3NH5A 1YJNZ 2B63I 3CCL1 1VQMZ 5T67A 2M48A 4A3MI 4E32A 1VQM1 1QXFA 4NBGA 2JR6A 4E31A 1YUKA 1I50I 2RHBA 4AYBA 1WCMI 2E7ZA 1YHQ1 3J81f 2F4MA 1QF8A 1RQFA 2VPXA 4BBRI 4TNUA 5T64A 4A3BI 1RO0A 4HGYA 3CMA1 2Y0SA 3CC7Z 3S14I 4A3FI 2NVTI 1USPB 4Y7NI 3RZDI 1YJWZ 2E9HA 4E30A 2P28A 4BXXI 3CME1 3D6WA 2JIRA 5A2Qb 3G71Z 2AKLA 4NBAA 5AN9F 4NB8A 1NP6A 2VPYA 5T6BA 3GTJI 3S1QI 1VQ8Z 2QEXZ 1VQN1 3FQMA 2OTJ1 1Q16A 3JAMf 5IP7I 1R9TI 1VLAA 5D1OB 3CD6Z 4RVGA 2VPWA 1ZB9A 3CCRZ 3JAMb 4NBHA 1M901 3GTMI 4NH1C 4X6AI 4RVFA 2IZ3A 4NBBA 1VQLZ 1K9M1 1X3WA 1QVGY 3CCJZ 2OOXB 5IP9I 5IT9b 1YITZ 3EERA 3GTGI 2YADA 1JJ2Z 2O53A 3HOVI 1USPA 4E33A 4MD8A 2G2KA 3OW2Z 1W2BZ 1Q7Y1 2Q51A 2AYDA 3J80f 3CC71 1X0TA 1Y1VI 3F3PC 4A3KI 3H0GI 3S1RI 3FQQA 3S1NI 1QVFZ 3BG0B 2NAPA 2JMOA 3HOZI 5FLXf 1YHQZ 5C44I 3NDIA 2QREB 3PO3I 2WAQA 2JNYA 5IT9f 3FKII 4E2WA 2JS4A 2QA4Z 2VUGA 1VQ71 3RZOI 1TWHI 4MRIA 3CCQ1 2JIPA 2PM9A 2JIOA 2Q4ZA 1K8A1 1YJ9Z 4RVDA 3TDHB 1YIJ1 3G6EZ 3S1MI 4E2XA 2OZKA 4A93I 1WJ2A 1TFIA 5LL6f 3CCJ1 2JA7I 2V8JA 3CC2Z 3HOWI 2JIMA 1M1K2 3CCUZ 1VQ4Z 1Q861 3MZKB 4NFRA 1P9NA 4NOZA 3S2HI 2LFUA 1N8R2 3VMHA 1VQ5Z 2R7ZI 2V45A 2NVQI 4RS4A 1Q811 3T4NB
chains in the Genus database with same CATH topology
3CCV1 5C3EI 3CCMZ 3I4NI 2BJOA 1Q822 3J7A4 1Q862 1KRLA 4BY1I 2OTLZ 3CCSZ 2QEX1 1JJ2Y 1ZH1A 2RT9A 1VQPZ 3I551 3BG1B 1QVGZ 3I561 1K9M2 3I55Z 1VQP1 5C4XI 1KQSY 3G711 1M902 3HKZA 3MONA 1SFOI 2OTL1 1Z02A 2RIQA 1YJW1 2E2JI 1KC81 2HU9A 1VQO1 4MONA 1S721 3CMAZ 1VQ51 4QTUA 5C4JI 1S7MA 1YUAA 3GCFA 2DE7A 2W03A 2E2HI 2OOYB 3CPWZ 2V8IA 5FLMI 1S72Z 2DE6A 2F4OA 1JWHC 1N2FA 2EGTA 4RV9A 1YIJZ 4A3JI 4A3II 2O4HA 3HOUI 2HF1A 2QRDB 4NBFA 2QR1B 3P5JB 3OW2Y 1W2BY 3GKQA 1KD11 2P3YA 1YJN1 3VB9A 2QA41 1VQ7Z 3S16I 2PMZA 3I07A 3D9XA 2JA8I 3CXCZ 4HH4A 3KIHA 2R6MA 3GTPI 3Q87A 1YI21 3CCEZ 1KD12 4BY7I 3EEDA 2K5RA 3MZLB 4MD7A 5D1OA 1VQK1 3CCM1 3CC41 1NUIA 3VMIA 1YIT1 1N8R1 4A3LI 3S17I 2WB1A 1Q812 1PFTA 3CCU1 1I6HI 2J6AA 2JUBA 5D1PA 1VQL1 1KQSZ 3IF8A 4NB9A 2H85A 4DK1A 4QTTA 2ZAEB 3HOYI 3CC4Z 2RPRA 3G6E1 4A3CI 4NBEA 1YJ91 3CCR1 4NBDA 5A2Qf 5CM2M 1DL6A 1Q7Y2 1VQKZ 1WW9A 3CCQZ 1VQ9Z 2GU2A 3CD61 3PO3S 2V8KA 3NFZA 1RNIA 4MD9A 4DGLA 1VQNZ 2PK7A 3S15I 1X3ZA 1YI2Z 2GTIA 3PO2I 4MH4A 1NJI2 3TE5B 2VUMI 4BBSI 1TWFI 4DQYB 5FLXb 1TWAI 1TWGI 3CMEZ 1Z03A 1VQ61 2GTHA 4NBCA 1K8A2 2RBLA 1ZB8A 1VQ6Z 3U50C 1K83I 3KIFA 4RVHA 3H3VJ 2JA5I 1L1OC 3GTQI 3IFUA 3GTOI 1RO2A 1K732 3NH8A 1M1K1 2KI7B 4E2YA 1RO4A 3NH4A 4E2ZA 4EWCA 1Y1VS 3HOXI 4XX2A 3J81b 1VQOZ 3K7AI 2QLVB 3VTNA 2JA6I 3S2DI 2K3RA 2LIYA 1K731 1VQ91 2VF1A 1I3QI 2OTJZ 3CCLZ 2W04A 3GTMS 1RLYA 1QYPA 3GTKI 4A3DI 1VQ81 3CQZI 4CL1A 3CPWY 3G4S1 3I56Z 2IZ4A 2QKDA 1WIIA 1Z01A 4A3GI 2R93I 2KPIA 3CCS1 2NVXI 3IX0A 3I4MI 2NVYI 2I3CA 2QRCB 2YU9I 3NDJA 1ML8A 3CCVZ 3GTLI 1KC82 2R92I 1Q821 4Y52I 3ESWA 1Y1WI 3VMGA 3F3FC 4S1TA 3M4OI 3LUSA 3CXCY 1LQLA 1TWCI 3M3YI 1VQ41 4HGZA 3CCE1 2E2II 3CC21 2M6NA 1NJI1 3QWUA 3G4SZ 4MXUA 1QVFY 4A3EI 3J80b 2DE5A 3NH5A 1YJNZ 2B63I 3CCL1 1VQMZ 5T67A 2M48A 4A3MI 4E32A 1VQM1 4NBGA 2JR6A 4E31A 1YUKA 1I50I 2RHBA 4AYBA 1WCMI 3J81f 1YHQ1 2F4MA 1QF8A 1RQFA 4BBRI 4TNUA 5T64A 4A3BI 1RO0A 4HGYA 3CMA1 2Y0SA 3CC7Z 3S14I 4A3FI 2NVTI 1USPB 4Y7NI 3RZDI 1YJWZ 2E9HA 4E30A 2P28A 4BXXI 3CME1 3D6WA 5A2Qb 3G71Z 2AKLA 4NBAA 5AN9F 4NB8A 1NP6A 5T6BA 3GTJI 3S1QI 1VQ8Z 2QEXZ 1VQN1 3FQMA 2OTJ1 3JAMf 5IP7I 1R9TI 1VLAA 5D1OB 3CD6Z 4RVGA 1ZB9A 3CCRZ 3JAMb 4NBHA 1M901 3GTMI 4NH1C 4X6AI 4RVFA 2IZ3A 4NBBA 1VQLZ 1K9M1 1X3WA 1QVGY 3CCJZ 2OOXB 5IP9I 5IT9b 1YITZ 3EERA 3GTGI 2YADA 1JJ2Z 2O53A 3HOVI 1USPA 4E33A 4MD8A 2G2KA 3OW2Z 1W2BZ 1Q7Y1 2Q51A 3J80f 3CC71 1X0TA 1Y1VI 3F3PC 4A3KI 3H0GI 3S1RI 3FQQA 3S1NI 1QVFZ 3BG0B 2JMOA 3HOZI 5FLXf 1YHQZ 5C44I 3NDIA 2QREB 3PO3I 2WAQA 2JNYA 5IT9f 3FKII 4E2WA 2JS4A 2VUGA 2QA4Z 1VQ71 3RZOI 1TWHI 4MRIA 3CCQ1 2PM9A 2Q4ZA 1K8A1 1YJ9Z 4RVDA 3TDHB 1YIJ1 3G6EZ 3S1MI 4E2XA 2OZKA 4A93I 1TFIA 5LL6f 3CCJ1 2JA7I 2V8JA 3CC2Z 3HOWI 1M1K2 1VQ4Z 3CCUZ 1Q861 3MZKB 4NFRA 1P9NA 4NOZA 3S2HI 2LFUA 1N8R2 3VMHA 1VQ5Z 2R7ZI 2NVQI 4RS4A 1Q811 3T4NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 1;  3CCV 1;  3CCM Z;  1VQ8 Z;  1YIT 1;  1N8R 1;  2QEX Z;  1Q82 2;  1VQN 1;  2OTJ 1;  1Q81 2;  1Q86 2;  3CCU 1;  3CCS 1;  2OTL Z;  3CD6 Z;  3CCS Z;  1VQL 1;  2QEX 1;  1JJ2 Y;  1KQS Z;  3CCR Z;  1VQP Z;  1M90 1;  3I55 1;  1QVG Z;  3CCV Z;  3CC4 Z;  1KC8 2;  3I56 1;  1K9M 2;  3G6E 1;  3I55 Z;  1Q82 1;  1VQP 1;  1YJ9 1;  3CCR 1;  3G71 1;  1KQS Y;  1M90 2;  1Q7Y 2;  1VQK Z;  1VQL Z;  1K9M 1;  1VQ9 Z;  3CCQ Z;  2OTL 1;  3CD6 1;  3CXC Y;  1QVG Y;  1VQ4 1;  3CCJ Z;  3CCE 1;  3CC2 1;  1VQN Z;  1YJW 1;  1YIT Z;  1NJI 1;  1KC8 1;  1JJ2 Z;  1YI2 Z;  1VQO 1;  3G4S Z;  1QVF Y;  1S72 1;  3CMA Z;  3OW2 Z;  1W2B Z;  1YJN Z;  1Q7Y 1;  1VQ5 1;  1NJI 2;  3CC7 1;  3CCL 1;  1VQM Z;  1VQM 1;  3CPW Z;  1QVF Z;  3CME Z;  1VQ6 1;  1S72 Z;  1YHQ Z;  1K8A 2;  1VQ6 Z;  1YIJ Z;  1YHQ 1;  2QA4 Z;  1VQ7 1;  3OW2 Y;  1W2B Y;  1KD1 1;  3CCQ 1;  1K73 2;  1M1K 1;  1YJN 1;  1K8A 1;  3CMA 1;  1YJ9 Z;  2QA4 1;  1VQ7 Z;  3CC7 Z;  1YIJ 1;  3G6E Z;  3CXC Z;  1YJW Z;  1VQO Z;  1YI2 1;  3CCE Z;  3CCJ 1;  1KD1 2;  3CME 1;  3CC2 Z;  1K73 1;  1VQ9 1;  1M1K 2;  1VQ4 Z;  3CCU Z;  1Q86 1;  2OTJ Z;  3CCL Z;  3G71 Z;  1VQK 1;  1N8R 2;  3CCM 1;  1VQ5 Z;  1VQ8 1;  1Q81 1;  3CPW Y;  3G4S 1;  3I56 Z; 
#chains in the Genus database with same CATH topology
 3CCV 1;  5C3E I;  3CCM Z;  3I4N I;  2BJO A;  1Q82 2;  3J7A 4;  1Q86 2;  1KRL A;  4BY1 I;  2OTL Z;  3CCS Z;  2QEX 1;  1JJ2 Y;  1ZH1 A;  2RT9 A;  1VQP Z;  3I55 1;  3BG1 B;  1QVG Z;  3I56 1;  1K9M 2;  3I55 Z;  1VQP 1;  5C4X I;  1KQS Y;  3G71 1;  3D2L A;  1M90 2;  3HKZ A;  3MON A;  1SFO I;  2OTL 1;  1Z02 A;  2RIQ A;  1YJW 1;  2E2J I;  1KC8 1;  2HU9 A;  1VQO 1;  4MON A;  1S72 1;  3CMA Z;  1VQ5 1;  4QTU A;  5C4J I;  1S7M A;  1YUA A;  3GCF A;  2DE7 A;  2W03 A;  2E2H I;  2OOY B;  3CPW Z;  2V8I A;  5FLM I;  1S72 Z;  2DE6 A;  2F4O A;  1JWH C;  1N2F A;  2EGT A;  4RV9 A;  1YIJ Z;  4A3J I;  4A3I I;  2O4H A;  1WZN A;  3HOU I;  2HF1 A;  2QRD B;  4NBF A;  2QR1 B;  3P5J B;  3OW2 Y;  1W2B Y;  3GKQ A;  1KD1 1;  2P3Y A;  1YJN 1;  3VB9 A;  2QA4 1;  1VQ7 Z;  3S16 I;  2PMZ A;  3I07 A;  3D9X A;  2JA8 I;  3CXC Z;  4HH4 A;  3KIH A;  2R6M A;  3GTP I;  3Q87 A;  1YI2 1;  3CCE Z;  2V3V A;  1KD1 2;  4BY7 I;  3EED A;  2K5R A;  3MZL B;  4MD7 A;  1AA6 A;  1FDO A;  5D1O A;  1VQK 1;  2LEX A;  3CCM 1;  3CC4 1;  1NUI A;  3VMI A;  3IR7 A;  1YIT 1;  1N8R 1;  4A3L I;  3S17 I;  2WB1 A;  1FDI A;  1Q81 2;  1PFT A;  3CCU 1;  1I6H I;  2J6A A;  2JUB A;  5D1P A;  1VQL 1;  1KQS Z;  3IF8 A;  4NB9 A;  2H85 A;  4DK1 A;  4QTT A;  2ZAE B;  3HOY I;  3CC4 Z;  2RPR A;  3G6E 1;  4A3C I;  4NBE A;  1YJ9 1;  3CCR 1;  4NBD A;  5A2Q f;  5CM2 M;  1DL6 A;  1Q7Y 2;  1VQK Z;  1WW9 A;  3CCQ Z;  1VQ9 Z;  2GU2 A;  3CD6 1;  3PO3 S;  2V8K A;  3NFZ A;  1RNI A;  4MD9 A;  4DGL A;  1VQN Z;  2PK7 A;  3S15 I;  1X3Z A;  1YI2 Z;  2GTI A;  3PO2 I;  4MH4 A;  1NJI 2;  3TE5 B;  2VUM I;  4BBS I;  1TWF I;  4DQY B;  5FLX b;  1TWA I;  2JIQ A;  1TWG I;  1SIW A;  3CME Z;  1Z03 A;  1VQ6 1;  2GTH A;  4NBC A;  1K8A 2;  2RBL A;  1ZB8 A;  1VQ6 Z;  3U50 C;  1K83 I;  3KIF A;  4RVH A;  3H3V J;  2JA5 I;  1L1O C;  3GTQ I;  3IFU A;  3GTO I;  1RO2 A;  1K73 2;  3NH8 A;  1M1K 1;  2KI7 B;  4E2Y A;  1RO4 A;  3NH4 A;  4E2Z A;  4EWC A;  1Y1V S;  3HOX I;  4XX2 A;  3J81 b;  1VQO Z;  3K7A I;  2QLV B;  3VTN A;  2JA6 I;  3S2D I;  2K3R A;  2LIY A;  1K73 1;  1VQ9 1;  2VF1 A;  1I3Q I;  2OTJ Z;  3CCL Z;  1Y8C A;  2W04 A;  3GTM S;  1RLY A;  1QYP A;  3GTK I;  4A3D I;  2VPZ A;  1VQ8 1;  3CQZ I;  2IV2 X;  4CL1 A;  3CPW Y;  3G4S 1;  3I56 Z;  2IZ4 A;  2QKD A;  1WII A;  1Z01 A;  4A3G I;  2R93 I;  2KPI A;  3CCS 1;  2NVX I;  3IX0 A;  3I4M I;  2NVY I;  2I3C A;  2QRC B;  2YU9 I;  3NDJ A;  1ML8 A;  3CCV Z;  3GTL I;  1KC8 2;  2R92 I;  1Q82 1;  4Y52 I;  3ESW A;  1Y1W I;  3VMG A;  3F3F C;  4S1T A;  3M4O I;  3LUS A;  3CXC Y;  1LQL A;  1TWC I;  3M3Y I;  1VQ4 1;  4HGZ A;  3CCE 1;  2E2I I;  3CC2 1;  2M6N A;  1NJI 1;  3QWU A;  3G4S Z;  4MXU A;  1QVF Y;  4A3E I;  3J80 b;  2DE5 A;  3NH5 A;  1YJN Z;  2B63 I;  3CCL 1;  1VQM Z;  5T67 A;  2M48 A;  4A3M I;  4E32 A;  1VQM 1;  1QXF A;  4NBG A;  2JR6 A;  4E31 A;  1YUK A;  1I50 I;  2RHB A;  4AYB A;  1WCM I;  2E7Z A;  1YHQ 1;  3J81 f;  2F4M A;  1QF8 A;  1RQF A;  2VPX A;  4BBR I;  4TNU A;  5T64 A;  4A3B I;  1RO0 A;  4HGY A;  3CMA 1;  2Y0S A;  3CC7 Z;  3S14 I;  4A3F I;  2NVT I;  1USP B;  4Y7N I;  3RZD I;  1YJW Z;  2E9H A;  4E30 A;  2P28 A;  4BXX I;  3CME 1;  3D6W A;  2JIR A;  5A2Q b;  3G71 Z;  2AKL A;  4NBA A;  5AN9 F;  4NB8 A;  1NP6 A;  2VPY A;  5T6B A;  3GTJ I;  3S1Q I;  1VQ8 Z;  2QEX Z;  1VQN 1;  3FQM A;  2OTJ 1;  1Q16 A;  3JAM f;  5IP7 I;  1R9T I;  1VLA A;  5D1O B;  3CD6 Z;  4RVG A;  2VPW A;  1ZB9 A;  3CCR Z;  3JAM b;  4NBH A;  1M90 1;  3GTM I;  4NH1 C;  4X6A I;  4RVF A;  2IZ3 A;  4NBB A;  1VQL Z;  1K9M 1;  1X3W A;  1QVG Y;  3CCJ Z;  2OOX B;  5IP9 I;  5IT9 b;  1YIT Z;  3EER A;  3GTG I;  2YAD A;  1JJ2 Z;  2O53 A;  3HOV I;  1USP A;  4E33 A;  4MD8 A;  2G2K A;  3OW2 Z;  1W2B Z;  1Q7Y 1;  2Q51 A;  2AYD A;  3J80 f;  3CC7 1;  1X0T A;  1Y1V I;  3F3P C;  4A3K I;  3H0G I;  3S1R I;  3FQQ A;  3S1N I;  1QVF Z;  3BG0 B;  2NAP A;  2JMO A;  3HOZ I;  5FLX f;  1YHQ Z;  5C44 I;  3NDI A;  2QRE B;  3PO3 I;  2WAQ A;  2JNY A;  5IT9 f;  3FKI I;  4E2W A;  2JS4 A;  2QA4 Z;  2VUG A;  1VQ7 1;  3RZO I;  1TWH I;  4MRI A;  3CCQ 1;  2JIP A;  2PM9 A;  2JIO A;  2Q4Z A;  1K8A 1;  1YJ9 Z;  4RVD A;  3TDH B;  1YIJ 1;  3G6E Z;  3S1M I;  4E2X A;  2OZK A;  4A93 I;  1WJ2 A;  1TFI A;  5LL6 f;  3CCJ 1;  2JA7 I;  2V8J A;  3CC2 Z;  3HOW I;  2JIM A;  1M1K 2;  3CCU Z;  1VQ4 Z;  1Q86 1;  3MZK B;  4NFR A;  1P9N A;  4NOZ A;  3S2H I;  2LFU A;  1N8R 2;  3VMH A;  1VQ5 Z;  2R7Z I;  2V45 A;  2NVQ I;  4RS4 A;  1Q81 1;  3T4N B; 
#chains in the Genus database with same CATH homology
 3CCV 1;  5C3E I;  3CCM Z;  3I4N I;  2BJO A;  1Q82 2;  3J7A 4;  1Q86 2;  1KRL A;  4BY1 I;  2OTL Z;  3CCS Z;  2QEX 1;  1JJ2 Y;  1ZH1 A;  2RT9 A;  1VQP Z;  3I55 1;  3BG1 B;  1QVG Z;  3I56 1;  1K9M 2;  3I55 Z;  1VQP 1;  5C4X I;  1KQS Y;  3G71 1;  1M90 2;  3HKZ A;  3MON A;  1SFO I;  2OTL 1;  1Z02 A;  2RIQ A;  1YJW 1;  2E2J I;  1KC8 1;  2HU9 A;  1VQO 1;  4MON A;  1S72 1;  3CMA Z;  1VQ5 1;  4QTU A;  5C4J I;  1S7M A;  1YUA A;  3GCF A;  2DE7 A;  2W03 A;  2E2H I;  2OOY B;  3CPW Z;  2V8I A;  5FLM I;  1S72 Z;  2DE6 A;  2F4O A;  1JWH C;  1N2F A;  2EGT A;  4RV9 A;  1YIJ Z;  4A3J I;  4A3I I;  2O4H A;  3HOU I;  2HF1 A;  2QRD B;  4NBF A;  2QR1 B;  3P5J B;  3OW2 Y;  1W2B Y;  3GKQ A;  1KD1 1;  2P3Y A;  1YJN 1;  3VB9 A;  2QA4 1;  1VQ7 Z;  3S16 I;  2PMZ A;  3I07 A;  3D9X A;  2JA8 I;  3CXC Z;  4HH4 A;  3KIH A;  2R6M A;  3GTP I;  3Q87 A;  1YI2 1;  3CCE Z;  1KD1 2;  4BY7 I;  3EED A;  2K5R A;  3MZL B;  4MD7 A;  5D1O A;  1VQK 1;  3CCM 1;  3CC4 1;  1NUI A;  3VMI A;  1YIT 1;  1N8R 1;  4A3L I;  3S17 I;  2WB1 A;  1Q81 2;  1PFT A;  3CCU 1;  1I6H I;  2J6A A;  2JUB A;  5D1P A;  1VQL 1;  1KQS Z;  3IF8 A;  4NB9 A;  2H85 A;  4DK1 A;  4QTT A;  2ZAE B;  3HOY I;  3CC4 Z;  2RPR A;  3G6E 1;  4A3C I;  4NBE A;  1YJ9 1;  3CCR 1;  4NBD A;  5A2Q f;  5CM2 M;  1DL6 A;  1Q7Y 2;  1VQK Z;  1WW9 A;  3CCQ Z;  1VQ9 Z;  2GU2 A;  3CD6 1;  3PO3 S;  2V8K A;  3NFZ A;  1RNI A;  4MD9 A;  4DGL A;  1VQN Z;  2PK7 A;  3S15 I;  1X3Z A;  1YI2 Z;  2GTI A;  3PO2 I;  4MH4 A;  1NJI 2;  3TE5 B;  2VUM I;  4BBS I;  1TWF I;  4DQY B;  5FLX b;  1TWA I;  1TWG I;  3CME Z;  1Z03 A;  1VQ6 1;  2GTH A;  4NBC A;  1K8A 2;  2RBL A;  1ZB8 A;  1VQ6 Z;  3U50 C;  1K83 I;  3KIF A;  4RVH A;  3H3V J;  2JA5 I;  1L1O C;  3GTQ I;  3IFU A;  3GTO I;  1RO2 A;  1K73 2;  3NH8 A;  1M1K 1;  2KI7 B;  4E2Y A;  1RO4 A;  3NH4 A;  4E2Z A;  4EWC A;  1Y1V S;  3HOX I;  4XX2 A;  3J81 b;  1VQO Z;  3K7A I;  2QLV B;  3VTN A;  2JA6 I;  3S2D I;  2K3R A;  2LIY A;  1K73 1;  1VQ9 1;  2VF1 A;  1I3Q I;  2OTJ Z;  3CCL Z;  2W04 A;  3GTM S;  1RLY A;  1QYP A;  3GTK I;  4A3D I;  1VQ8 1;  3CQZ I;  4CL1 A;  3CPW Y;  3G4S 1;  3I56 Z;  2IZ4 A;  2QKD A;  1WII A;  1Z01 A;  4A3G I;  2R93 I;  2KPI A;  3CCS 1;  2NVX I;  3IX0 A;  3I4M I;  2NVY I;  2I3C A;  2QRC B;  2YU9 I;  3NDJ A;  1ML8 A;  3CCV Z;  3GTL I;  1KC8 2;  2R92 I;  1Q82 1;  4Y52 I;  3ESW A;  1Y1W I;  3VMG A;  3F3F C;  4S1T A;  3M4O I;  3LUS A;  3CXC Y;  1LQL A;  1TWC I;  3M3Y I;  1VQ4 1;  4HGZ A;  3CCE 1;  2E2I I;  3CC2 1;  2M6N A;  1NJI 1;  3QWU A;  3G4S Z;  4MXU A;  1QVF Y;  4A3E I;  3J80 b;  2DE5 A;  3NH5 A;  1YJN Z;  2B63 I;  3CCL 1;  1VQM Z;  5T67 A;  2M48 A;  4A3M I;  4E32 A;  1VQM 1;  4NBG A;  2JR6 A;  4E31 A;  1YUK A;  1I50 I;  2RHB A;  4AYB A;  1WCM I;  3J81 f;  1YHQ 1;  2F4M A;  1QF8 A;  1RQF A;  4BBR I;  4TNU A;  5T64 A;  4A3B I;  1RO0 A;  4HGY A;  3CMA 1;  2Y0S A;  3CC7 Z;  3S14 I;  4A3F I;  2NVT I;  1USP B;  4Y7N I;  3RZD I;  1YJW Z;  2E9H A;  4E30 A;  2P28 A;  4BXX I;  3CME 1;  3D6W A;  5A2Q b;  3G71 Z;  2AKL A;  4NBA A;  5AN9 F;  4NB8 A;  1NP6 A;  5T6B A;  3GTJ I;  3S1Q I;  1VQ8 Z;  2QEX Z;  1VQN 1;  3FQM A;  2OTJ 1;  3JAM f;  5IP7 I;  1R9T I;  1VLA A;  5D1O B;  3CD6 Z;  4RVG A;  1ZB9 A;  3CCR Z;  3JAM b;  4NBH A;  1M90 1;  3GTM I;  4NH1 C;  4X6A I;  4RVF A;  2IZ3 A;  4NBB A;  1VQL Z;  1K9M 1;  1X3W A;  1QVG Y;  3CCJ Z;  2OOX B;  5IP9 I;  5IT9 b;  1YIT Z;  3EER A;  3GTG I;  2YAD A;  1JJ2 Z;  2O53 A;  3HOV I;  1USP A;  4E33 A;  4MD8 A;  2G2K A;  3OW2 Z;  1W2B Z;  1Q7Y 1;  2Q51 A;  3J80 f;  3CC7 1;  1X0T A;  1Y1V I;  3F3P C;  4A3K I;  3H0G I;  3S1R I;  3FQQ A;  3S1N I;  1QVF Z;  3BG0 B;  2JMO A;  3HOZ I;  5FLX f;  1YHQ Z;  5C44 I;  3NDI A;  2QRE B;  3PO3 I;  2WAQ A;  2JNY A;  5IT9 f;  3FKI I;  4E2W A;  2JS4 A;  2VUG A;  2QA4 Z;  1VQ7 1;  3RZO I;  1TWH I;  4MRI A;  3CCQ 1;  2PM9 A;  2Q4Z A;  1K8A 1;  1YJ9 Z;  4RVD A;  3TDH B;  1YIJ 1;  3G6E Z;  3S1M I;  4E2X A;  2OZK A;  4A93 I;  1TFI A;  5LL6 f;  3CCJ 1;  2JA7 I;  2V8J A;  3CC2 Z;  3HOW I;  1M1K 2;  1VQ4 Z;  3CCU Z;  1Q86 1;  3MZK B;  4NFR A;  1P9N A;  4NOZ A;  3S2H I;  2LFU A;  1N8R 2;  3VMH A;  1VQ5 Z;  2R7Z I;  2NVQ I;  4RS4 A;  1Q81 1;  3T4N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...