3HOZI

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hozI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hozI02
3U50C 2J6AA 2JNYA 3LUSA 2DE7A 1R9TI 5IP7I 2HF1A 3CQZI 1WW9A 2E2II 4A3GI 4NB8A 4NBDA 1ZB8A 4A3MI 4BY7I 4Y52I 4X6AI 2R92I 2YU9I 3GCFA 4BBRI 2VUMI 2JA8I 3M4OI 2B63I 1USPA 3GTLI 1TWFI 3GTMI 3GTOI 1Y1VI 1I50I 2BJOA 3I4NI 4A3CI 3PO3I 3H3VJ 3RZDI 1PFTA 5C4JI 2E2JI 3I07A 3M3YI 1ML8A 4QTUA 1RO4A 2JR6A 5C4XI 1USPB 3I4MI 4BXXI 4BY1I 4A93I 2R7ZI 4A3JI 1LQLA 3S17I 1TWCI 2NVXI 1K83I 4NBAA 1TWAI 4A3BI 2AKLA 3HOZI 3FKII 1ZB9A 3VMIA 5CM2M 2KPIA 1I3QI 4NBBA 3HOXI 4A3KI 4NB9A 2DE6A 3VMGA 4NBEA 1WCMI 3S14I 2R93I 5FLMI 1YUAA 1RLYA 2NVYI 4NOZA 2JA6I 1SFOI 1I6HI 3K7AI 3GTGI 5C44I 1QYPA 1L1OC 2F4MA 3D6WA 3Q87A 4Y7NI 1Y1VS 3GTKI 3GTMS 3RZOI 1DL6A 2DE5A 2K5RA 3ESWA 4NBCA 1X3ZA 2JS4A 3GTPI 3HOVI 3GTJI 3H0GI 3VB9A 3VMHA 3S2HI 1N2FA 3S2DI 3GTQI 3S1QI 2JA7I 3S1MI 4NBGA 3HOUI 4MH4A 4A3LI 2JA5I 3HOYI 3S16I 4QTTA 4NBFA 4A3II 1VLAA 4BBSI 2RBLA 2NVTI 4NBHA 3GKQA 1X3WA 3S1RI 1TWHI 1TWGI 2PK7A 4A3EI 3HOWI 4XX2A 4A3FI 1Y1WI 5C3EI 3PO2I 2F4OA 2P3YA 2E2HI 3EERA 1NUIA 2NVQI 3S15I 4A3DI 3S1NI 5IP9I 3PO3S 1TFIA
chains in the Genus database with same CATH superfamily
1VQMZ 2JNYA 4MD8A 3LUSA 1Q7Y1 2VPXA 3OW2Z 1VQP1 3CQZI 4A3GI 2QEX1 2YADA 4NB8A 4Y52I 4A3MI 2O4HA 3FQQA 4TNUA 2JIOA 2VUMI 1VQKZ 3M4OI 4RVDA 1TWFI 3GTMI 2M48A 1Y1VI 1VQ4Z 2PM9A 1YJ91 1RNIA 3CXCZ 1KRLA 4S1TA 3H3VJ 1M1K1 3CCJ1 1RO0A 2QA4Z 4RVGA 3CC4Z 3CD61 1K8A2 1NP6A 1W2BY 2LEXA 3TDHB 2JR6A 1JJ2Z 1USPB 3I4MI 2VF1A 5A2Qf 2R7ZI 1VQOZ 2WAQA 3S17I 1TWCI 2VUGA 4E2XA 1K83I 5LL6f 4NBAA 5T6BA 2WB1A 3VMIA 1VQLZ 5FLXf 1Q7Y2 3HOXI 4E31A 3EEDA 3NDIA 3I561 1YUAA 2NVYI 4NOZA 3CME1 1VQN1 2GU2A 1WZNA 2VPYA 1Q861 1DL6A 2DE5A 2K5RA 4MONA 1YIT1 1YJW1 2E7ZA 3J81f 3S1QI 3CCR1 2ZAEB 2JA5I 3CMAZ 3HOYI 2OOXB 4NBFA 2NVTI 2QLVB 3NDJA 1X3WA 3J7A4 1WIIA 2IZ3A 3HOWI 1VQ71 4XX2A 3G4SZ 3F3PC 3PO2I 2M6NA 4E2YA 2E2HI 3CCS1 1NUIA 2NVQI 3JAMf 3CCVZ 5T64A 1R9TI 3J80f 2HF1A 5T67A 2E2II 2OTLZ 1S721 1S7MA 4NBDA 4BY7I 4RS4A 1Q862 2R92I 2OTJZ 3CCMZ 3TE5B 1VQ51 3GTLI 1YI2Z 3I55Z 4HGYA 1KQSZ 4MD9A 1K9M1 3PO3I 3KIFA 2E2JI 3I07A 2KI7B 5C4XI 2P28A 1M901 4BY1I 1FDIA 2GTIA 1YHQ1 3VTNA 1VQ8Z 1KD11 3CCU1 1TWAI 3D9XA 4A3BI 3HOZI 2KPIA 3G71Z 1VQ9Z 4NB9A 1Z03A 1YJN1 3VMGA 1VQM1 1WJ2A 2R93I 4RV9A 4E2WA 3IX0A 1QVGY 3MZLB 1P9NA 5C44I 1QYPA 3GTMS 3RZOI 3D6WA 1Y1VS 3IR7A 3NFZA 3IF8A 2V8KA 5FLXb 1VQK1 2QRCB 3GTJI 3H0GI 3VB9A 3VMHA 3CPWZ 2RPRA 1K9M2 3S2DI 2JA7I 4NBGA 1VQ41 2GTHA 1Q16A 4QTTA 1K731 1YIJZ 3FQMA 2RBLA 3NH8A 1FDOA 1QVFZ 2QA41 3CC41 1M902 2QKDA 3CCQZ 2PK7A 1KD12 3J81b 2OOYB 3OW2Y 1VQO1 2LFUA 4E30A 2J6AA 2Q4ZA 2JIPA 2NAPA 1JWHC 1VQL1 2DE7A 5D1OB 3CCEZ 5IP7I 1WW9A 1YUKA 5D1PA 3CC2Z 5D1OA 3G6EZ 3GCFA 4BBRI 2LIYA 2JA8I 2JUBA 3JAMb 4E2ZA 3BG0B 3CXCY 3GTOI 4E32A 2BJOA 3NH4A 3I4NI 4E33A 3CCLZ 3CC7Z 1VQ6Z 4HH4A 4A3CI 3J80b 3RZDI 1K732 1PFTA 1JJ2Y 2V8IA 3M3YI 2R6MA 2QREB 1ML8A 3CMA1 2H85A 2EGTA 4MRIA 2W04A 4BXXI 1QVGZ 4NH1C 2QRDB 1W2BZ 2AKLA 4CL1A 3FKII 1N8R1 3G4S1 5CM2M 1VQPZ 1Q812 1AA6A 2RIQA 4NBBA 2QEXZ 4NBEA 1WCMI 5FLMI 3CCV1 5IT9f 4MXUA 4MD7A 1RLYA 2JA6I 1I6HI 1QXFA 3MZKB 4EWCA 2OTL1 2F4MA 4NFRA 2Y0SA 3ESWA 2I3CA 4NBCA 2JS4A 1QF8A 3NH5A 1YJ9Z 2OTJ1 3CCM1 4AYBA 2O53A 1YI21 2W03A 3CCJZ 3CD6Z 3I551 1Q821 3S1MI 4DK1A 4MH4A 4RVHA 3S16I 4A3II 1VLAA 4NBHA 3KIHA 2IV2X 3GKQA 1TWHI 5A2Qb 1TWGI 4A3EI 4A3FI 1Y1WI 2VPZA 2F4OA 2P3YA 1ZH1A 1RQFA 4A3DI 3S15I 1N8R2 5IP9I 2VPWA 3U50C 1VQ81 3P5JB 3I56Z 3CMEZ 4DGLA 3G711 1VQ91 1VQNZ 2HU9A 3QWUA 2OZKA 1SIWA 1ZB8A 3HKZA 4X6AI 1YITZ 2YU9I 1YJWZ 2B63I 1KQSY 2G2KA 1USPA 2V45A 2PMZA 3CCRZ 1I50I 2V3VA 1Q822 1Z02A 1Q811 5C4JI 1VQ7Z 4QTUA 1RO4A 1KC81 1YIJ1 3CCSZ 4A93I 1NJI1 4A3JI 1LQLA 2E9HA 2NVXI 3CCQ1 1X0TA 1ZB9A 1I3QI 1M1K2 5AN9F 4A3KI 3T4NB 2DE6A 2K3RA 2RHBA 1S72Z 3S14I 2IZ4A 2JIMA 4RVFA 3D2LA 3CCE1 4HGZA 1SFOI 3K7AI 3GTGI 1VQ5Z 4Y7NI 1L1OC 3Q87A 3MONA 3GTKI 3BG1B 3CC21 3G6E1 3CPWY 2JIRA 3F3FC 1X3ZA 3GTPI 3HOVI 2V8JA 2AYDA 2JIQA 3S2HI 1N2FA 3GTQI 1RO2A 3HOUI 1Z01A 5IT9b 4A3LI 3CCL1 3CC71 1QVFY 1VQ61 2RT9A 4BBSI 1K8A1 4DQYB 2Q51A 1YHQZ 1KC82 3S1RI 3CCUZ 1Y8CA 1NJI2 2QR1B 5C3EI 2JMOA 3IFUA 3EERA 3S1NI 1YJNZ 3PO3S 1TFIA
chains in the Genus database with same CATH topology
1VQMZ 2JNYA 4MD8A 3LUSA 1Q7Y1 3OW2Z 1VQP1 3CQZI 4A3GI 2QEX1 2YADA 4NB8A 4Y52I 4A3MI 2O4HA 3FQQA 4TNUA 2VUMI 1VQKZ 3M4OI 4RVDA 1TWFI 3GTMI 2M48A 1Y1VI 1VQ4Z 2PM9A 1YJ91 1RNIA 3CXCZ 1KRLA 4S1TA 3H3VJ 1M1K1 3CCJ1 1RO0A 2QA4Z 4RVGA 3CC4Z 3CD61 1K8A2 1NP6A 1W2BY 3TDHB 2JR6A 1JJ2Z 1USPB 3I4MI 2VF1A 5A2Qf 2R7ZI 1VQOZ 2WAQA 3S17I 1TWCI 2VUGA 4E2XA 1K83I 5LL6f 4NBAA 5T6BA 2WB1A 3VMIA 1VQLZ 5FLXf 1Q7Y2 3HOXI 4E31A 3EEDA 3NDIA 3I561 1YUAA 2NVYI 4NOZA 3CME1 1VQN1 2GU2A 1Q861 1DL6A 2DE5A 2K5RA 4MONA 1YIT1 1YJW1 3J81f 3S1QI 3CCR1 2ZAEB 2JA5I 3CMAZ 3HOYI 2OOXB 4NBFA 2NVTI 2QLVB 3NDJA 1X3WA 3J7A4 1WIIA 2IZ3A 3HOWI 1VQ71 4XX2A 3G4SZ 3F3PC 3PO2I 2M6NA 4E2YA 2E2HI 3CCS1 1NUIA 2NVQI 3JAMf 3CCVZ 5T64A 1R9TI 3J80f 2HF1A 5T67A 2E2II 2OTLZ 1S721 1S7MA 4NBDA 4BY7I 4RS4A 1Q862 2R92I 2OTJZ 3CCMZ 3TE5B 1VQ51 3GTLI 1YI2Z 3I55Z 4HGYA 1KQSZ 4MD9A 1K9M1 3PO3I 3KIFA 2E2JI 3I07A 2KI7B 5C4XI 2P28A 1M901 4BY1I 2GTIA 1YHQ1 3VTNA 1VQ8Z 1KD11 3CCU1 1TWAI 3D9XA 4A3BI 3HOZI 2KPIA 3G71Z 1VQ9Z 4NB9A 1Z03A 1YJN1 3VMGA 1VQM1 2R93I 4RV9A 4E2WA 3IX0A 1QVGY 3MZLB 1P9NA 5C44I 1QYPA 3GTMS 3RZOI 3D6WA 1Y1VS 3NFZA 3IF8A 2V8KA 5FLXb 1VQK1 2QRCB 3GTJI 3H0GI 3VB9A 3VMHA 3CPWZ 2RPRA 1K9M2 3S2DI 2JA7I 4NBGA 1VQ41 2GTHA 1K731 4QTTA 1YIJZ 3FQMA 2RBLA 3NH8A 1QVFZ 2QA41 3CC41 1M902 2QKDA 3CCQZ 2PK7A 1KD12 3J81b 2OOYB 3OW2Y 1VQO1 2LFUA 4E30A 2J6AA 2Q4ZA 1JWHC 1VQL1 2DE7A 5D1OB 3CCEZ 5IP7I 1WW9A 1YUKA 5D1PA 3CC2Z 5D1OA 3G6EZ 3GCFA 4BBRI 2LIYA 2JA8I 2JUBA 3JAMb 4E2ZA 3BG0B 3CXCY 3GTOI 4E32A 2BJOA 3NH4A 3I4NI 4E33A 3CCLZ 3CC7Z 1VQ6Z 4HH4A 4A3CI 3J80b 3RZDI 1K732 1PFTA 1JJ2Y 2V8IA 3M3YI 2R6MA 2QREB 1ML8A 3CMA1 2H85A 2EGTA 4MRIA 2W04A 4BXXI 1QVGZ 4NH1C 2QRDB 1W2BZ 2AKLA 4CL1A 3FKII 1N8R1 3G4S1 5CM2M 1VQPZ 1Q812 2RIQA 4NBBA 2QEXZ 4NBEA 1WCMI 5FLMI 3CCV1 5IT9f 4MXUA 4MD7A 1RLYA 2JA6I 1I6HI 3MZKB 4EWCA 2OTL1 2F4MA 4NFRA 2Y0SA 3ESWA 2I3CA 4NBCA 2JS4A 1QF8A 3NH5A 1YJ9Z 2OTJ1 3CCM1 4AYBA 2O53A 1YI21 2W03A 3CCJZ 3CD6Z 3I551 1Q821 3S1MI 4DK1A 4MH4A 4RVHA 3S16I 4A3II 1VLAA 4NBHA 3KIHA 3GKQA 1TWHI 5A2Qb 1TWGI 4A3EI 4A3FI 1Y1WI 2F4OA 2P3YA 1ZH1A 1RQFA 4A3DI 3S15I 1N8R2 5IP9I 3U50C 1VQ81 3P5JB 3I56Z 3CMEZ 4DGLA 3G711 1VQ91 1VQNZ 2HU9A 3QWUA 2OZKA 1ZB8A 3HKZA 4X6AI 1YITZ 2YU9I 1YJWZ 2B63I 1KQSY 2G2KA 1USPA 2PMZA 3CCRZ 1I50I 1Q822 1Z02A 1Q811 5C4JI 1VQ7Z 4QTUA 1RO4A 1KC81 1YIJ1 3CCSZ 4A93I 1NJI1 4A3JI 1LQLA 2E9HA 2NVXI 3CCQ1 1X0TA 1ZB9A 1I3QI 1M1K2 5AN9F 4A3KI 3T4NB 2DE6A 2K3RA 2RHBA 1S72Z 3S14I 2IZ4A 4RVFA 3CCE1 4HGZA 1SFOI 3K7AI 3GTGI 1VQ5Z 4Y7NI 1L1OC 3Q87A 3MONA 3GTKI 3BG1B 3CC21 3G6E1 3CPWY 3F3FC 1X3ZA 3GTPI 3HOVI 2V8JA 3S2HI 1N2FA 3GTQI 1RO2A 3HOUI 1Z01A 5IT9b 4A3LI 3CCL1 3CC71 1QVFY 1VQ61 2RT9A 4BBSI 1K8A1 4DQYB 2Q51A 1YHQZ 1KC82 3S1RI 3CCUZ 1NJI2 2QR1B 5C3EI 2JMOA 3IFUA 3EERA 3S1NI 1YJNZ 3PO3S 1TFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U50 C;  2J6A A;  2JNY A;  3LUS A;  2DE7 A;  1R9T I;  5IP7 I;  2HF1 A;  3CQZ I;  1WW9 A;  2E2I I;  4A3G I;  4NB8 A;  4NBD A;  1ZB8 A;  4A3M I;  4BY7 I;  4Y52 I;  4X6A I;  2R92 I;  2YU9 I;  3GCF A;  4BBR I;  2VUM I;  2JA8 I;  3M4O I;  2B63 I;  1USP A;  3GTL I;  1TWF I;  3GTM I;  3GTO I;  1Y1V I;  1I50 I;  2BJO A;  3I4N I;  4A3C I;  3PO3 I;  3H3V J;  3RZD I;  1PFT A;  5C4J I;  2E2J I;  3I07 A;  3M3Y I;  1ML8 A;  4QTU A;  1RO4 A;  2JR6 A;  5C4X I;  1USP B;  3I4M I;  4BXX I;  4BY1 I;  4A93 I;  2R7Z I;  4A3J I;  1LQL A;  3S17 I;  1TWC I;  2NVX I;  1K83 I;  4NBA A;  1TWA I;  4A3B I;  2AKL A;  3HOZ I;  3FKI I;  1ZB9 A;  3VMI A;  5CM2 M;  2KPI A;  1I3Q I;  4NBB A;  3HOX I;  4A3K I;  4NB9 A;  2DE6 A;  3VMG A;  4NBE A;  1WCM I;  3S14 I;  2R93 I;  5FLM I;  1YUA A;  1RLY A;  2NVY I;  4NOZ A;  2JA6 I;  1SFO I;  1I6H I;  3K7A I;  3GTG I;  5C44 I;  1QYP A;  1L1O C;  2F4M A;  3D6W A;  3Q87 A;  4Y7N I;  1Y1V S;  3GTK I;  3GTM S;  3RZO I;  1DL6 A;  2DE5 A;  2K5R A;  3ESW A;  4NBC A;  1X3Z A;  2JS4 A;  3GTP I;  3HOV I;  3GTJ I;  3H0G I;  3VB9 A;  3VMH A;  3S2H I;  1N2F A;  3S2D I;  3GTQ I;  3S1Q I;  2JA7 I;  3S1M I;  4NBG A;  3HOU I;  4MH4 A;  4A3L I;  2JA5 I;  3HOY I;  3S16 I;  4QTT A;  4NBF A;  4A3I I;  1VLA A;  4BBS I;  2RBL A;  2NVT I;  4NBH A;  3GKQ A;  1X3W A;  3S1R I;  1TWH I;  1TWG I;  2PK7 A;  4A3E I;  3HOW I;  4XX2 A;  4A3F I;  1Y1W I;  5C3E I;  3PO2 I;  2F4O A;  2P3Y A;  2E2H I;  3EER A;  1NUI A;  2NVQ I;  3S15 I;  4A3D I;  3S1N I;  5IP9 I;  3PO3 S;  1TFI A; 
#chains in the Genus database with same CATH topology
 1VQM Z;  2JNY A;  4MD8 A;  3LUS A;  1Q7Y 1;  2VPX A;  3OW2 Z;  1VQP 1;  3CQZ I;  4A3G I;  2QEX 1;  2YAD A;  4NB8 A;  4Y52 I;  4A3M I;  2O4H A;  3FQQ A;  4TNU A;  2JIO A;  2VUM I;  1VQK Z;  3M4O I;  4RVD A;  1TWF I;  3GTM I;  2M48 A;  1Y1V I;  1VQ4 Z;  2PM9 A;  1YJ9 1;  1RNI A;  3CXC Z;  1KRL A;  4S1T A;  3H3V J;  1M1K 1;  3CCJ 1;  1RO0 A;  2QA4 Z;  4RVG A;  3CC4 Z;  3CD6 1;  1K8A 2;  1NP6 A;  1W2B Y;  2LEX A;  3TDH B;  2JR6 A;  1JJ2 Z;  1USP B;  3I4M I;  2VF1 A;  5A2Q f;  2R7Z I;  1VQO Z;  2WAQ A;  3S17 I;  1TWC I;  2VUG A;  4E2X A;  1K83 I;  5LL6 f;  4NBA A;  5T6B A;  2WB1 A;  3VMI A;  1VQL Z;  5FLX f;  1Q7Y 2;  3HOX I;  4E31 A;  3EED A;  3NDI A;  3I56 1;  1YUA A;  2NVY I;  4NOZ A;  3CME 1;  1VQN 1;  2GU2 A;  1WZN A;  2VPY A;  1Q86 1;  1DL6 A;  2DE5 A;  2K5R A;  4MON A;  1YIT 1;  1YJW 1;  2E7Z A;  3J81 f;  3S1Q I;  3CCR 1;  2ZAE B;  2JA5 I;  3CMA Z;  3HOY I;  2OOX B;  4NBF A;  2NVT I;  2QLV B;  3NDJ A;  1X3W A;  3J7A 4;  1WII A;  2IZ3 A;  3HOW I;  1VQ7 1;  4XX2 A;  3G4S Z;  3F3P C;  3PO2 I;  2M6N A;  4E2Y A;  2E2H I;  3CCS 1;  1NUI A;  2NVQ I;  3JAM f;  3CCV Z;  5T64 A;  1R9T I;  3J80 f;  2HF1 A;  5T67 A;  2E2I I;  2OTL Z;  1S72 1;  1S7M A;  4NBD A;  4BY7 I;  4RS4 A;  1Q86 2;  2R92 I;  2OTJ Z;  3CCM Z;  3TE5 B;  1VQ5 1;  3GTL I;  1YI2 Z;  3I55 Z;  4HGY A;  1KQS Z;  4MD9 A;  1K9M 1;  3PO3 I;  3KIF A;  2E2J I;  3I07 A;  2KI7 B;  5C4X I;  2P28 A;  1M90 1;  4BY1 I;  1FDI A;  2GTI A;  1YHQ 1;  3VTN A;  1VQ8 Z;  1KD1 1;  3CCU 1;  1TWA I;  3D9X A;  4A3B I;  3HOZ I;  2KPI A;  3G71 Z;  1VQ9 Z;  4NB9 A;  1Z03 A;  1YJN 1;  3VMG A;  1VQM 1;  1WJ2 A;  2R93 I;  4RV9 A;  4E2W A;  3IX0 A;  1QVG Y;  3MZL B;  1P9N A;  5C44 I;  1QYP A;  3GTM S;  3RZO I;  3D6W A;  1Y1V S;  3IR7 A;  3NFZ A;  3IF8 A;  2V8K A;  5FLX b;  1VQK 1;  2QRC B;  3GTJ I;  3H0G I;  3VB9 A;  3VMH A;  3CPW Z;  2RPR A;  1K9M 2;  3S2D I;  2JA7 I;  4NBG A;  1VQ4 1;  2GTH A;  1Q16 A;  4QTT A;  1K73 1;  1YIJ Z;  3FQM A;  2RBL A;  3NH8 A;  1FDO A;  1QVF Z;  2QA4 1;  3CC4 1;  1M90 2;  2QKD A;  3CCQ Z;  2PK7 A;  1KD1 2;  3J81 b;  2OOY B;  3OW2 Y;  1VQO 1;  2LFU A;  4E30 A;  2J6A A;  2Q4Z A;  2JIP A;  2NAP A;  1JWH C;  1VQL 1;  2DE7 A;  5D1O B;  3CCE Z;  5IP7 I;  1WW9 A;  1YUK A;  5D1P A;  3CC2 Z;  5D1O A;  3G6E Z;  3GCF A;  4BBR I;  2LIY A;  2JA8 I;  2JUB A;  3JAM b;  4E2Z A;  3BG0 B;  3CXC Y;  3GTO I;  4E32 A;  2BJO A;  3NH4 A;  3I4N I;  4E33 A;  3CCL Z;  3CC7 Z;  1VQ6 Z;  4HH4 A;  4A3C I;  3J80 b;  3RZD I;  1K73 2;  1PFT A;  1JJ2 Y;  2V8I A;  3M3Y I;  2R6M A;  2QRE B;  1ML8 A;  3CMA 1;  2H85 A;  2EGT A;  4MRI A;  2W04 A;  4BXX I;  1QVG Z;  4NH1 C;  2QRD B;  1W2B Z;  2AKL A;  4CL1 A;  3FKI I;  1N8R 1;  3G4S 1;  5CM2 M;  1VQP Z;  1Q81 2;  1AA6 A;  2RIQ A;  4NBB A;  2QEX Z;  4NBE A;  1WCM I;  5FLM I;  3CCV 1;  5IT9 f;  4MXU A;  4MD7 A;  1RLY A;  2JA6 I;  1I6H I;  1QXF A;  3MZK B;  4EWC A;  2OTL 1;  2F4M A;  4NFR A;  2Y0S A;  3ESW A;  2I3C A;  4NBC A;  2JS4 A;  1QF8 A;  3NH5 A;  1YJ9 Z;  2OTJ 1;  3CCM 1;  4AYB A;  2O53 A;  1YI2 1;  2W03 A;  3CCJ Z;  3CD6 Z;  3I55 1;  1Q82 1;  3S1M I;  4DK1 A;  4MH4 A;  4RVH A;  3S16 I;  4A3I I;  1VLA A;  4NBH A;  3KIH A;  2IV2 X;  3GKQ A;  1TWH I;  5A2Q b;  1TWG I;  4A3E I;  4A3F I;  1Y1W I;  2VPZ A;  2F4O A;  2P3Y A;  1ZH1 A;  1RQF A;  4A3D I;  3S15 I;  1N8R 2;  5IP9 I;  2VPW A;  3U50 C;  1VQ8 1;  3P5J B;  3I56 Z;  3CME Z;  4DGL A;  3G71 1;  1VQ9 1;  1VQN Z;  2HU9 A;  3QWU A;  2OZK A;  1SIW A;  1ZB8 A;  3HKZ A;  4X6A I;  1YIT Z;  2YU9 I;  1YJW Z;  2B63 I;  1KQS Y;  2G2K A;  1USP A;  2V45 A;  2PMZ A;  3CCR Z;  1I50 I;  2V3V A;  1Q82 2;  1Z02 A;  1Q81 1;  5C4J I;  1VQ7 Z;  4QTU A;  1RO4 A;  1KC8 1;  1YIJ 1;  3CCS Z;  4A93 I;  1NJI 1;  4A3J I;  1LQL A;  2E9H A;  2NVX I;  3CCQ 1;  1X0T A;  1ZB9 A;  1I3Q I;  1M1K 2;  5AN9 F;  4A3K I;  3T4N B;  2DE6 A;  2K3R A;  2RHB A;  1S72 Z;  3S14 I;  2IZ4 A;  2JIM A;  4RVF A;  3D2L A;  3CCE 1;  4HGZ A;  1SFO I;  3K7A I;  3GTG I;  1VQ5 Z;  4Y7N I;  1L1O C;  3Q87 A;  3MON A;  3GTK I;  3BG1 B;  3CC2 1;  3G6E 1;  3CPW Y;  2JIR A;  3F3F C;  1X3Z A;  3GTP I;  3HOV I;  2V8J A;  2AYD A;  2JIQ A;  3S2H I;  1N2F A;  3GTQ I;  1RO2 A;  3HOU I;  1Z01 A;  5IT9 b;  4A3L I;  3CCL 1;  3CC7 1;  1QVF Y;  1VQ6 1;  2RT9 A;  4BBS I;  1K8A 1;  4DQY B;  2Q51 A;  1YHQ Z;  1KC8 2;  3S1R I;  3CCU Z;  1Y8C A;  1NJI 2;  2QR1 B;  5C3E I;  2JMO A;  3IFU A;  3EER A;  3S1N I;  1YJN Z;  3PO3 S;  1TFI A; 
#chains in the Genus database with same CATH homology
 1VQM Z;  2JNY A;  4MD8 A;  3LUS A;  1Q7Y 1;  3OW2 Z;  1VQP 1;  3CQZ I;  4A3G I;  2QEX 1;  2YAD A;  4NB8 A;  4Y52 I;  4A3M I;  2O4H A;  3FQQ A;  4TNU A;  2VUM I;  1VQK Z;  3M4O I;  4RVD A;  1TWF I;  3GTM I;  2M48 A;  1Y1V I;  1VQ4 Z;  2PM9 A;  1YJ9 1;  1RNI A;  3CXC Z;  1KRL A;  4S1T A;  3H3V J;  1M1K 1;  3CCJ 1;  1RO0 A;  2QA4 Z;  4RVG A;  3CC4 Z;  3CD6 1;  1K8A 2;  1NP6 A;  1W2B Y;  3TDH B;  2JR6 A;  1JJ2 Z;  1USP B;  3I4M I;  2VF1 A;  5A2Q f;  2R7Z I;  1VQO Z;  2WAQ A;  3S17 I;  1TWC I;  2VUG A;  4E2X A;  1K83 I;  5LL6 f;  4NBA A;  5T6B A;  2WB1 A;  3VMI A;  1VQL Z;  5FLX f;  1Q7Y 2;  3HOX I;  4E31 A;  3EED A;  3NDI A;  3I56 1;  1YUA A;  2NVY I;  4NOZ A;  3CME 1;  1VQN 1;  2GU2 A;  1Q86 1;  1DL6 A;  2DE5 A;  2K5R A;  4MON A;  1YIT 1;  1YJW 1;  3J81 f;  3S1Q I;  3CCR 1;  2ZAE B;  2JA5 I;  3CMA Z;  3HOY I;  2OOX B;  4NBF A;  2NVT I;  2QLV B;  3NDJ A;  1X3W A;  3J7A 4;  1WII A;  2IZ3 A;  3HOW I;  1VQ7 1;  4XX2 A;  3G4S Z;  3F3P C;  3PO2 I;  2M6N A;  4E2Y A;  2E2H I;  3CCS 1;  1NUI A;  2NVQ I;  3JAM f;  3CCV Z;  5T64 A;  1R9T I;  3J80 f;  2HF1 A;  5T67 A;  2E2I I;  2OTL Z;  1S72 1;  1S7M A;  4NBD A;  4BY7 I;  4RS4 A;  1Q86 2;  2R92 I;  2OTJ Z;  3CCM Z;  3TE5 B;  1VQ5 1;  3GTL I;  1YI2 Z;  3I55 Z;  4HGY A;  1KQS Z;  4MD9 A;  1K9M 1;  3PO3 I;  3KIF A;  2E2J I;  3I07 A;  2KI7 B;  5C4X I;  2P28 A;  1M90 1;  4BY1 I;  2GTI A;  1YHQ 1;  3VTN A;  1VQ8 Z;  1KD1 1;  3CCU 1;  1TWA I;  3D9X A;  4A3B I;  3HOZ I;  2KPI A;  3G71 Z;  1VQ9 Z;  4NB9 A;  1Z03 A;  1YJN 1;  3VMG A;  1VQM 1;  2R93 I;  4RV9 A;  4E2W A;  3IX0 A;  1QVG Y;  3MZL B;  1P9N A;  5C44 I;  1QYP A;  3GTM S;  3RZO I;  3D6W A;  1Y1V S;  3NFZ A;  3IF8 A;  2V8K A;  5FLX b;  1VQK 1;  2QRC B;  3GTJ I;  3H0G I;  3VB9 A;  3VMH A;  3CPW Z;  2RPR A;  1K9M 2;  3S2D I;  2JA7 I;  4NBG A;  1VQ4 1;  2GTH A;  1K73 1;  4QTT A;  1YIJ Z;  3FQM A;  2RBL A;  3NH8 A;  1QVF Z;  2QA4 1;  3CC4 1;  1M90 2;  2QKD A;  3CCQ Z;  2PK7 A;  1KD1 2;  3J81 b;  2OOY B;  3OW2 Y;  1VQO 1;  2LFU A;  4E30 A;  2J6A A;  2Q4Z A;  1JWH C;  1VQL 1;  2DE7 A;  5D1O B;  3CCE Z;  5IP7 I;  1WW9 A;  1YUK A;  5D1P A;  3CC2 Z;  5D1O A;  3G6E Z;  3GCF A;  4BBR I;  2LIY A;  2JA8 I;  2JUB A;  3JAM b;  4E2Z A;  3BG0 B;  3CXC Y;  3GTO I;  4E32 A;  2BJO A;  3NH4 A;  3I4N I;  4E33 A;  3CCL Z;  3CC7 Z;  1VQ6 Z;  4HH4 A;  4A3C I;  3J80 b;  3RZD I;  1K73 2;  1PFT A;  1JJ2 Y;  2V8I A;  3M3Y I;  2R6M A;  2QRE B;  1ML8 A;  3CMA 1;  2H85 A;  2EGT A;  4MRI A;  2W04 A;  4BXX I;  1QVG Z;  4NH1 C;  2QRD B;  1W2B Z;  2AKL A;  4CL1 A;  3FKI I;  1N8R 1;  3G4S 1;  5CM2 M;  1VQP Z;  1Q81 2;  2RIQ A;  4NBB A;  2QEX Z;  4NBE A;  1WCM I;  5FLM I;  3CCV 1;  5IT9 f;  4MXU A;  4MD7 A;  1RLY A;  2JA6 I;  1I6H I;  3MZK B;  4EWC A;  2OTL 1;  2F4M A;  4NFR A;  2Y0S A;  3ESW A;  2I3C A;  4NBC A;  2JS4 A;  1QF8 A;  3NH5 A;  1YJ9 Z;  2OTJ 1;  3CCM 1;  4AYB A;  2O53 A;  1YI2 1;  2W03 A;  3CCJ Z;  3CD6 Z;  3I55 1;  1Q82 1;  3S1M I;  4DK1 A;  4MH4 A;  4RVH A;  3S16 I;  4A3I I;  1VLA A;  4NBH A;  3KIH A;  3GKQ A;  1TWH I;  5A2Q b;  1TWG I;  4A3E I;  4A3F I;  1Y1W I;  2F4O A;  2P3Y A;  1ZH1 A;  1RQF A;  4A3D I;  3S15 I;  1N8R 2;  5IP9 I;  3U50 C;  1VQ8 1;  3P5J B;  3I56 Z;  3CME Z;  4DGL A;  3G71 1;  1VQ9 1;  1VQN Z;  2HU9 A;  3QWU A;  2OZK A;  1ZB8 A;  3HKZ A;  4X6A I;  1YIT Z;  2YU9 I;  1YJW Z;  2B63 I;  1KQS Y;  2G2K A;  1USP A;  2PMZ A;  3CCR Z;  1I50 I;  1Q82 2;  1Z02 A;  1Q81 1;  5C4J I;  1VQ7 Z;  4QTU A;  1RO4 A;  1KC8 1;  1YIJ 1;  3CCS Z;  4A93 I;  1NJI 1;  4A3J I;  1LQL A;  2E9H A;  2NVX I;  3CCQ 1;  1X0T A;  1ZB9 A;  1I3Q I;  1M1K 2;  5AN9 F;  4A3K I;  3T4N B;  2DE6 A;  2K3R A;  2RHB A;  1S72 Z;  3S14 I;  2IZ4 A;  4RVF A;  3CCE 1;  4HGZ A;  1SFO I;  3K7A I;  3GTG I;  1VQ5 Z;  4Y7N I;  1L1O C;  3Q87 A;  3MON A;  3GTK I;  3BG1 B;  3CC2 1;  3G6E 1;  3CPW Y;  3F3F C;  1X3Z A;  3GTP I;  3HOV I;  2V8J A;  3S2H I;  1N2F A;  3GTQ I;  1RO2 A;  3HOU I;  1Z01 A;  5IT9 b;  4A3L I;  3CCL 1;  3CC7 1;  1QVF Y;  1VQ6 1;  2RT9 A;  4BBS I;  1K8A 1;  4DQY B;  2Q51 A;  1YHQ Z;  1KC8 2;  3S1R I;  3CCU Z;  1NJI 2;  2QR1 B;  5C3E I;  2JMO A;  3IFU A;  3EER A;  3S1N I;  1YJN Z;  3PO3 S;  1TFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...