3HOZI

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hozI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hozI02
3S17I 4A3BI 1Y1WI 1USPA 2P3YA 2JA6I 1QYPA 3RZOI 2K5RA 1I50I 4A3II 4A3FI 2E2II 2AKLA 3PO3I 5C4JI 5C3EI 1I6HI 3S2DI 3GKQA 4A3JI 3PO3S 3CQZI 1ZB9A 1Y1VS 2E2HI 2F4MA 3ESWA 4A3GI 3S2HI 3S1MI 2YU9I 1X3WA 2JA8I 1TWHI 3VB9A 3H0GI 3H3VJ 1USPB 4MH4A 3U50C 4NB9A 3GTPI 1DL6A 2NVTI 1RLYA 3D6WA 2JR6A 5FLMI 2KPIA 2E2JI 1YUAA 2DE5A 3I4MI 3Q87A 5C44I 3GTJI 1VLAA 3GCFA 3GTQI 3GTMI 1TWAI 3GTMS 2R92I 3LUSA 3S1NI 3HOUI 3EERA 2NVXI 2BJOA 5C4XI 5IP7I 4XX2A 4QTUA 1I3QI 3M4OI 3S15I 3S1QI 1TFIA 2J6AA 2DE7A 4BBRI 3HOZI 4A93I 1LQLA 3VMGA 3I4NI 1ML8A 3S14I 4NBEA 1ZB8A 2DE6A 2R7ZI 3S16I 3RZDI 2NVQI 3GTLI 4BBSI 2HF1A 4BY7I 4A3LI 2JA5I 1TWCI 1RO4A 3HOYI 2NVYI 3FKII 3VMHA 4NBCA 5IP9I 3GTKI 4NOZA 4A3EI 4X6AI 1L1OC 1WW9A 4A3DI 1N2FA 1X3ZA 4NBDA 1NUIA 1TWFI 2B63I 3I07A 2R93I 3HOVI 3GTGI 4NBGA 4A3KI 4NBFA 3S1RI 1WCMI 2VUMI 4NBBA 2F4OA 1PFTA 2JNYA 4BXXI 5CM2M 1SFOI 1Y1VI 1TWGI 3GTOI 4NB8A 4QTTA 3VMIA 3HOXI 4A3CI 2PK7A 4NBHA 1K83I 3K7AI 2RBLA 4BY1I 4A3MI 3PO2I 2JA7I 1R9TI 4NBAA 4Y52I 3M3YI 4Y7NI 2JS4A 3HOWI
chains in the Genus database with same CATH superfamily
3D9XA 1QVFY 2E2II 3I56Z 3PO3I 3D2LA 3S2DI 1VQ8Z 1VQPZ 2QR1B 3CQZI 1VQ51 2QRDB 3CC41 2E2HI 3ESWA 3CCRZ 3J80b 2OTJ1 3VB9A 2K3RA 3H0GI 3KIFA 2ZAEB 3CCV1 1DL6A 3GTPI 4E2WA 1S7MA 2VPWA 2NVTI 2JR6A 1YIJZ 3CPWZ 2DE5A 1VQNZ 5T6BA 3GTJI 2WAQA 1YJW1 3GTQI 1M1K1 3CD61 4MD8A 3GTMS 3I55Z 2NAPA 3JAMf 5IP7I 2QKDA 4XX2A 1Y8CA 1VQ41 1KQSZ 2PMZA 1Z03A 4RV9A 1W2BZ 3CCM1 1WIIA 3CXCZ 2J6AA 3OW2Y 4TNUA 2W04A 1Z01A 3CCJ1 3S14I 1YI2Z 4NFRA 2QEXZ 1SIWA 3BG0B 2G2KA 3RZDI 3GTLI 3CMEZ 3F3PC 4BY7I 4A3LI 4DQYB 4MD9A 1Q7Y1 3FKII 4CL1A 3JAMb 3GTKI 4X6AI 1L1OC 2V8JA 1N2FA 1X3ZA 3HKZA 3IR7A 1TWFI 2B63I 3HOVI 4NBGA 2VUMI 4E2ZA 4AYBA 3J81f 1Y1VI 1TWGI 3GTOI 3MZKB 3CCLZ 4A3CI 1YHQ1 1KC82 1K83I 2RBLA 2VPYA 3F3FC 1K8A2 5T64A 2QA4Z 4RVHA 2VUGA 1ZH1A 1VQ6Z 4NBAA 4RVFA 1NJI2 3M3YI 2RPRA 1YJN1 3CCQZ 1FDOA 1USPA 2JA6I 5C4JI 5C3EI 3CCE1 1N8R1 1RNIA 1Q861 3FQQA 1ZB9A 1Y1VS 2Y0SA 2F4MA 3MONA 1VQ91 3CCS1 2Q4ZA 3S2HI 1K732 1VQO1 4HGZA 2JA8I 1S721 4MH4A 2WB1A 1Q821 4NB9A 3U50C 3D6WA 2OOXB 2GTHA 2LEXA 4HGYA 3I4MI 4MD7A 3Q87A 2E9HA 5C44I 1QVGZ 3GCFA 3T4NB 3GTMI 1TWAI 1M902 2R92I 1VQK1 4RVDA 1Z02A 2NVXI 2BJOA 5C4XI 1WJ2A 3M4OI 2IZ4A 3CMAZ 3S1QI 2DE7A 2LIYA 3NDIA 3G4SZ 3NDJA 4NBEA 2R7ZI 4BBSI 1TWCI 1Q811 3CCUZ 3G6EZ 1RO2A 2NVYI 3CC2Z 3OW2Z 4E33A 2W03A 4A3EI 1WW9A 2VF1A 4RVGA 3I07A 1K9M2 3GTGI 1X0TA 1VQL1 5D1OB 3S1RI 2VPZA 1YJ9Z 2F4OA 1PFTA 3G71Z 4BXXI 5CM2M 4E2XA 4NB8A 4QTTA 3IF8A 1JJ2Y 3VMIA 3K7AI 2LFUA 1VQ71 2JA7I 2RT9A 3CC4Z 4Y52I 2JS4A 2KI7B 3J7A4 3HOWI 2OTJZ 3S17I 2O4HA 1Y1WI 2P3YA 4E30A 3RZOI 1RQFA 1I50I 1AA6A 4A3II 4A3FI 2GU2A 3CC71 2AKLA 2JMOA 4S1TA 3CXCY 1KD11 1I6HI 4A3JI 1P9NA 1YUKA 1NP6A 3CCVZ 2QREB 1VQM1 1QXFA 1M1K2 2R6MA 2YU9I 1X3WA 1TWHI 2IV2X 3I561 3H3VJ 1YJWZ 3VTNA 1YITZ 1VQ81 2I3CA 1VQP1 1QF8A 3P5JB 1WZNA 1RLYA 2JIQA 3CCR1 2P28A 1VQ4Z 2E2JI 5D1OA 3CCMZ 2V8KA 1RO0A 3LUSA 3S1NI 3CCJZ 3HOUI 4E2YA 5T67A 1YIJ1 1QVFZ 1I3QI 2V8IA 1VQN1 1JWHC 3CCU1 4BBRI 3CC21 2PM9A 2H85A 4A93I 1LQLA 3I551 2RHBA 3VMGA 2JIOA 2Q51A 3IX0A 2DE6A 3BG1B 5LL6f 3TDHB 3QWUA 2JA5I 3HOYI 4MXUA 3G711 4NOZA 1YI21 2QEX1 4A3DI 1NUIA 5IT9f 3FQMA 3CME1 5FLXb 1YHQZ 2R93I 4NBFA 4NBBA 2JNYA 2QRCB 2JUBA 4DGLA 2V45A 4NH1C 1YJNZ 2OTLZ 1N8R2 3KIHA 2O53A 4NBHA 1Q862 2OZKA 4BY1I 1QVGY 2EGTA 5A2Qf 3CCEZ 3PO2I 2M48A 3NH5A 1R9TI 5IT9b 4EWCA 3CCL1 2IZ3A 1VQ9Z 2JIRA 4A3BI 1JJ2Z 3CCSZ 1VQOZ 1Q822 3MZLB 1QYPA 1S72Z 2K5RA 1FDIA 2QA41 3GKQA 4DK1A 3PO3S 1YIT1 1KC81 1VQ61 1K8A1 3CCQ1 4A3GI 3CPWY 5A2Qb 3S1MI 2JIMA 3TE5B 2RIQA 1NJI1 1VQ5Z 1USPB 2V3VA 3NH4A 1VQKZ 5FLMI 1KQSY 2KPIA 1YUAA 1W2BY 4E31A 1VLAA 1K731 2GTIA 1Q812 3EERA 3NH8A 4MRIA 4QTUA 2VPXA 3S15I 2M6NA 1TFIA 3CD6Z 3HOZI 3I4NI 1ML8A 2OOYB 1ZB8A 3S16I 2NVQI 4RS4A 2HF1A 3EEDA 4E32A 1M901 4HH4A 2AYDA 1VQLZ 1RO4A 3CMA1 3VMHA 2QLVB 2E7ZA 4NBCA 5IP9I 3G4S1 1Q7Y2 2JIPA 1KRLA 2YADA 4NBDA 2OTL1 4MONA 5FLXf 2HU9A 3G6E1 4A3KI 1VQ7Z 1WCMI 3J81b 3IFUA 1SFOI 1Q16A 1KD12 3HOXI 2PK7A 5D1PA 3J80f 5AN9F 4A3MI 3CC7Z 3NFZA 1YJ91 1K9M1 1VQMZ 4Y7NI
chains in the Genus database with same CATH topology
3D9XA 1QVFY 2E2II 3I56Z 3PO3I 3S2DI 1VQ8Z 1VQPZ 2QR1B 3CQZI 1VQ51 2QRDB 3CC41 2E2HI 3ESWA 3CCRZ 3J80b 2OTJ1 3VB9A 2K3RA 3H0GI 3KIFA 2ZAEB 3CCV1 1DL6A 3GTPI 4E2WA 1S7MA 2NVTI 2JR6A 1YIJZ 3CPWZ 2DE5A 1VQNZ 5T6BA 3GTJI 2WAQA 1YJW1 3GTQI 1M1K1 3CD61 4MD8A 3GTMS 3I55Z 3JAMf 5IP7I 2QKDA 4XX2A 1VQ41 1KQSZ 2PMZA 1Z03A 4RV9A 1W2BZ 3CCM1 1WIIA 3CXCZ 2J6AA 3OW2Y 4TNUA 2W04A 1Z01A 3CCJ1 3S14I 1YI2Z 4NFRA 2QEXZ 3BG0B 2G2KA 3RZDI 3GTLI 3CMEZ 3F3PC 4BY7I 4A3LI 4DQYB 4MD9A 1Q7Y1 3FKII 4CL1A 3JAMb 3GTKI 4X6AI 1L1OC 2V8JA 1N2FA 1X3ZA 3HKZA 1TWFI 2B63I 3HOVI 4NBGA 2VUMI 4E2ZA 4AYBA 3J81f 1Y1VI 1TWGI 3GTOI 3MZKB 3CCLZ 4A3CI 1YHQ1 1KC82 1K83I 2RBLA 3F3FC 1K8A2 5T64A 2QA4Z 4RVHA 2VUGA 1ZH1A 1VQ6Z 4NBAA 4RVFA 1NJI2 3M3YI 2RPRA 1YJN1 3CCQZ 1USPA 2JA6I 5C4JI 5C3EI 3CCE1 1N8R1 1RNIA 1Q861 3FQQA 1ZB9A 1Y1VS 2Y0SA 2F4MA 3MONA 1VQ91 3CCS1 2Q4ZA 3S2HI 1K732 1VQO1 4HGZA 2JA8I 1S721 4MH4A 2WB1A 1Q821 4NB9A 3U50C 3D6WA 2OOXB 2GTHA 4HGYA 3I4MI 4MD7A 3Q87A 2E9HA 5C44I 1QVGZ 3GCFA 3T4NB 3GTMI 1TWAI 1M902 2R92I 1VQK1 4RVDA 1Z02A 2NVXI 2BJOA 5C4XI 3M4OI 2IZ4A 3CMAZ 3S1QI 2DE7A 2LIYA 3NDIA 3G4SZ 3NDJA 4NBEA 2R7ZI 4BBSI 1TWCI 1Q811 3CCUZ 3G6EZ 1RO2A 2NVYI 3CC2Z 3OW2Z 4E33A 2W03A 4A3EI 1WW9A 2VF1A 4RVGA 3I07A 1K9M2 3GTGI 1X0TA 1VQL1 5D1OB 3S1RI 1YJ9Z 2F4OA 1PFTA 3G71Z 4BXXI 5CM2M 4E2XA 4NB8A 4QTTA 3IF8A 1JJ2Y 3VMIA 3K7AI 2LFUA 1VQ71 2JA7I 2RT9A 3CC4Z 4Y52I 2JS4A 2KI7B 3J7A4 3HOWI 2OTJZ 3S17I 2O4HA 1Y1WI 2P3YA 4E30A 3RZOI 1RQFA 1I50I 4A3II 4A3FI 2GU2A 3CC71 2AKLA 2JMOA 4S1TA 3CXCY 1KD11 1I6HI 4A3JI 1P9NA 1YUKA 1NP6A 3CCVZ 2QREB 1VQM1 1M1K2 2R6MA 2YU9I 1X3WA 1TWHI 3I561 3H3VJ 1YJWZ 3VTNA 1YITZ 1VQ81 2I3CA 1VQP1 1QF8A 3P5JB 1RLYA 3CCR1 2P28A 1VQ4Z 2E2JI 5D1OA 3CCMZ 2V8KA 1RO0A 3LUSA 3S1NI 3CCJZ 3HOUI 4E2YA 5T67A 1YIJ1 1QVFZ 1I3QI 2V8IA 1VQN1 1JWHC 3CCU1 4BBRI 3CC21 2PM9A 2H85A 4A93I 1LQLA 3I551 2RHBA 3VMGA 2Q51A 3IX0A 2DE6A 3BG1B 5LL6f 3TDHB 3QWUA 2JA5I 3HOYI 4MXUA 3G711 4NOZA 1YI21 2QEX1 4A3DI 1NUIA 5IT9f 3FQMA 3CME1 5FLXb 1YHQZ 2R93I 4NBFA 4NBBA 2JNYA 2QRCB 2JUBA 4DGLA 4NH1C 1YJNZ 2OTLZ 1N8R2 3KIHA 2O53A 4NBHA 1Q862 2OZKA 4BY1I 1QVGY 2EGTA 5A2Qf 3CCEZ 3PO2I 2M48A 3NH5A 1R9TI 5IT9b 4EWCA 3CCL1 2IZ3A 1VQ9Z 4A3BI 1JJ2Z 3CCSZ 1VQOZ 1Q822 3MZLB 1QYPA 1S72Z 2K5RA 2QA41 3GKQA 4DK1A 3PO3S 1YIT1 1KC81 1VQ61 1K8A1 3CCQ1 4A3GI 3CPWY 5A2Qb 3S1MI 3TE5B 2RIQA 1NJI1 1VQ5Z 1USPB 3NH4A 1VQKZ 5FLMI 1KQSY 2KPIA 1YUAA 1W2BY 4E31A 1VLAA 1K731 2GTIA 1Q812 3EERA 3NH8A 4MRIA 4QTUA 3S15I 2M6NA 1TFIA 3CD6Z 3HOZI 3I4NI 1ML8A 2OOYB 1ZB8A 3S16I 2NVQI 4RS4A 2HF1A 3EEDA 4E32A 1M901 4HH4A 1VQLZ 1RO4A 3CMA1 3VMHA 2QLVB 4NBCA 5IP9I 3G4S1 1Q7Y2 1KRLA 2YADA 4NBDA 2OTL1 4MONA 5FLXf 2HU9A 3G6E1 4A3KI 1VQ7Z 1WCMI 3J81b 3IFUA 1SFOI 1KD12 3HOXI 2PK7A 5D1PA 3J80f 5AN9F 4A3MI 3CC7Z 3NFZA 1YJ91 1K9M1 1VQMZ 4Y7NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 I;  4A3B I;  1Y1W I;  1USP A;  2P3Y A;  2JA6 I;  1QYP A;  3RZO I;  2K5R A;  1I50 I;  4A3I I;  4A3F I;  2E2I I;  2AKL A;  3PO3 I;  5C4J I;  5C3E I;  1I6H I;  3S2D I;  3GKQ A;  4A3J I;  3PO3 S;  3CQZ I;  1ZB9 A;  1Y1V S;  2E2H I;  2F4M A;  3ESW A;  4A3G I;  3S2H I;  3S1M I;  2YU9 I;  1X3W A;  2JA8 I;  1TWH I;  3VB9 A;  3H0G I;  3H3V J;  1USP B;  4MH4 A;  3U50 C;  4NB9 A;  3GTP I;  1DL6 A;  2NVT I;  1RLY A;  3D6W A;  2JR6 A;  5FLM I;  2KPI A;  2E2J I;  1YUA A;  2DE5 A;  3I4M I;  3Q87 A;  5C44 I;  3GTJ I;  1VLA A;  3GCF A;  3GTQ I;  3GTM I;  1TWA I;  3GTM S;  2R92 I;  3LUS A;  3S1N I;  3HOU I;  3EER A;  2NVX I;  2BJO A;  5C4X I;  5IP7 I;  4XX2 A;  4QTU A;  1I3Q I;  3M4O I;  3S15 I;  3S1Q I;  1TFI A;  2J6A A;  2DE7 A;  4BBR I;  3HOZ I;  4A93 I;  1LQL A;  3VMG A;  3I4N I;  1ML8 A;  3S14 I;  4NBE A;  1ZB8 A;  2DE6 A;  2R7Z I;  3S16 I;  3RZD I;  2NVQ I;  3GTL I;  4BBS I;  2HF1 A;  4BY7 I;  4A3L I;  2JA5 I;  1TWC I;  1RO4 A;  3HOY I;  2NVY I;  3FKI I;  3VMH A;  4NBC A;  5IP9 I;  3GTK I;  4NOZ A;  4A3E I;  4X6A I;  1L1O C;  1WW9 A;  4A3D I;  1N2F A;  1X3Z A;  4NBD A;  1NUI A;  1TWF I;  2B63 I;  3I07 A;  2R93 I;  3HOV I;  3GTG I;  4NBG A;  4A3K I;  4NBF A;  3S1R I;  1WCM I;  2VUM I;  4NBB A;  2F4O A;  1PFT A;  2JNY A;  4BXX I;  5CM2 M;  1SFO I;  1Y1V I;  1TWG I;  3GTO I;  4NB8 A;  4QTT A;  3VMI A;  3HOX I;  4A3C I;  2PK7 A;  4NBH A;  1K83 I;  3K7A I;  2RBL A;  4BY1 I;  4A3M I;  3PO2 I;  2JA7 I;  1R9T I;  4NBA A;  4Y52 I;  3M3Y I;  4Y7N I;  2JS4 A;  3HOW I; 
#chains in the Genus database with same CATH topology
 3D9X A;  1QVF Y;  2E2I I;  3I56 Z;  3PO3 I;  3D2L A;  3S2D I;  1VQ8 Z;  1VQP Z;  2QR1 B;  3CQZ I;  1VQ5 1;  2QRD B;  3CC4 1;  2E2H I;  3ESW A;  3CCR Z;  3J80 b;  2OTJ 1;  3VB9 A;  2K3R A;  3H0G I;  3KIF A;  2ZAE B;  3CCV 1;  1DL6 A;  3GTP I;  4E2W A;  1S7M A;  2VPW A;  2NVT I;  2JR6 A;  1YIJ Z;  3CPW Z;  2DE5 A;  1VQN Z;  5T6B A;  3GTJ I;  2WAQ A;  1YJW 1;  3GTQ I;  1M1K 1;  3CD6 1;  4MD8 A;  3GTM S;  3I55 Z;  2NAP A;  3JAM f;  5IP7 I;  2QKD A;  4XX2 A;  1Y8C A;  1VQ4 1;  1KQS Z;  2PMZ A;  1Z03 A;  4RV9 A;  1W2B Z;  3CCM 1;  1WII A;  3CXC Z;  2J6A A;  3OW2 Y;  4TNU A;  2W04 A;  1Z01 A;  3CCJ 1;  3S14 I;  1YI2 Z;  4NFR A;  2QEX Z;  1SIW A;  3BG0 B;  2G2K A;  3RZD I;  3GTL I;  3CME Z;  3F3P C;  4BY7 I;  4A3L I;  4DQY B;  4MD9 A;  1Q7Y 1;  3FKI I;  4CL1 A;  3JAM b;  3GTK I;  4X6A I;  1L1O C;  2V8J A;  1N2F A;  1X3Z A;  3HKZ A;  3IR7 A;  1TWF I;  2B63 I;  3HOV I;  4NBG A;  2VUM I;  4E2Z A;  4AYB A;  3J81 f;  1Y1V I;  1TWG I;  3GTO I;  3MZK B;  3CCL Z;  4A3C I;  1YHQ 1;  1KC8 2;  1K83 I;  2RBL A;  2VPY A;  3F3F C;  1K8A 2;  5T64 A;  2QA4 Z;  4RVH A;  2VUG A;  1ZH1 A;  1VQ6 Z;  4NBA A;  4RVF A;  1NJI 2;  3M3Y I;  2RPR A;  1YJN 1;  3CCQ Z;  1FDO A;  1USP A;  2JA6 I;  5C4J I;  5C3E I;  3CCE 1;  1N8R 1;  1RNI A;  1Q86 1;  3FQQ A;  1ZB9 A;  1Y1V S;  2Y0S A;  2F4M A;  3MON A;  1VQ9 1;  3CCS 1;  2Q4Z A;  3S2H I;  1K73 2;  1VQO 1;  4HGZ A;  2JA8 I;  1S72 1;  4MH4 A;  2WB1 A;  1Q82 1;  4NB9 A;  3U50 C;  3D6W A;  2OOX B;  2GTH A;  2LEX A;  4HGY A;  3I4M I;  4MD7 A;  3Q87 A;  2E9H A;  5C44 I;  1QVG Z;  3GCF A;  3T4N B;  3GTM I;  1TWA I;  1M90 2;  2R92 I;  1VQK 1;  4RVD A;  1Z02 A;  2NVX I;  2BJO A;  5C4X I;  1WJ2 A;  3M4O I;  2IZ4 A;  3CMA Z;  3S1Q I;  2DE7 A;  2LIY A;  3NDI A;  3G4S Z;  3NDJ A;  4NBE A;  2R7Z I;  4BBS I;  1TWC I;  1Q81 1;  3CCU Z;  3G6E Z;  1RO2 A;  2NVY I;  3CC2 Z;  3OW2 Z;  4E33 A;  2W03 A;  4A3E I;  1WW9 A;  2VF1 A;  4RVG A;  3I07 A;  1K9M 2;  3GTG I;  1X0T A;  1VQL 1;  5D1O B;  3S1R I;  2VPZ A;  1YJ9 Z;  2F4O A;  1PFT A;  3G71 Z;  4BXX I;  5CM2 M;  4E2X A;  4NB8 A;  4QTT A;  3IF8 A;  1JJ2 Y;  3VMI A;  3K7A I;  2LFU A;  1VQ7 1;  2JA7 I;  2RT9 A;  3CC4 Z;  4Y52 I;  2JS4 A;  2KI7 B;  3J7A 4;  3HOW I;  2OTJ Z;  3S17 I;  2O4H A;  1Y1W I;  2P3Y A;  4E30 A;  3RZO I;  1RQF A;  1I50 I;  1AA6 A;  4A3I I;  4A3F I;  2GU2 A;  3CC7 1;  2AKL A;  2JMO A;  4S1T A;  3CXC Y;  1KD1 1;  1I6H I;  4A3J I;  1P9N A;  1YUK A;  1NP6 A;  3CCV Z;  2QRE B;  1VQM 1;  1QXF A;  1M1K 2;  2R6M A;  2YU9 I;  1X3W A;  1TWH I;  2IV2 X;  3I56 1;  3H3V J;  1YJW Z;  3VTN A;  1YIT Z;  1VQ8 1;  2I3C A;  1VQP 1;  1QF8 A;  3P5J B;  1WZN A;  1RLY A;  2JIQ A;  3CCR 1;  2P28 A;  1VQ4 Z;  2E2J I;  5D1O A;  3CCM Z;  2V8K A;  1RO0 A;  3LUS A;  3S1N I;  3CCJ Z;  3HOU I;  4E2Y A;  5T67 A;  1YIJ 1;  1QVF Z;  1I3Q I;  2V8I A;  1VQN 1;  1JWH C;  3CCU 1;  4BBR I;  3CC2 1;  2PM9 A;  2H85 A;  4A93 I;  1LQL A;  3I55 1;  2RHB A;  3VMG A;  2JIO A;  2Q51 A;  3IX0 A;  2DE6 A;  3BG1 B;  5LL6 f;  3TDH B;  3QWU A;  2JA5 I;  3HOY I;  4MXU A;  3G71 1;  4NOZ A;  1YI2 1;  2QEX 1;  4A3D I;  1NUI A;  5IT9 f;  3FQM A;  3CME 1;  5FLX b;  1YHQ Z;  2R93 I;  4NBF A;  4NBB A;  2JNY A;  2QRC B;  2JUB A;  4DGL A;  2V45 A;  4NH1 C;  1YJN Z;  2OTL Z;  1N8R 2;  3KIH A;  2O53 A;  4NBH A;  1Q86 2;  2OZK A;  4BY1 I;  1QVG Y;  2EGT A;  5A2Q f;  3CCE Z;  3PO2 I;  2M48 A;  3NH5 A;  1R9T I;  5IT9 b;  4EWC A;  3CCL 1;  2IZ3 A;  1VQ9 Z;  2JIR A;  4A3B I;  1JJ2 Z;  3CCS Z;  1VQO Z;  1Q82 2;  3MZL B;  1QYP A;  1S72 Z;  2K5R A;  1FDI A;  2QA4 1;  3GKQ A;  4DK1 A;  3PO3 S;  1YIT 1;  1KC8 1;  1VQ6 1;  1K8A 1;  3CCQ 1;  4A3G I;  3CPW Y;  5A2Q b;  3S1M I;  2JIM A;  3TE5 B;  2RIQ A;  1NJI 1;  1VQ5 Z;  1USP B;  2V3V A;  3NH4 A;  1VQK Z;  5FLM I;  1KQS Y;  2KPI A;  1YUA A;  1W2B Y;  4E31 A;  1VLA A;  1K73 1;  2GTI A;  1Q81 2;  3EER A;  3NH8 A;  4MRI A;  4QTU A;  2VPX A;  3S15 I;  2M6N A;  1TFI A;  3CD6 Z;  3HOZ I;  3I4N I;  1ML8 A;  2OOY B;  1ZB8 A;  3S16 I;  2NVQ I;  4RS4 A;  2HF1 A;  3EED A;  4E32 A;  1M90 1;  4HH4 A;  2AYD A;  1VQL Z;  1RO4 A;  3CMA 1;  3VMH A;  2QLV B;  2E7Z A;  4NBC A;  5IP9 I;  3G4S 1;  1Q7Y 2;  2JIP A;  1KRL A;  2YAD A;  4NBD A;  2OTL 1;  4MON A;  5FLX f;  2HU9 A;  3G6E 1;  4A3K I;  1VQ7 Z;  1WCM I;  3J81 b;  3IFU A;  1SFO I;  1Q16 A;  1KD1 2;  3HOX I;  2PK7 A;  5D1P A;  3J80 f;  5AN9 F;  4A3M I;  3CC7 Z;  3NFZ A;  1YJ9 1;  1K9M 1;  1VQM Z;  4Y7N I; 
#chains in the Genus database with same CATH homology
 3D9X A;  1QVF Y;  2E2I I;  3I56 Z;  3PO3 I;  3S2D I;  1VQ8 Z;  1VQP Z;  2QR1 B;  3CQZ I;  1VQ5 1;  2QRD B;  3CC4 1;  2E2H I;  3ESW A;  3CCR Z;  3J80 b;  2OTJ 1;  3VB9 A;  2K3R A;  3H0G I;  3KIF A;  2ZAE B;  3CCV 1;  1DL6 A;  3GTP I;  4E2W A;  1S7M A;  2NVT I;  2JR6 A;  1YIJ Z;  3CPW Z;  2DE5 A;  1VQN Z;  5T6B A;  3GTJ I;  2WAQ A;  1YJW 1;  3GTQ I;  1M1K 1;  3CD6 1;  4MD8 A;  3GTM S;  3I55 Z;  3JAM f;  5IP7 I;  2QKD A;  4XX2 A;  1VQ4 1;  1KQS Z;  2PMZ A;  1Z03 A;  4RV9 A;  1W2B Z;  3CCM 1;  1WII A;  3CXC Z;  2J6A A;  3OW2 Y;  4TNU A;  2W04 A;  1Z01 A;  3CCJ 1;  3S14 I;  1YI2 Z;  4NFR A;  2QEX Z;  3BG0 B;  2G2K A;  3RZD I;  3GTL I;  3CME Z;  3F3P C;  4BY7 I;  4A3L I;  4DQY B;  4MD9 A;  1Q7Y 1;  3FKI I;  4CL1 A;  3JAM b;  3GTK I;  4X6A I;  1L1O C;  2V8J A;  1N2F A;  1X3Z A;  3HKZ A;  1TWF I;  2B63 I;  3HOV I;  4NBG A;  2VUM I;  4E2Z A;  4AYB A;  3J81 f;  1Y1V I;  1TWG I;  3GTO I;  3MZK B;  3CCL Z;  4A3C I;  1YHQ 1;  1KC8 2;  1K83 I;  2RBL A;  3F3F C;  1K8A 2;  5T64 A;  2QA4 Z;  4RVH A;  2VUG A;  1ZH1 A;  1VQ6 Z;  4NBA A;  4RVF A;  1NJI 2;  3M3Y I;  2RPR A;  1YJN 1;  3CCQ Z;  1USP A;  2JA6 I;  5C4J I;  5C3E I;  3CCE 1;  1N8R 1;  1RNI A;  1Q86 1;  3FQQ A;  1ZB9 A;  1Y1V S;  2Y0S A;  2F4M A;  3MON A;  1VQ9 1;  3CCS 1;  2Q4Z A;  3S2H I;  1K73 2;  1VQO 1;  4HGZ A;  2JA8 I;  1S72 1;  4MH4 A;  2WB1 A;  1Q82 1;  4NB9 A;  3U50 C;  3D6W A;  2OOX B;  2GTH A;  4HGY A;  3I4M I;  4MD7 A;  3Q87 A;  2E9H A;  5C44 I;  1QVG Z;  3GCF A;  3T4N B;  3GTM I;  1TWA I;  1M90 2;  2R92 I;  1VQK 1;  4RVD A;  1Z02 A;  2NVX I;  2BJO A;  5C4X I;  3M4O I;  2IZ4 A;  3CMA Z;  3S1Q I;  2DE7 A;  2LIY A;  3NDI A;  3G4S Z;  3NDJ A;  4NBE A;  2R7Z I;  4BBS I;  1TWC I;  1Q81 1;  3CCU Z;  3G6E Z;  1RO2 A;  2NVY I;  3CC2 Z;  3OW2 Z;  4E33 A;  2W03 A;  4A3E I;  1WW9 A;  2VF1 A;  4RVG A;  3I07 A;  1K9M 2;  3GTG I;  1X0T A;  1VQL 1;  5D1O B;  3S1R I;  1YJ9 Z;  2F4O A;  1PFT A;  3G71 Z;  4BXX I;  5CM2 M;  4E2X A;  4NB8 A;  4QTT A;  3IF8 A;  1JJ2 Y;  3VMI A;  3K7A I;  2LFU A;  1VQ7 1;  2JA7 I;  2RT9 A;  3CC4 Z;  4Y52 I;  2JS4 A;  2KI7 B;  3J7A 4;  3HOW I;  2OTJ Z;  3S17 I;  2O4H A;  1Y1W I;  2P3Y A;  4E30 A;  3RZO I;  1RQF A;  1I50 I;  4A3I I;  4A3F I;  2GU2 A;  3CC7 1;  2AKL A;  2JMO A;  4S1T A;  3CXC Y;  1KD1 1;  1I6H I;  4A3J I;  1P9N A;  1YUK A;  1NP6 A;  3CCV Z;  2QRE B;  1VQM 1;  1M1K 2;  2R6M A;  2YU9 I;  1X3W A;  1TWH I;  3I56 1;  3H3V J;  1YJW Z;  3VTN A;  1YIT Z;  1VQ8 1;  2I3C A;  1VQP 1;  1QF8 A;  3P5J B;  1RLY A;  3CCR 1;  2P28 A;  1VQ4 Z;  2E2J I;  5D1O A;  3CCM Z;  2V8K A;  1RO0 A;  3LUS A;  3S1N I;  3CCJ Z;  3HOU I;  4E2Y A;  5T67 A;  1YIJ 1;  1QVF Z;  1I3Q I;  2V8I A;  1VQN 1;  1JWH C;  3CCU 1;  4BBR I;  3CC2 1;  2PM9 A;  2H85 A;  4A93 I;  1LQL A;  3I55 1;  2RHB A;  3VMG A;  2Q51 A;  3IX0 A;  2DE6 A;  3BG1 B;  5LL6 f;  3TDH B;  3QWU A;  2JA5 I;  3HOY I;  4MXU A;  3G71 1;  4NOZ A;  1YI2 1;  2QEX 1;  4A3D I;  1NUI A;  5IT9 f;  3FQM A;  3CME 1;  5FLX b;  1YHQ Z;  2R93 I;  4NBF A;  4NBB A;  2JNY A;  2QRC B;  2JUB A;  4DGL A;  4NH1 C;  1YJN Z;  2OTL Z;  1N8R 2;  3KIH A;  2O53 A;  4NBH A;  1Q86 2;  2OZK A;  4BY1 I;  1QVG Y;  2EGT A;  5A2Q f;  3CCE Z;  3PO2 I;  2M48 A;  3NH5 A;  1R9T I;  5IT9 b;  4EWC A;  3CCL 1;  2IZ3 A;  1VQ9 Z;  4A3B I;  1JJ2 Z;  3CCS Z;  1VQO Z;  1Q82 2;  3MZL B;  1QYP A;  1S72 Z;  2K5R A;  2QA4 1;  3GKQ A;  4DK1 A;  3PO3 S;  1YIT 1;  1KC8 1;  1VQ6 1;  1K8A 1;  3CCQ 1;  4A3G I;  3CPW Y;  5A2Q b;  3S1M I;  3TE5 B;  2RIQ A;  1NJI 1;  1VQ5 Z;  1USP B;  3NH4 A;  1VQK Z;  5FLM I;  1KQS Y;  2KPI A;  1YUA A;  1W2B Y;  4E31 A;  1VLA A;  1K73 1;  2GTI A;  1Q81 2;  3EER A;  3NH8 A;  4MRI A;  4QTU A;  3S15 I;  2M6N A;  1TFI A;  3CD6 Z;  3HOZ I;  3I4N I;  1ML8 A;  2OOY B;  1ZB8 A;  3S16 I;  2NVQ I;  4RS4 A;  2HF1 A;  3EED A;  4E32 A;  1M90 1;  4HH4 A;  1VQL Z;  1RO4 A;  3CMA 1;  3VMH A;  2QLV B;  4NBC A;  5IP9 I;  3G4S 1;  1Q7Y 2;  1KRL A;  2YAD A;  4NBD A;  2OTL 1;  4MON A;  5FLX f;  2HU9 A;  3G6E 1;  4A3K I;  1VQ7 Z;  1WCM I;  3J81 b;  3IFU A;  1SFO I;  1KD1 2;  3HOX I;  2PK7 A;  5D1P A;  3J80 f;  5AN9 F;  4A3M I;  3CC7 Z;  3NFZ A;  1YJ9 1;  1K9M 1;  1VQM Z;  4Y7N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...