1YJ91

Crystal structure of the mutant 50s ribosomal subunit of haloarcula marismortui containing a three residue deletion in l22
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yj9100
3CC2Z 1VQP1 1KQSZ 1QVFY 2QEXZ 1VQNZ 1K9M1 3CCJZ 1Q861 1YJ91 3G71Z 2QA4Z 2OTJZ 3CC21 3CCLZ 1Q821 1JJ2Y 1VQ81 3CCEZ 3CCR1 3CXCZ 2QEX1 1K9M2 1VQ6Z 1VQN1 3CCJ1 1Q811 1KC81 3CC71 1VQ51 1QVGY 1YITZ 2OTJ1 3CD6Z 1YIJZ 3I55Z 1YI21 1VQK1 1JJ2Z 1VQ71 1YJW1 1Q822 3CCL1 3G6EZ 3CCUZ 1M902 1VQL1 1VQOZ 3CCE1 1Q7Y1 1QVGZ 3CCQZ 3CXCY 1KC82 1VQ9Z 1YHQZ 3CCS1 3CME1 1N8R1 1KD11 3CD61 1YIJ1 3I551 3CCMZ 1W2BY 3CMAZ 1VQMZ 1NJI1 1M1K1 1VQO1 1Q862 1Q7Y2 1K8A1 1K731 3G711 3I56Z 2QA41 1W2BZ 1N8R2 1KD12 3CCVZ 3CC4Z 2OTLZ 3CCM1 1S72Z 3CMA1 3CPWZ 1VQM1 1NJI2 1M1K2 1VQ61 1VQPZ 1Q812 1K8A2 3I561 1YIT1 1YJ9Z 3CCV1 2OTL1 3G6E1 3CCU1 3CPWY 3CCQ1 3G4SZ 3OW2Y 1VQ91 1YHQ1 1VQ8Z 3CCRZ 1YJNZ 3CC7Z 1VQ5Z 1VQ4Z 1YI2Z 1VQKZ 3OW2Z 1VQ7Z 1K732 1YJWZ 1QVFZ 1VQLZ 1M901 3G4S1 1YJN1 1KQSY 3CC41 3CCSZ 1S721 1VQ41 3CMEZ
chains in the Genus database with same CATH superfamily
2VF1A 1VLAA 3CC2Z 4NBAA 3EEDA 2G2KA 2K5RA 1WIIA 2M6NA 2QEXZ 2YU9I 2QA4Z 2NVQI 1X3WA 1TFIA 3FQQA 1VQ6Z 1K83I 1VQN1 3CCJ1 2HF1A 4NB9A 3CC71 2PK7A 1L1OC 1QF8A 3S14I 5C44I 4NH1C 2VPYA 2QKDA 4RVFA 1S7MA 2RPRA 3G6EZ 2E9HA 5FLXb 3CCUZ 1P9NA 3BG1B 1M902 2E2II 3CCE1 1RNIA 3PO3S 3CXCY 2Y0SA 2JIOA 1YIJ1 3I551 1JWHC 1USPA 1TWGI 1Z03A 1TWAI 1SIWA 4AYBA 1VQMZ 4NB8A 2OOXB 4MXUA 3VMGA 3K7AI 1Q16A 3I56Z 3G711 1ZH1A 3CCVZ 1KRLA 5CM2M 2E2JI 1YUKA 1S72Z 3CMA1 1N2FA 1ML8A 1X3ZA 2VPZA 2YADA 1Q812 1I50I 1YJ9Z 2F4OA 5A2Qb 4A3GI 2J6AA 3T4NB 4CL1A 3GTQI 3NDJA 1R9TI 2V8KA 2NVTI 3CCQ1 1RQFA 1YHQ1 2JR6A 2JIQA 1VQ8Z 3VMHA 4E31A 5C4XI 2JMOA 5IP9I 2GU2A 4NBGA 2V45A 3NH5A 3GTGI 1YI2Z 5D1OB 3OW2Z 1VQ7Z 1YJWZ 2V8JA 2JA5I 3Q87A 3MZLB 1NP6A 1VQ41 2V3VA 2DE7A 2JA6I 1VQP1 1ZB8A 2W04A 3D2LA 1Q861 4NOZA 3JAMf 4MD7A 3CC21 2BJOA 4DK1A 1Q821 4A3CI 3S17I 3F3FC 3J81b 1RO2A 3CXCZ 2QEX1 2B63I 1KC81 3EERA 2NVXI 2R93I 1QVGY 2QR1B 4HGYA 4E30A 1JJ2Z 3TDHB 1Y1VI 2DE6A 1Q822 5IT9b 1WZNA 1VQOZ 4QTTA 4E32A 5T64A 1Q7Y1 1ZB9A 3M4OI 1KC82 2KPIA 2O53A 4TNUA 1WJ2A 2P3YA 3CME1 1N8R1 3GTMI 3HOZI 3PO2I 1QXFA 3J7A4 1NJI1 4NFRA 2WB1A 3J80f 1Q7Y2 3ESWA 2ZAEB 2W03A 4MRIA 1W2BZ 4E2WA 1N8R2 3CC4Z 2KI7B 2OTLZ 3VB9A 4Y52I 4A3MI 1VQM1 1NJI2 2AKLA 2RHBA 5IP7I 4BY1I 3I561 3GKQA 2IZ4A 1WCMI 1YIT1 5FLXf 2DE5A 3CCV1 3NDIA 4A3DI 3I4NI 1RLYA 2I3CA 3HOWI 1Z01A 3G4SZ 1VQ91 3CQZI 3NH4A 1YJNZ 3H0GI 1USPB 2LEXA 2R7ZI 3HOXI 3S1NI 3CC7Z 1Y1VS 3GTJI 4EWCA 5C4JI 5LL6f 3VMIA 3GTMS 4A93I 3IX0A 3U50C 2IV2X 4NBCA 4BBRI 4X6AI 2VPXA 1TWCI 5A2Qf 3S2HI 2GTIA 4E2YA 1KQSZ 3FQMA 4NBEA 1K9M1 2LIYA 2E2HI 3G71Z 3M3YI 2HU9A 3HOYI 2OTJZ 2JNYA 2VPWA 2RT9A 3LUSA 4HGZA 2IZ3A 3CCLZ 2EGTA 3CCR1 1K9M2 2VUMI 3P5JB 2QRCB 4RVHA 1VQ51 3S15I 1X0TA 3GCFA 3CD6Z 1AA6A 2JA8I 3FKII 1VQK1 3IR7A 3D9XA 1VQL1 2K3RA 1YUAA 2WAQA 4A3FI 1RO0A 3CCQZ 4A3LI 1PFTA 1YHQZ 3CCS1 2GTHA 4A3BI 1I3QI 4A3KI 3CCMZ 3KIFA 4DQYB 1M1K1 1VQO1 2NAPA 4NBHA 1Q862 4A3II 4Y7NI 1K731 3TE5B 2QA41 3D6WA 3S2DI 1NUIA 3J81f 1SFOI 3IFUA 4E2XA 3PO3I 4NBDA 3I4MI 2RBLA 1M1K2 1I6HI 1VQ61 1VQPZ 3QWUA 3GTKI 1DL6A 2JIPA 3BG0B 4XX2A 5IT9f 4S1TA 2OTL1 5FLMI 2PMZA 4NBFA 3G6E1 3CCU1 3CPWY 3RZOI 3MONA 4E33A 3OW2Y 1RO4A 3GTLI 2R92I 2JIRA 1Y8CA 4A3JI 1LQLA 3J80b 2NVYI 2OOYB 3NFZA 3HOVI 3KIHA 1M901 3G4S1 1FDIA 1YJN1 4BXXI 2VUGA 1S721 3CMEZ 2E7ZA 1TWFI 2QREB 2JA7I 1QVFY 1VQNZ 3CCJZ 1YJ91 4BY7I 4NBBA 1WW9A 2Q4ZA 2QRDB 4MD9A 1JJ2Y 1VQ81 3CCEZ 1Q811 5AN9F 2OZKA 1YITZ 4MD8A 2OTJ1 1YIJZ 3VTNA 3I55Z 1YI21 3F3PC 4RV9A 3S1QI 1VQ71 5T67A 1YJW1 2Q51A 3HKZA 2PM9A 3CCL1 5C3EI 2RIQA 1QVGZ 1Y1WI 3RZDI 1VQ9Z 4A3EI 2JS4A 1KD11 3CD61 1QYPA 3H3VJ 1W2BY 3CMAZ 2JIMA 3IF8A 4DGLA 5D1OA 4MH4A 1K8A1 2AYDA 3MZKB 2V8IA 2LFUA 1KD12 2H85A 3CCM1 5T6BA 2F4MA 4HH4A 3CPWZ 3GTPI 4RVDA 3I07A 4QTUA 2R6MA 3HOUI 1K8A2 4MONA 2O4HA 3S1MI 2QLVB 1FDOA 3JAMb 3CCRZ 3S1RI 2M48A 1VQ5Z 1VQ4Z 1VQKZ 1Z02A 4BBSI 1K732 1QVFZ 2JUBA 1TWHI 1VQLZ 3S16I 2P28A 3GTOI 3NH8A 1KQSY 5D1PA 4RVGA 3CC41 4RS4A 4E2ZA 3CCSZ
chains in the Genus database with same CATH topology
2VF1A 1VLAA 3CC2Z 4NBAA 3EEDA 2G2KA 2K5RA 1WIIA 2M6NA 2QEXZ 2YU9I 2QA4Z 2NVQI 1X3WA 1TFIA 3FQQA 1VQ6Z 1K83I 1VQN1 3CCJ1 2HF1A 4NB9A 3CC71 2PK7A 1L1OC 1QF8A 3S14I 5C44I 4NH1C 2QKDA 4RVFA 1S7MA 2RPRA 3G6EZ 2E9HA 5FLXb 3CCUZ 1P9NA 3BG1B 1M902 2E2II 3CCE1 1RNIA 3PO3S 3CXCY 2Y0SA 1YIJ1 3I551 1JWHC 1USPA 1TWGI 1Z03A 1TWAI 4AYBA 1VQMZ 4NB8A 2OOXB 4MXUA 3VMGA 3K7AI 3G711 3I56Z 1ZH1A 3CCVZ 1KRLA 5CM2M 2E2JI 1YUKA 1S72Z 3CMA1 1N2FA 1ML8A 1X3ZA 2YADA 1Q812 1I50I 1YJ9Z 2F4OA 5A2Qb 4A3GI 2J6AA 3T4NB 4CL1A 3GTQI 3NDJA 1R9TI 2V8KA 2NVTI 3CCQ1 1RQFA 1YHQ1 2JR6A 1VQ8Z 3VMHA 4E31A 5C4XI 2JMOA 5IP9I 2GU2A 4NBGA 3NH5A 3GTGI 1YI2Z 5D1OB 3OW2Z 1VQ7Z 1YJWZ 2V8JA 2JA5I 3Q87A 3MZLB 1NP6A 1VQ41 2DE7A 2JA6I 1VQP1 1ZB8A 2W04A 1Q861 4NOZA 3JAMf 4MD7A 3CC21 2BJOA 4DK1A 1Q821 4A3CI 3S17I 3F3FC 3J81b 1RO2A 3CXCZ 2QEX1 2B63I 1KC81 3EERA 2NVXI 2R93I 1QVGY 2QR1B 4HGYA 4E30A 1JJ2Z 3TDHB 1Y1VI 2DE6A 1Q822 5IT9b 1VQOZ 4QTTA 4E32A 5T64A 1Q7Y1 1ZB9A 3M4OI 1KC82 2KPIA 2O53A 4TNUA 2P3YA 3CME1 1N8R1 3GTMI 3HOZI 3PO2I 3J7A4 1NJI1 4NFRA 2WB1A 3J80f 1Q7Y2 3ESWA 2ZAEB 2W03A 4MRIA 1W2BZ 4E2WA 1N8R2 3CC4Z 2KI7B 2OTLZ 3VB9A 4Y52I 4A3MI 1VQM1 1NJI2 2AKLA 2RHBA 5IP7I 4BY1I 3I561 3GKQA 2IZ4A 1WCMI 1YIT1 5FLXf 2DE5A 3CCV1 3NDIA 4A3DI 3I4NI 1RLYA 2I3CA 3HOWI 1Z01A 3G4SZ 1VQ91 3CQZI 3NH4A 1YJNZ 3H0GI 1USPB 2R7ZI 3HOXI 3S1NI 3CC7Z 1Y1VS 3GTJI 4EWCA 5C4JI 5LL6f 3VMIA 3GTMS 4A93I 3IX0A 3U50C 4NBCA 4BBRI 4X6AI 1TWCI 5A2Qf 3S2HI 2GTIA 4E2YA 1KQSZ 3FQMA 4NBEA 1K9M1 2LIYA 2E2HI 3G71Z 3M3YI 2HU9A 3HOYI 2OTJZ 2JNYA 2RT9A 3LUSA 4HGZA 2IZ3A 3CCLZ 2EGTA 3CCR1 1K9M2 2VUMI 3P5JB 2QRCB 4RVHA 1VQ51 3S15I 1X0TA 3GCFA 3CD6Z 2JA8I 3FKII 1VQK1 3D9XA 1VQL1 2K3RA 1YUAA 2WAQA 4A3FI 1RO0A 3CCQZ 4A3LI 1PFTA 1YHQZ 3CCS1 2GTHA 4A3BI 1I3QI 4A3KI 3CCMZ 3KIFA 4DQYB 1M1K1 1VQO1 4NBHA 1Q862 4A3II 4Y7NI 1K731 3TE5B 2QA41 3D6WA 3S2DI 1NUIA 3J81f 1SFOI 3IFUA 4E2XA 3PO3I 4NBDA 3I4MI 2RBLA 1M1K2 1I6HI 1VQ61 1VQPZ 3QWUA 3GTKI 1DL6A 3BG0B 4XX2A 5IT9f 4S1TA 2OTL1 5FLMI 2PMZA 4NBFA 3G6E1 3CCU1 3CPWY 3RZOI 3MONA 4E33A 3OW2Y 1RO4A 3GTLI 2R92I 4A3JI 1LQLA 3J80b 2NVYI 2OOYB 3NFZA 3HOVI 3KIHA 1M901 3G4S1 1YJN1 4BXXI 2VUGA 1S721 3CMEZ 1TWFI 2QREB 2JA7I 1QVFY 1VQNZ 3CCJZ 1YJ91 4BY7I 4NBBA 1WW9A 2Q4ZA 2QRDB 4MD9A 1JJ2Y 1VQ81 3CCEZ 1Q811 5AN9F 2OZKA 1YITZ 4MD8A 2OTJ1 1YIJZ 3VTNA 3I55Z 1YI21 3F3PC 4RV9A 3S1QI 1VQ71 5T67A 1YJW1 2Q51A 3HKZA 2PM9A 3CCL1 5C3EI 2RIQA 1QVGZ 1Y1WI 3RZDI 1VQ9Z 4A3EI 2JS4A 1KD11 3CD61 1QYPA 3H3VJ 1W2BY 3CMAZ 3IF8A 4DGLA 5D1OA 4MH4A 1K8A1 3MZKB 2V8IA 2LFUA 1KD12 2H85A 3CCM1 5T6BA 2F4MA 4HH4A 3CPWZ 3GTPI 4RVDA 3I07A 4QTUA 2R6MA 3HOUI 1K8A2 4MONA 2O4HA 3S1MI 2QLVB 3JAMb 3CCRZ 3S1RI 2M48A 1VQ5Z 1VQ4Z 1VQKZ 1Z02A 4BBSI 1K732 1QVFZ 2JUBA 1TWHI 1VQLZ 3S16I 2P28A 3GTOI 3NH8A 1KQSY 5D1PA 4RVGA 3CC41 4RS4A 4E2ZA 3CCSZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 Z;  1VQP 1;  1KQS Z;  1QVF Y;  2QEX Z;  1VQN Z;  1K9M 1;  3CCJ Z;  1Q86 1;  1YJ9 1;  3G71 Z;  2QA4 Z;  2OTJ Z;  3CC2 1;  3CCL Z;  1Q82 1;  1JJ2 Y;  1VQ8 1;  3CCE Z;  3CCR 1;  3CXC Z;  2QEX 1;  1K9M 2;  1VQ6 Z;  1VQN 1;  3CCJ 1;  1Q81 1;  1KC8 1;  3CC7 1;  1VQ5 1;  1QVG Y;  1YIT Z;  2OTJ 1;  3CD6 Z;  1YIJ Z;  3I55 Z;  1YI2 1;  1VQK 1;  1JJ2 Z;  1VQ7 1;  1YJW 1;  1Q82 2;  3CCL 1;  3G6E Z;  3CCU Z;  1M90 2;  1VQL 1;  1VQO Z;  3CCE 1;  1Q7Y 1;  1QVG Z;  3CCQ Z;  3CXC Y;  1KC8 2;  1VQ9 Z;  1YHQ Z;  3CCS 1;  3CME 1;  1N8R 1;  1KD1 1;  3CD6 1;  1YIJ 1;  3I55 1;  3CCM Z;  1W2B Y;  3CMA Z;  1VQM Z;  1NJI 1;  1M1K 1;  1VQO 1;  1Q86 2;  1Q7Y 2;  1K8A 1;  1K73 1;  3G71 1;  3I56 Z;  2QA4 1;  1W2B Z;  1N8R 2;  1KD1 2;  3CCV Z;  3CC4 Z;  2OTL Z;  3CCM 1;  1S72 Z;  3CMA 1;  3CPW Z;  1VQM 1;  1NJI 2;  1M1K 2;  1VQ6 1;  1VQP Z;  1Q81 2;  1K8A 2;  3I56 1;  1YIT 1;  1YJ9 Z;  3CCV 1;  2OTL 1;  3G6E 1;  3CCU 1;  3CPW Y;  3CCQ 1;  3G4S Z;  3OW2 Y;  1VQ9 1;  1YHQ 1;  1VQ8 Z;  3CCR Z;  1YJN Z;  3CC7 Z;  1VQ5 Z;  1VQ4 Z;  1YI2 Z;  1VQK Z;  3OW2 Z;  1VQ7 Z;  1K73 2;  1YJW Z;  1QVF Z;  1VQL Z;  1M90 1;  3G4S 1;  1YJN 1;  1KQS Y;  3CC4 1;  3CCS Z;  1S72 1;  1VQ4 1;  3CME Z; 
#chains in the Genus database with same CATH topology
 2VF1 A;  1VLA A;  3CC2 Z;  4NBA A;  3EED A;  2G2K A;  2K5R A;  1WII A;  2M6N A;  2QEX Z;  2YU9 I;  2QA4 Z;  2NVQ I;  1X3W A;  1TFI A;  3FQQ A;  1VQ6 Z;  1K83 I;  1VQN 1;  3CCJ 1;  2HF1 A;  4NB9 A;  3CC7 1;  2PK7 A;  1L1O C;  1QF8 A;  3S14 I;  5C44 I;  4NH1 C;  2VPY A;  2QKD A;  4RVF A;  1S7M A;  2RPR A;  3G6E Z;  2E9H A;  5FLX b;  3CCU Z;  1P9N A;  3BG1 B;  1M90 2;  2E2I I;  3CCE 1;  1RNI A;  3PO3 S;  3CXC Y;  2Y0S A;  2JIO A;  1YIJ 1;  3I55 1;  1JWH C;  1USP A;  1TWG I;  1Z03 A;  1TWA I;  1SIW A;  4AYB A;  1VQM Z;  4NB8 A;  2OOX B;  4MXU A;  3VMG A;  3K7A I;  1Q16 A;  3I56 Z;  3G71 1;  1ZH1 A;  3CCV Z;  1KRL A;  5CM2 M;  2E2J I;  1YUK A;  1S72 Z;  3CMA 1;  1N2F A;  1ML8 A;  1X3Z A;  2VPZ A;  2YAD A;  1Q81 2;  1I50 I;  1YJ9 Z;  2F4O A;  5A2Q b;  4A3G I;  2J6A A;  3T4N B;  4CL1 A;  3GTQ I;  3NDJ A;  1R9T I;  2V8K A;  2NVT I;  3CCQ 1;  1RQF A;  1YHQ 1;  2JR6 A;  2JIQ A;  1VQ8 Z;  3VMH A;  4E31 A;  5C4X I;  2JMO A;  5IP9 I;  2GU2 A;  4NBG A;  2V45 A;  3NH5 A;  3GTG I;  1YI2 Z;  5D1O B;  3OW2 Z;  1VQ7 Z;  1YJW Z;  2V8J A;  2JA5 I;  3Q87 A;  3MZL B;  1NP6 A;  1VQ4 1;  2V3V A;  2DE7 A;  2JA6 I;  1VQP 1;  1ZB8 A;  2W04 A;  3D2L A;  1Q86 1;  4NOZ A;  3JAM f;  4MD7 A;  3CC2 1;  2BJO A;  4DK1 A;  1Q82 1;  4A3C I;  3S17 I;  3F3F C;  3J81 b;  1RO2 A;  3CXC Z;  2QEX 1;  2B63 I;  1KC8 1;  3EER A;  2NVX I;  2R93 I;  1QVG Y;  2QR1 B;  4HGY A;  4E30 A;  1JJ2 Z;  3TDH B;  1Y1V I;  2DE6 A;  1Q82 2;  5IT9 b;  1WZN A;  1VQO Z;  4QTT A;  4E32 A;  5T64 A;  1Q7Y 1;  1ZB9 A;  3M4O I;  1KC8 2;  2KPI A;  2O53 A;  4TNU A;  1WJ2 A;  2P3Y A;  3CME 1;  1N8R 1;  3GTM I;  3HOZ I;  3PO2 I;  1QXF A;  3J7A 4;  1NJI 1;  4NFR A;  2WB1 A;  3J80 f;  1Q7Y 2;  3ESW A;  2ZAE B;  2W03 A;  4MRI A;  1W2B Z;  4E2W A;  1N8R 2;  3CC4 Z;  2KI7 B;  2OTL Z;  3VB9 A;  4Y52 I;  4A3M I;  1VQM 1;  1NJI 2;  2AKL A;  2RHB A;  5IP7 I;  4BY1 I;  3I56 1;  3GKQ A;  2IZ4 A;  1WCM I;  1YIT 1;  5FLX f;  2DE5 A;  3CCV 1;  3NDI A;  4A3D I;  3I4N I;  1RLY A;  2I3C A;  3HOW I;  1Z01 A;  3G4S Z;  1VQ9 1;  3CQZ I;  3NH4 A;  1YJN Z;  3H0G I;  1USP B;  2LEX A;  2R7Z I;  3HOX I;  3S1N I;  3CC7 Z;  1Y1V S;  3GTJ I;  4EWC A;  5C4J I;  5LL6 f;  3VMI A;  3GTM S;  4A93 I;  3IX0 A;  3U50 C;  2IV2 X;  4NBC A;  4BBR I;  4X6A I;  2VPX A;  1TWC I;  5A2Q f;  3S2H I;  2GTI A;  4E2Y A;  1KQS Z;  3FQM A;  4NBE A;  1K9M 1;  2LIY A;  2E2H I;  3G71 Z;  3M3Y I;  2HU9 A;  3HOY I;  2OTJ Z;  2JNY A;  2VPW A;  2RT9 A;  3LUS A;  4HGZ A;  2IZ3 A;  3CCL Z;  2EGT A;  3CCR 1;  1K9M 2;  2VUM I;  3P5J B;  2QRC B;  4RVH A;  1VQ5 1;  3S15 I;  1X0T A;  3GCF A;  3CD6 Z;  1AA6 A;  2JA8 I;  3FKI I;  1VQK 1;  3IR7 A;  3D9X A;  1VQL 1;  2K3R A;  1YUA A;  2WAQ A;  4A3F I;  1RO0 A;  3CCQ Z;  4A3L I;  1PFT A;  1YHQ Z;  3CCS 1;  2GTH A;  4A3B I;  1I3Q I;  4A3K I;  3CCM Z;  3KIF A;  4DQY B;  1M1K 1;  1VQO 1;  2NAP A;  4NBH A;  1Q86 2;  4A3I I;  4Y7N I;  1K73 1;  3TE5 B;  2QA4 1;  3D6W A;  3S2D I;  1NUI A;  3J81 f;  1SFO I;  3IFU A;  4E2X A;  3PO3 I;  4NBD A;  3I4M I;  2RBL A;  1M1K 2;  1I6H I;  1VQ6 1;  1VQP Z;  3QWU A;  3GTK I;  1DL6 A;  2JIP A;  3BG0 B;  4XX2 A;  5IT9 f;  4S1T A;  2OTL 1;  5FLM I;  2PMZ A;  4NBF A;  3G6E 1;  3CCU 1;  3CPW Y;  3RZO I;  3MON A;  4E33 A;  3OW2 Y;  1RO4 A;  3GTL I;  2R92 I;  2JIR A;  1Y8C A;  4A3J I;  1LQL A;  3J80 b;  2NVY I;  2OOY B;  3NFZ A;  3HOV I;  3KIH A;  1M90 1;  3G4S 1;  1FDI A;  1YJN 1;  4BXX I;  2VUG A;  1S72 1;  3CME Z;  2E7Z A;  1TWF I;  2QRE B;  2JA7 I;  1QVF Y;  1VQN Z;  3CCJ Z;  1YJ9 1;  4BY7 I;  4NBB A;  1WW9 A;  2Q4Z A;  2QRD B;  4MD9 A;  1JJ2 Y;  1VQ8 1;  3CCE Z;  1Q81 1;  5AN9 F;  2OZK A;  1YIT Z;  4MD8 A;  2OTJ 1;  1YIJ Z;  3VTN A;  3I55 Z;  1YI2 1;  3F3P C;  4RV9 A;  3S1Q I;  1VQ7 1;  5T67 A;  1YJW 1;  2Q51 A;  3HKZ A;  2PM9 A;  3CCL 1;  5C3E I;  2RIQ A;  1QVG Z;  1Y1W I;  3RZD I;  1VQ9 Z;  4A3E I;  2JS4 A;  1KD1 1;  3CD6 1;  1QYP A;  3H3V J;  1W2B Y;  3CMA Z;  2JIM A;  3IF8 A;  4DGL A;  5D1O A;  4MH4 A;  1K8A 1;  2AYD A;  3MZK B;  2V8I A;  2LFU A;  1KD1 2;  2H85 A;  3CCM 1;  5T6B A;  2F4M A;  4HH4 A;  3CPW Z;  3GTP I;  4RVD A;  3I07 A;  4QTU A;  2R6M A;  3HOU I;  1K8A 2;  4MON A;  2O4H A;  3S1M I;  2QLV B;  1FDO A;  3JAM b;  3CCR Z;  3S1R I;  2M48 A;  1VQ5 Z;  1VQ4 Z;  1VQK Z;  1Z02 A;  4BBS I;  1K73 2;  1QVF Z;  2JUB A;  1TWH I;  1VQL Z;  3S16 I;  2P28 A;  3GTO I;  3NH8 A;  1KQS Y;  5D1P A;  4RVG A;  3CC4 1;  4RS4 A;  4E2Z A;  3CCS Z; 
#chains in the Genus database with same CATH homology
 2VF1 A;  1VLA A;  3CC2 Z;  4NBA A;  3EED A;  2G2K A;  2K5R A;  1WII A;  2M6N A;  2QEX Z;  2YU9 I;  2QA4 Z;  2NVQ I;  1X3W A;  1TFI A;  3FQQ A;  1VQ6 Z;  1K83 I;  1VQN 1;  3CCJ 1;  2HF1 A;  4NB9 A;  3CC7 1;  2PK7 A;  1L1O C;  1QF8 A;  3S14 I;  5C44 I;  4NH1 C;  2QKD A;  4RVF A;  1S7M A;  2RPR A;  3G6E Z;  2E9H A;  5FLX b;  3CCU Z;  1P9N A;  3BG1 B;  1M90 2;  2E2I I;  3CCE 1;  1RNI A;  3PO3 S;  3CXC Y;  2Y0S A;  1YIJ 1;  3I55 1;  1JWH C;  1USP A;  1TWG I;  1Z03 A;  1TWA I;  4AYB A;  1VQM Z;  4NB8 A;  2OOX B;  4MXU A;  3VMG A;  3K7A I;  3G71 1;  3I56 Z;  1ZH1 A;  3CCV Z;  1KRL A;  5CM2 M;  2E2J I;  1YUK A;  1S72 Z;  3CMA 1;  1N2F A;  1ML8 A;  1X3Z A;  2YAD A;  1Q81 2;  1I50 I;  1YJ9 Z;  2F4O A;  5A2Q b;  4A3G I;  2J6A A;  3T4N B;  4CL1 A;  3GTQ I;  3NDJ A;  1R9T I;  2V8K A;  2NVT I;  3CCQ 1;  1RQF A;  1YHQ 1;  2JR6 A;  1VQ8 Z;  3VMH A;  4E31 A;  5C4X I;  2JMO A;  5IP9 I;  2GU2 A;  4NBG A;  3NH5 A;  3GTG I;  1YI2 Z;  5D1O B;  3OW2 Z;  1VQ7 Z;  1YJW Z;  2V8J A;  2JA5 I;  3Q87 A;  3MZL B;  1NP6 A;  1VQ4 1;  2DE7 A;  2JA6 I;  1VQP 1;  1ZB8 A;  2W04 A;  1Q86 1;  4NOZ A;  3JAM f;  4MD7 A;  3CC2 1;  2BJO A;  4DK1 A;  1Q82 1;  4A3C I;  3S17 I;  3F3F C;  3J81 b;  1RO2 A;  3CXC Z;  2QEX 1;  2B63 I;  1KC8 1;  3EER A;  2NVX I;  2R93 I;  1QVG Y;  2QR1 B;  4HGY A;  4E30 A;  1JJ2 Z;  3TDH B;  1Y1V I;  2DE6 A;  1Q82 2;  5IT9 b;  1VQO Z;  4QTT A;  4E32 A;  5T64 A;  1Q7Y 1;  1ZB9 A;  3M4O I;  1KC8 2;  2KPI A;  2O53 A;  4TNU A;  2P3Y A;  3CME 1;  1N8R 1;  3GTM I;  3HOZ I;  3PO2 I;  3J7A 4;  1NJI 1;  4NFR A;  2WB1 A;  3J80 f;  1Q7Y 2;  3ESW A;  2ZAE B;  2W03 A;  4MRI A;  1W2B Z;  4E2W A;  1N8R 2;  3CC4 Z;  2KI7 B;  2OTL Z;  3VB9 A;  4Y52 I;  4A3M I;  1VQM 1;  1NJI 2;  2AKL A;  2RHB A;  5IP7 I;  4BY1 I;  3I56 1;  3GKQ A;  2IZ4 A;  1WCM I;  1YIT 1;  5FLX f;  2DE5 A;  3CCV 1;  3NDI A;  4A3D I;  3I4N I;  1RLY A;  2I3C A;  3HOW I;  1Z01 A;  3G4S Z;  1VQ9 1;  3CQZ I;  3NH4 A;  1YJN Z;  3H0G I;  1USP B;  2R7Z I;  3HOX I;  3S1N I;  3CC7 Z;  1Y1V S;  3GTJ I;  4EWC A;  5C4J I;  5LL6 f;  3VMI A;  3GTM S;  4A93 I;  3IX0 A;  3U50 C;  4NBC A;  4BBR I;  4X6A I;  1TWC I;  5A2Q f;  3S2H I;  2GTI A;  4E2Y A;  1KQS Z;  3FQM A;  4NBE A;  1K9M 1;  2LIY A;  2E2H I;  3G71 Z;  3M3Y I;  2HU9 A;  3HOY I;  2OTJ Z;  2JNY A;  2RT9 A;  3LUS A;  4HGZ A;  2IZ3 A;  3CCL Z;  2EGT A;  3CCR 1;  1K9M 2;  2VUM I;  3P5J B;  2QRC B;  4RVH A;  1VQ5 1;  3S15 I;  1X0T A;  3GCF A;  3CD6 Z;  2JA8 I;  3FKI I;  1VQK 1;  3D9X A;  1VQL 1;  2K3R A;  1YUA A;  2WAQ A;  4A3F I;  1RO0 A;  3CCQ Z;  4A3L I;  1PFT A;  1YHQ Z;  3CCS 1;  2GTH A;  4A3B I;  1I3Q I;  4A3K I;  3CCM Z;  3KIF A;  4DQY B;  1M1K 1;  1VQO 1;  4NBH A;  1Q86 2;  4A3I I;  4Y7N I;  1K73 1;  3TE5 B;  2QA4 1;  3D6W A;  3S2D I;  1NUI A;  3J81 f;  1SFO I;  3IFU A;  4E2X A;  3PO3 I;  4NBD A;  3I4M I;  2RBL A;  1M1K 2;  1I6H I;  1VQ6 1;  1VQP Z;  3QWU A;  3GTK I;  1DL6 A;  3BG0 B;  4XX2 A;  5IT9 f;  4S1T A;  2OTL 1;  5FLM I;  2PMZ A;  4NBF A;  3G6E 1;  3CCU 1;  3CPW Y;  3RZO I;  3MON A;  4E33 A;  3OW2 Y;  1RO4 A;  3GTL I;  2R92 I;  4A3J I;  1LQL A;  3J80 b;  2NVY I;  2OOY B;  3NFZ A;  3HOV I;  3KIH A;  1M90 1;  3G4S 1;  1YJN 1;  4BXX I;  2VUG A;  1S72 1;  3CME Z;  1TWF I;  2QRE B;  2JA7 I;  1QVF Y;  1VQN Z;  3CCJ Z;  1YJ9 1;  4BY7 I;  4NBB A;  1WW9 A;  2Q4Z A;  2QRD B;  4MD9 A;  1JJ2 Y;  1VQ8 1;  3CCE Z;  1Q81 1;  5AN9 F;  2OZK A;  1YIT Z;  4MD8 A;  2OTJ 1;  1YIJ Z;  3VTN A;  3I55 Z;  1YI2 1;  3F3P C;  4RV9 A;  3S1Q I;  1VQ7 1;  5T67 A;  1YJW 1;  2Q51 A;  3HKZ A;  2PM9 A;  3CCL 1;  5C3E I;  2RIQ A;  1QVG Z;  1Y1W I;  3RZD I;  1VQ9 Z;  4A3E I;  2JS4 A;  1KD1 1;  3CD6 1;  1QYP A;  3H3V J;  1W2B Y;  3CMA Z;  3IF8 A;  4DGL A;  5D1O A;  4MH4 A;  1K8A 1;  3MZK B;  2V8I A;  2LFU A;  1KD1 2;  2H85 A;  3CCM 1;  5T6B A;  2F4M A;  4HH4 A;  3CPW Z;  3GTP I;  4RVD A;  3I07 A;  4QTU A;  2R6M A;  3HOU I;  1K8A 2;  4MON A;  2O4H A;  3S1M I;  2QLV B;  3JAM b;  3CCR Z;  3S1R I;  2M48 A;  1VQ5 Z;  1VQ4 Z;  1VQK Z;  1Z02 A;  4BBS I;  1K73 2;  1QVF Z;  2JUB A;  1TWH I;  1VQL Z;  3S16 I;  2P28 A;  3GTO I;  3NH8 A;  1KQS Y;  5D1P A;  4RVG A;  3CC4 1;  4RS4 A;  4E2Z A;  3CCS Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...