3HOZI

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription,transferase/dna/rna hybrid
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hozI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hozI02
4NB8A 4NB9A 1N2FA 3D6WA 4A3DI 1Y1VI 1X3ZA 4Y7NI 2JR6A 3ESWA 4X6AI 3HOUI 3M3YI 3HOVI 4A3LI 4A93I 4BY1I 1RO4A 3S15I 3PO3S 2DE7A 1ZB9A 1I6HI 4A3BI 3CQZI 1TWCI 2JA6I 2JNYA 3HOZI 3HOXI 5IP7I 4A3II 3S2DI 1I3QI 3S1RI 1Y1WI 3GTGI 1USPB 5IP9I 1USPA 3K7AI 2NVXI 4BXXI 1SFOI 3FKII 1X3WA 2RBLA 2R92I 1PFTA 1LQLA 4BBRI 3LUSA 4A3JI 3S17I 2BJOA 2PK7A 1NUIA 2B63I 3GTKI 1TFIA 3GCFA 1Y1VS 3HOYI 3GTOI 2NVQI 3S1MI 4QTTA 3I4NI 2F4MA 3HOWI 3VMHA 4NBAA 3GTQI 4BBSI 4MH4A 3GTJI 4A3CI 1TWHI 3GKQA 3PO2I 2E2HI 4NBDA 2E2II 3RZOI 2K5RA 4Y52I 3GTMI 4BY7I 2J6AA 1WCMI 2AKLA 5C4XI 2JA5I 2F4OA 2NVTI 2KPIA 4NBFA 5C44I 4A3GI 2DE5A 5FLMI 3Q87A 4NBBA 3GTPI 2DE6A 3H0GI 3VB9A 5CM2M 1K83I 3I4MI 4NBGA 1RLYA 3M4OI 3S1QI 1VLAA 3I07A 1R9TI 4A3EI 2NVYI 5C3EI 1I50I 4NBEA 3S1NI 4NBCA 2JS4A 3S14I 3PO3I 1QYPA 1ZB8A 3S2HI 2R7ZI 4NBHA 3H3VJ 2JA8I 2VUMI 4A3FI 3EERA 3RZDI 2YU9I 3U50C 3VMGA 3S16I 4A3MI 1WW9A 1DL6A 1L1OC 2JA7I 4XX2A 4A3KI 1TWGI 1TWAI 2P3YA 5C4JI 2HF1A 4NOZA 1TWFI 1ML8A 3GTMS 1YUAA 4QTUA 3VMIA 2E2JI 3GTLI 2R93I
chains in the Genus database with same CATH superfamily
4NB8A 2JIMA 1WJ2A 3HOUI 3CCQZ 1YHQZ 5AN9F 3G4SZ 3HOVI 4A3LI 1WZNA 4MD7A 1Z02A 3CCU1 1Q821 4RS4A 3G6EZ 4A3BI 2IZ4A 5IP7I 3JAMf 2QRDB 5IP9I 3J7A4 3FKII 2R92I 1KD11 1PFTA 1M1K1 1VQNZ 2BJOA 1Q861 3MZLB 1VQ4Z 1TFIA 2V8IA 1Q16A 1JJ2Z 5FLXf 2IV2X 3I4NI 4HGZA 1YHQ1 3I561 1K8A2 4NBAA 2PM9A 4BBSI 3NDJA 1RO0A 3GTJI 3KIHA 4MXUA 1QVGZ 4NBDA 2OOYB 2E2II 1KC82 2K5RA 3T4NB 2OTJZ 1KD12 2AKLA 1VQP1 2OTJ1 3CC21 5C44I 4A3GI 2M48A 2QA41 4NBBA 2WB1A 3GTPI 1RQFA 2DE6A 3H0GI 3J81f 1YJNZ 1AA6A 3I4MI 4RV9A 3M4OI 1VQ9Z 2R6MA 2O4HA 2NAPA 3S1NI 3S14I 2V45A 1QYPA 4NBHA 2JA8I 2VUMI 4RVDA 1KRLA 2VUGA 2RT9A 3NH8A 1Q862 4A3MI 1DL6A 4XX2A 4A3KI 1TWGI 1TWFI 2H85A 2OOXB 1YUAA 3VMIA 2I3CA 1KQSY 3GTLI 1FDOA 4RVFA 2W04A 1X0TA 2JIOA 4MD9A 4Y7NI 3ESWA 4X6AI 3MONA 4DQYB 1Q812 3CCE1 4A93I 4BY1I 1RO4A 3CD61 3PO3S 2DE7A 2M6NA 3CCSZ 3CCL1 2JA6I 3G711 2JNYA 1VQPZ 5A2Qb 1I3QI 3GTGI 1USPB 4E2XA 1Z01A 2JMOA 3CCJZ 2NVXI 4BXXI 1S7MA 1VQ81 2Y0SA 2QREB 2RBLA 3CMA1 4NFRA 1LQLA 1YJWZ 3D9XA 4AYBA 2VPZA 1YJW1 4A3JI 2PK7A 1VQN1 2B63I 3GTKI 1QVFY 4NH1C 4HGYA 4MRIA 3HOYI 3OW2Z 4QTTA 3G71Z 3HOWI 3VMHA 4DGLA 2OTL1 4EWCA 1TWHI 3NDIA 3IX0A 4RVGA 2LIYA 3JAMb 2E2HI 3PO2I 2O53A 1VQ5Z 2ZAEB 2J6AA 5C4XI 2JA5I 1VQK1 1VQ41 2V8JA 1W2BZ 2P28A 1W2BY 2GU2A 3F3PC 3CCQ1 2V8KA 4S1TA 1RLYA 1VLAA 3CXCY 3VTNA 1RO2A 1R9TI 2NVYI 4HH4A 5C3EI 1I50I 2JS4A 3J80f 3PO3I 1M1K2 3S2HI 2R7ZI 1P9NA 4A3FI 3EERA 2QRCB 2QR1B 3S16I 1Z03A 2QLVB 2Q4ZA 1WW9A 1VQO1 4E2YA 2JA7I 2P3YA 1YI21 1Y8CA 3GTMS 2KI7B 4E31A 2QA4Z 2K3RA 3QWUA 4A3DI 1X3ZA 1K731 3D2LA 2JR6A 3KIFA 1VQ8Z 3M3YI 2OTLZ 1S721 1QXFA 3S15I 1NJI2 1I6HI 3HOZI 1K9M1 3S2DI 3S1RI 3CCEZ 3K7AI 1Q7Y2 2VPXA 3FQQA 3CCJ1 1X3WA 1QVFZ 3CMAZ 1NJI1 1N8R1 1KC81 3CCMZ 3LUSA 3CCR1 2VPWA 3I551 1VQ7Z 1Y1VS 2GTHA 2RIQA 1QVGY 2NVQI 3S1MI 2F4MA 1SIWA 5T64A 3MZKB 2LEXA 2VPYA 2QEX1 2OZKA 3CCVZ 3J81b 1Q811 4Y52I 3CCV1 3GTMI 1WCMI 3BG1B 2KPIA 2PMZA 2DE5A 5FLMI 3IR7A 2QKDA 3Q87A 4MONA 1K9M2 1QF8A 1YJN1 2Q51A 3VB9A 2IZ3A 5CM2M 1VQ51 3NH5A 5T6BA 2JIPA 1VQL1 5IT9f 3CC2Z 4A3EI 3CCRZ 3CME1 3CC71 4NBEA 4NBCA 3I55Z 1ZB8A 1K8A1 3H3VJ 2V3VA 1VQM1 3NFZA 3I56Z 2YU9I 3CC4Z 5T67A 1YJ9Z 2JUBA 1YJ91 2VF1A 1YUKA 2LFUA 2HF1A 4NOZA 1ML8A 2EGTA 3TDHB 4QTUA 3CPWZ 2E2JI 4MD8A 3J80b 3CMEZ 1YIJ1 4NB9A 4E33A 1YIJZ 1M902 1N2FA 1N8R2 3D6WA 1Y1VI 4E30A 3IFUA 3BG0B 1Q7Y1 3CCUZ 5LL6f 1YI2Z 1ZB9A 3CQZI 3TE5B 1TWCI 1VQMZ 3G4S1 3HOXI 4A3II 1JJ2Y 1VQKZ 1Y1WI 1VQ61 4DK1A 1USPA 5D1OA 2YADA 1YIT1 1SFOI 3P5JB 4BBRI 4CL1A 3CCS1 1WIIA 3S17I 3FQMA 4E2WA 3CD6Z 1NUIA 2JIRA 5IT9b 1VQ71 3GCFA 3EEDA 3GTOI 1YITZ 2W03A 3G6E1 2E7ZA 2GTIA 4RVHA 1VQ6Z 3CCM1 1VQ91 5D1PA 3GTQI 1KQSZ 4MH4A 4A3CI 2QEXZ 3GKQA 3OW2Y 2RHBA 3RZOI 4BY7I 1JWHC 2F4OA 2NVTI 4NBFA 1FDIA 2WAQA 3CXCZ 1NP6A 2E9HA 3HKZA 4TNUA 1K732 1RNIA 1K83I 2HU9A 4NBGA 3S1QI 3NH4A 3I07A 5D1OB 3F3FC 2RPRA 5FLXb 4E2ZA 2AYDA 2G2KA 2JIQA 3RZDI 3CC41 3IF8A 3U50C 3VMGA 1M901 1Q822 1S72Z 3CPWY 1L1OC 3CC7Z 4E32A 1VQOZ 1TWAI 5A2Qf 5C4JI 3CCLZ 1VQLZ 1ZH1A 2R93I
chains in the Genus database with same CATH topology
4NB8A 3HOUI 3CCQZ 1YHQZ 5AN9F 3G4SZ 3HOVI 4A3LI 4MD7A 1Z02A 3CCU1 1Q821 4RS4A 3G6EZ 4A3BI 2IZ4A 5IP7I 3JAMf 2QRDB 5IP9I 3J7A4 3FKII 2R92I 1KD11 1PFTA 1M1K1 1VQNZ 2BJOA 1Q861 3MZLB 1VQ4Z 1TFIA 2V8IA 1JJ2Z 5FLXf 3I4NI 4HGZA 1YHQ1 3I561 1K8A2 4NBAA 2PM9A 4BBSI 3NDJA 1RO0A 3GTJI 3KIHA 4MXUA 1QVGZ 4NBDA 2OOYB 2E2II 1KC82 2K5RA 3T4NB 2OTJZ 1KD12 2AKLA 1VQP1 2OTJ1 3CC21 5C44I 4A3GI 2M48A 2QA41 4NBBA 2WB1A 3GTPI 1RQFA 2DE6A 3H0GI 3J81f 1YJNZ 3I4MI 4RV9A 3M4OI 1VQ9Z 2R6MA 2O4HA 3S1NI 3S14I 1QYPA 4NBHA 2JA8I 2VUMI 4RVDA 1KRLA 2VUGA 2RT9A 3NH8A 1Q862 4A3MI 1DL6A 4XX2A 4A3KI 1TWGI 1TWFI 2H85A 2OOXB 1YUAA 3VMIA 2I3CA 1KQSY 3GTLI 4RVFA 2W04A 1X0TA 4MD9A 4Y7NI 3ESWA 4X6AI 3MONA 4DQYB 1Q812 3CCE1 4A93I 4BY1I 1RO4A 3CD61 3PO3S 2DE7A 2M6NA 3CCSZ 3CCL1 2JA6I 3G711 2JNYA 1VQPZ 5A2Qb 1I3QI 3GTGI 1USPB 4E2XA 1Z01A 2JMOA 3CCJZ 2NVXI 4BXXI 1S7MA 1VQ81 2Y0SA 2QREB 2RBLA 3CMA1 4NFRA 1LQLA 1YJWZ 3D9XA 4AYBA 1YJW1 4A3JI 2PK7A 1VQN1 2B63I 3GTKI 1QVFY 4NH1C 4HGYA 4MRIA 3HOYI 3OW2Z 4QTTA 3G71Z 3HOWI 3VMHA 4DGLA 2OTL1 4EWCA 1TWHI 3NDIA 3IX0A 4RVGA 2LIYA 3JAMb 2E2HI 3PO2I 2O53A 1VQ5Z 2ZAEB 2J6AA 5C4XI 2JA5I 1VQK1 1VQ41 2V8JA 1W2BZ 2P28A 1W2BY 2GU2A 3F3PC 3CCQ1 2V8KA 4S1TA 1RLYA 1VLAA 3CXCY 3VTNA 1RO2A 1R9TI 2NVYI 4HH4A 5C3EI 1I50I 2JS4A 3J80f 3PO3I 1M1K2 3S2HI 2R7ZI 1P9NA 4A3FI 3EERA 2QRCB 2QR1B 3S16I 1Z03A 2QLVB 2Q4ZA 1WW9A 1VQO1 4E2YA 2JA7I 2P3YA 1YI21 3GTMS 2KI7B 4E31A 2QA4Z 2K3RA 3QWUA 4A3DI 1X3ZA 1K731 2JR6A 3KIFA 1VQ8Z 3M3YI 2OTLZ 1S721 3S15I 1NJI2 1I6HI 3HOZI 1K9M1 3S2DI 3S1RI 3CCEZ 3K7AI 1Q7Y2 3FQQA 3CCJ1 1X3WA 1QVFZ 3CMAZ 1NJI1 1N8R1 1KC81 3CCMZ 3LUSA 3CCR1 3I551 1VQ7Z 1Y1VS 2GTHA 2RIQA 1QVGY 2NVQI 3S1MI 2F4MA 5T64A 3MZKB 2QEX1 2OZKA 3CCVZ 3J81b 1Q811 4Y52I 3CCV1 3GTMI 1WCMI 3BG1B 2KPIA 2PMZA 2DE5A 5FLMI 2QKDA 3Q87A 4MONA 1K9M2 1QF8A 1YJN1 2Q51A 3VB9A 2IZ3A 5CM2M 1VQ51 3NH5A 5T6BA 1VQL1 5IT9f 3CC2Z 4A3EI 3CCRZ 3CME1 3CC71 4NBEA 4NBCA 3I55Z 1ZB8A 1K8A1 3H3VJ 1VQM1 3NFZA 3I56Z 2YU9I 3CC4Z 5T67A 1YJ9Z 2JUBA 1YJ91 2VF1A 1YUKA 2LFUA 2HF1A 4NOZA 1ML8A 2EGTA 3TDHB 4QTUA 3CPWZ 2E2JI 4MD8A 3J80b 3CMEZ 1YIJ1 4NB9A 4E33A 1YIJZ 1M902 1N2FA 1N8R2 3D6WA 1Y1VI 4E30A 3IFUA 3BG0B 1Q7Y1 3CCUZ 5LL6f 1YI2Z 1ZB9A 3CQZI 3TE5B 1TWCI 1VQMZ 3G4S1 3HOXI 4A3II 1JJ2Y 1VQKZ 1Y1WI 1VQ61 4DK1A 1USPA 5D1OA 2YADA 1YIT1 1SFOI 3P5JB 4BBRI 4CL1A 3CCS1 1WIIA 3S17I 3FQMA 4E2WA 3CD6Z 1NUIA 5IT9b 1VQ71 3GCFA 3EEDA 3GTOI 1YITZ 2W03A 3G6E1 2GTIA 4RVHA 1VQ6Z 3CCM1 1VQ91 5D1PA 3GTQI 1KQSZ 4MH4A 4A3CI 2QEXZ 3GKQA 3OW2Y 2RHBA 3RZOI 4BY7I 1JWHC 2F4OA 2NVTI 4NBFA 2WAQA 3CXCZ 1NP6A 2E9HA 3HKZA 1K732 4TNUA 1RNIA 1K83I 2HU9A 4NBGA 3S1QI 3NH4A 3I07A 5D1OB 3F3FC 2RPRA 5FLXb 4E2ZA 2G2KA 3RZDI 3CC41 3IF8A 3U50C 3VMGA 1M901 1Q822 1S72Z 3CPWY 1L1OC 3CC7Z 4E32A 1VQOZ 1TWAI 5A2Qf 5C4JI 3CCLZ 1VQLZ 1ZH1A 2R93I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB8 A;  4NB9 A;  1N2F A;  3D6W A;  4A3D I;  1Y1V I;  1X3Z A;  4Y7N I;  2JR6 A;  3ESW A;  4X6A I;  3HOU I;  3M3Y I;  3HOV I;  4A3L I;  4A93 I;  4BY1 I;  1RO4 A;  3S15 I;  3PO3 S;  2DE7 A;  1ZB9 A;  1I6H I;  4A3B I;  3CQZ I;  1TWC I;  2JA6 I;  2JNY A;  3HOZ I;  3HOX I;  5IP7 I;  4A3I I;  3S2D I;  1I3Q I;  3S1R I;  1Y1W I;  3GTG I;  1USP B;  5IP9 I;  1USP A;  3K7A I;  2NVX I;  4BXX I;  1SFO I;  3FKI I;  1X3W A;  2RBL A;  2R92 I;  1PFT A;  1LQL A;  4BBR I;  3LUS A;  4A3J I;  3S17 I;  2BJO A;  2PK7 A;  1NUI A;  2B63 I;  3GTK I;  1TFI A;  3GCF A;  1Y1V S;  3HOY I;  3GTO I;  2NVQ I;  3S1M I;  4QTT A;  3I4N I;  2F4M A;  3HOW I;  3VMH A;  4NBA A;  3GTQ I;  4BBS I;  4MH4 A;  3GTJ I;  4A3C I;  1TWH I;  3GKQ A;  3PO2 I;  2E2H I;  4NBD A;  2E2I I;  3RZO I;  2K5R A;  4Y52 I;  3GTM I;  4BY7 I;  2J6A A;  1WCM I;  2AKL A;  5C4X I;  2JA5 I;  2F4O A;  2NVT I;  2KPI A;  4NBF A;  5C44 I;  4A3G I;  2DE5 A;  5FLM I;  3Q87 A;  4NBB A;  3GTP I;  2DE6 A;  3H0G I;  3VB9 A;  5CM2 M;  1K83 I;  3I4M I;  4NBG A;  1RLY A;  3M4O I;  3S1Q I;  1VLA A;  3I07 A;  1R9T I;  4A3E I;  2NVY I;  5C3E I;  1I50 I;  4NBE A;  3S1N I;  4NBC A;  2JS4 A;  3S14 I;  3PO3 I;  1QYP A;  1ZB8 A;  3S2H I;  2R7Z I;  4NBH A;  3H3V J;  2JA8 I;  2VUM I;  4A3F I;  3EER A;  3RZD I;  2YU9 I;  3U50 C;  3VMG A;  3S16 I;  4A3M I;  1WW9 A;  1DL6 A;  1L1O C;  2JA7 I;  4XX2 A;  4A3K I;  1TWG I;  1TWA I;  2P3Y A;  5C4J I;  2HF1 A;  4NOZ A;  1TWF I;  1ML8 A;  3GTM S;  1YUA A;  4QTU A;  3VMI A;  2E2J I;  3GTL I;  2R93 I; 
#chains in the Genus database with same CATH topology
 4NB8 A;  2JIM A;  1WJ2 A;  3HOU I;  3CCQ Z;  1YHQ Z;  5AN9 F;  3G4S Z;  3HOV I;  4A3L I;  1WZN A;  4MD7 A;  1Z02 A;  3CCU 1;  1Q82 1;  4RS4 A;  3G6E Z;  4A3B I;  2IZ4 A;  5IP7 I;  3JAM f;  2QRD B;  5IP9 I;  3J7A 4;  3FKI I;  2R92 I;  1KD1 1;  1PFT A;  1M1K 1;  1VQN Z;  2BJO A;  1Q86 1;  3MZL B;  1VQ4 Z;  1TFI A;  2V8I A;  1Q16 A;  1JJ2 Z;  5FLX f;  2IV2 X;  3I4N I;  4HGZ A;  1YHQ 1;  3I56 1;  1K8A 2;  4NBA A;  2PM9 A;  4BBS I;  3NDJ A;  1RO0 A;  3GTJ I;  3KIH A;  4MXU A;  1QVG Z;  4NBD A;  2OOY B;  2E2I I;  1KC8 2;  2K5R A;  3T4N B;  2OTJ Z;  1KD1 2;  2AKL A;  1VQP 1;  2OTJ 1;  3CC2 1;  5C44 I;  4A3G I;  2M48 A;  2QA4 1;  4NBB A;  2WB1 A;  3GTP I;  1RQF A;  2DE6 A;  3H0G I;  3J81 f;  1YJN Z;  1AA6 A;  3I4M I;  4RV9 A;  3M4O I;  1VQ9 Z;  2R6M A;  2O4H A;  2NAP A;  3S1N I;  3S14 I;  2V45 A;  1QYP A;  4NBH A;  2JA8 I;  2VUM I;  4RVD A;  1KRL A;  2VUG A;  2RT9 A;  3NH8 A;  1Q86 2;  4A3M I;  1DL6 A;  4XX2 A;  4A3K I;  1TWG I;  1TWF I;  2H85 A;  2OOX B;  1YUA A;  3VMI A;  2I3C A;  1KQS Y;  3GTL I;  1FDO A;  4RVF A;  2W04 A;  1X0T A;  2JIO A;  4MD9 A;  4Y7N I;  3ESW A;  4X6A I;  3MON A;  4DQY B;  1Q81 2;  3CCE 1;  4A93 I;  4BY1 I;  1RO4 A;  3CD6 1;  3PO3 S;  2DE7 A;  2M6N A;  3CCS Z;  3CCL 1;  2JA6 I;  3G71 1;  2JNY A;  1VQP Z;  5A2Q b;  1I3Q I;  3GTG I;  1USP B;  4E2X A;  1Z01 A;  2JMO A;  3CCJ Z;  2NVX I;  4BXX I;  1S7M A;  1VQ8 1;  2Y0S A;  2QRE B;  2RBL A;  3CMA 1;  4NFR A;  1LQL A;  1YJW Z;  3D9X A;  4AYB A;  2VPZ A;  1YJW 1;  4A3J I;  2PK7 A;  1VQN 1;  2B63 I;  3GTK I;  1QVF Y;  4NH1 C;  4HGY A;  4MRI A;  3HOY I;  3OW2 Z;  4QTT A;  3G71 Z;  3HOW I;  3VMH A;  4DGL A;  2OTL 1;  4EWC A;  1TWH I;  3NDI A;  3IX0 A;  4RVG A;  2LIY A;  3JAM b;  2E2H I;  3PO2 I;  2O53 A;  1VQ5 Z;  2ZAE B;  2J6A A;  5C4X I;  2JA5 I;  1VQK 1;  1VQ4 1;  2V8J A;  1W2B Z;  2P28 A;  1W2B Y;  2GU2 A;  3F3P C;  3CCQ 1;  2V8K A;  4S1T A;  1RLY A;  1VLA A;  3CXC Y;  3VTN A;  1RO2 A;  1R9T I;  2NVY I;  4HH4 A;  5C3E I;  1I50 I;  2JS4 A;  3J80 f;  3PO3 I;  1M1K 2;  3S2H I;  2R7Z I;  1P9N A;  4A3F I;  3EER A;  2QRC B;  2QR1 B;  3S16 I;  1Z03 A;  2QLV B;  2Q4Z A;  1WW9 A;  1VQO 1;  4E2Y A;  2JA7 I;  2P3Y A;  1YI2 1;  1Y8C A;  3GTM S;  2KI7 B;  4E31 A;  2QA4 Z;  2K3R A;  3QWU A;  4A3D I;  1X3Z A;  1K73 1;  3D2L A;  2JR6 A;  3KIF A;  1VQ8 Z;  3M3Y I;  2OTL Z;  1S72 1;  1QXF A;  3S15 I;  1NJI 2;  1I6H I;  3HOZ I;  1K9M 1;  3S2D I;  3S1R I;  3CCE Z;  3K7A I;  1Q7Y 2;  2VPX A;  3FQQ A;  3CCJ 1;  1X3W A;  1QVF Z;  3CMA Z;  1NJI 1;  1N8R 1;  1KC8 1;  3CCM Z;  3LUS A;  3CCR 1;  2VPW A;  3I55 1;  1VQ7 Z;  1Y1V S;  2GTH A;  2RIQ A;  1QVG Y;  2NVQ I;  3S1M I;  2F4M A;  1SIW A;  5T64 A;  3MZK B;  2LEX A;  2VPY A;  2QEX 1;  2OZK A;  3CCV Z;  3J81 b;  1Q81 1;  4Y52 I;  3CCV 1;  3GTM I;  1WCM I;  3BG1 B;  2KPI A;  2PMZ A;  2DE5 A;  5FLM I;  3IR7 A;  2QKD A;  3Q87 A;  4MON A;  1K9M 2;  1QF8 A;  1YJN 1;  2Q51 A;  3VB9 A;  2IZ3 A;  5CM2 M;  1VQ5 1;  3NH5 A;  5T6B A;  2JIP A;  1VQL 1;  5IT9 f;  3CC2 Z;  4A3E I;  3CCR Z;  3CME 1;  3CC7 1;  4NBE A;  4NBC A;  3I55 Z;  1ZB8 A;  1K8A 1;  3H3V J;  2V3V A;  1VQM 1;  3NFZ A;  3I56 Z;  2YU9 I;  3CC4 Z;  5T67 A;  1YJ9 Z;  2JUB A;  1YJ9 1;  2VF1 A;  1YUK A;  2LFU A;  2HF1 A;  4NOZ A;  1ML8 A;  2EGT A;  3TDH B;  4QTU A;  3CPW Z;  2E2J I;  4MD8 A;  3J80 b;  3CME Z;  1YIJ 1;  4NB9 A;  4E33 A;  1YIJ Z;  1M90 2;  1N2F A;  1N8R 2;  3D6W A;  1Y1V I;  4E30 A;  3IFU A;  3BG0 B;  1Q7Y 1;  3CCU Z;  5LL6 f;  1YI2 Z;  1ZB9 A;  3CQZ I;  3TE5 B;  1TWC I;  1VQM Z;  3G4S 1;  3HOX I;  4A3I I;  1JJ2 Y;  1VQK Z;  1Y1W I;  1VQ6 1;  4DK1 A;  1USP A;  5D1O A;  2YAD A;  1YIT 1;  1SFO I;  3P5J B;  4BBR I;  4CL1 A;  3CCS 1;  1WII A;  3S17 I;  3FQM A;  4E2W A;  3CD6 Z;  1NUI A;  2JIR A;  5IT9 b;  1VQ7 1;  3GCF A;  3EED A;  3GTO I;  1YIT Z;  2W03 A;  3G6E 1;  2E7Z A;  2GTI A;  4RVH A;  1VQ6 Z;  3CCM 1;  1VQ9 1;  5D1P A;  3GTQ I;  1KQS Z;  4MH4 A;  4A3C I;  2QEX Z;  3GKQ A;  3OW2 Y;  2RHB A;  3RZO I;  4BY7 I;  1JWH C;  2F4O A;  2NVT I;  4NBF A;  1FDI A;  2WAQ A;  3CXC Z;  1NP6 A;  2E9H A;  3HKZ A;  4TNU A;  1K73 2;  1RNI A;  1K83 I;  2HU9 A;  4NBG A;  3S1Q I;  3NH4 A;  3I07 A;  5D1O B;  3F3F C;  2RPR A;  5FLX b;  4E2Z A;  2AYD A;  2G2K A;  2JIQ A;  3RZD I;  3CC4 1;  3IF8 A;  3U50 C;  3VMG A;  1M90 1;  1Q82 2;  1S72 Z;  3CPW Y;  1L1O C;  3CC7 Z;  4E32 A;  1VQO Z;  1TWA I;  5A2Q f;  5C4J I;  3CCL Z;  1VQL Z;  1ZH1 A;  2R93 I; 
#chains in the Genus database with same CATH homology
 4NB8 A;  3HOU I;  3CCQ Z;  1YHQ Z;  5AN9 F;  3G4S Z;  3HOV I;  4A3L I;  4MD7 A;  1Z02 A;  3CCU 1;  1Q82 1;  4RS4 A;  3G6E Z;  4A3B I;  2IZ4 A;  5IP7 I;  3JAM f;  2QRD B;  5IP9 I;  3J7A 4;  3FKI I;  2R92 I;  1KD1 1;  1PFT A;  1M1K 1;  1VQN Z;  2BJO A;  1Q86 1;  3MZL B;  1VQ4 Z;  1TFI A;  2V8I A;  1JJ2 Z;  5FLX f;  3I4N I;  4HGZ A;  1YHQ 1;  3I56 1;  1K8A 2;  4NBA A;  2PM9 A;  4BBS I;  3NDJ A;  1RO0 A;  3GTJ I;  3KIH A;  4MXU A;  1QVG Z;  4NBD A;  2OOY B;  2E2I I;  1KC8 2;  2K5R A;  3T4N B;  2OTJ Z;  1KD1 2;  2AKL A;  1VQP 1;  2OTJ 1;  3CC2 1;  5C44 I;  4A3G I;  2M48 A;  2QA4 1;  4NBB A;  2WB1 A;  3GTP I;  1RQF A;  2DE6 A;  3H0G I;  3J81 f;  1YJN Z;  3I4M I;  4RV9 A;  3M4O I;  1VQ9 Z;  2R6M A;  2O4H A;  3S1N I;  3S14 I;  1QYP A;  4NBH A;  2JA8 I;  2VUM I;  4RVD A;  1KRL A;  2VUG A;  2RT9 A;  3NH8 A;  1Q86 2;  4A3M I;  1DL6 A;  4XX2 A;  4A3K I;  1TWG I;  1TWF I;  2H85 A;  2OOX B;  1YUA A;  3VMI A;  2I3C A;  1KQS Y;  3GTL I;  4RVF A;  2W04 A;  1X0T A;  4MD9 A;  4Y7N I;  3ESW A;  4X6A I;  3MON A;  4DQY B;  1Q81 2;  3CCE 1;  4A93 I;  4BY1 I;  1RO4 A;  3CD6 1;  3PO3 S;  2DE7 A;  2M6N A;  3CCS Z;  3CCL 1;  2JA6 I;  3G71 1;  2JNY A;  1VQP Z;  5A2Q b;  1I3Q I;  3GTG I;  1USP B;  4E2X A;  1Z01 A;  2JMO A;  3CCJ Z;  2NVX I;  4BXX I;  1S7M A;  1VQ8 1;  2Y0S A;  2QRE B;  2RBL A;  3CMA 1;  4NFR A;  1LQL A;  1YJW Z;  3D9X A;  4AYB A;  1YJW 1;  4A3J I;  2PK7 A;  1VQN 1;  2B63 I;  3GTK I;  1QVF Y;  4NH1 C;  4HGY A;  4MRI A;  3HOY I;  3OW2 Z;  4QTT A;  3G71 Z;  3HOW I;  3VMH A;  4DGL A;  2OTL 1;  4EWC A;  1TWH I;  3NDI A;  3IX0 A;  4RVG A;  2LIY A;  3JAM b;  2E2H I;  3PO2 I;  2O53 A;  1VQ5 Z;  2ZAE B;  2J6A A;  5C4X I;  2JA5 I;  1VQK 1;  1VQ4 1;  2V8J A;  1W2B Z;  2P28 A;  1W2B Y;  2GU2 A;  3F3P C;  3CCQ 1;  2V8K A;  4S1T A;  1RLY A;  1VLA A;  3CXC Y;  3VTN A;  1RO2 A;  1R9T I;  2NVY I;  4HH4 A;  5C3E I;  1I50 I;  2JS4 A;  3J80 f;  3PO3 I;  1M1K 2;  3S2H I;  2R7Z I;  1P9N A;  4A3F I;  3EER A;  2QRC B;  2QR1 B;  3S16 I;  1Z03 A;  2QLV B;  2Q4Z A;  1WW9 A;  1VQO 1;  4E2Y A;  2JA7 I;  2P3Y A;  1YI2 1;  3GTM S;  2KI7 B;  4E31 A;  2QA4 Z;  2K3R A;  3QWU A;  4A3D I;  1X3Z A;  1K73 1;  2JR6 A;  3KIF A;  1VQ8 Z;  3M3Y I;  2OTL Z;  1S72 1;  3S15 I;  1NJI 2;  1I6H I;  3HOZ I;  1K9M 1;  3S2D I;  3S1R I;  3CCE Z;  3K7A I;  1Q7Y 2;  3FQQ A;  3CCJ 1;  1X3W A;  1QVF Z;  3CMA Z;  1NJI 1;  1N8R 1;  1KC8 1;  3CCM Z;  3LUS A;  3CCR 1;  3I55 1;  1VQ7 Z;  1Y1V S;  2GTH A;  2RIQ A;  1QVG Y;  2NVQ I;  3S1M I;  2F4M A;  5T64 A;  3MZK B;  2QEX 1;  2OZK A;  3CCV Z;  3J81 b;  1Q81 1;  4Y52 I;  3CCV 1;  3GTM I;  1WCM I;  3BG1 B;  2KPI A;  2PMZ A;  2DE5 A;  5FLM I;  2QKD A;  3Q87 A;  4MON A;  1K9M 2;  1QF8 A;  1YJN 1;  2Q51 A;  3VB9 A;  2IZ3 A;  5CM2 M;  1VQ5 1;  3NH5 A;  5T6B A;  1VQL 1;  5IT9 f;  3CC2 Z;  4A3E I;  3CCR Z;  3CME 1;  3CC7 1;  4NBE A;  4NBC A;  3I55 Z;  1ZB8 A;  1K8A 1;  3H3V J;  1VQM 1;  3NFZ A;  3I56 Z;  2YU9 I;  3CC4 Z;  5T67 A;  1YJ9 Z;  2JUB A;  1YJ9 1;  2VF1 A;  1YUK A;  2LFU A;  2HF1 A;  4NOZ A;  1ML8 A;  2EGT A;  3TDH B;  4QTU A;  3CPW Z;  2E2J I;  4MD8 A;  3J80 b;  3CME Z;  1YIJ 1;  4NB9 A;  4E33 A;  1YIJ Z;  1M90 2;  1N2F A;  1N8R 2;  3D6W A;  1Y1V I;  4E30 A;  3IFU A;  3BG0 B;  1Q7Y 1;  3CCU Z;  5LL6 f;  1YI2 Z;  1ZB9 A;  3CQZ I;  3TE5 B;  1TWC I;  1VQM Z;  3G4S 1;  3HOX I;  4A3I I;  1JJ2 Y;  1VQK Z;  1Y1W I;  1VQ6 1;  4DK1 A;  1USP A;  5D1O A;  2YAD A;  1YIT 1;  1SFO I;  3P5J B;  4BBR I;  4CL1 A;  3CCS 1;  1WII A;  3S17 I;  3FQM A;  4E2W A;  3CD6 Z;  1NUI A;  5IT9 b;  1VQ7 1;  3GCF A;  3EED A;  3GTO I;  1YIT Z;  2W03 A;  3G6E 1;  2GTI A;  4RVH A;  1VQ6 Z;  3CCM 1;  1VQ9 1;  5D1P A;  3GTQ I;  1KQS Z;  4MH4 A;  4A3C I;  2QEX Z;  3GKQ A;  3OW2 Y;  2RHB A;  3RZO I;  4BY7 I;  1JWH C;  2F4O A;  2NVT I;  4NBF A;  2WAQ A;  3CXC Z;  1NP6 A;  2E9H A;  3HKZ A;  1K73 2;  4TNU A;  1RNI A;  1K83 I;  2HU9 A;  4NBG A;  3S1Q I;  3NH4 A;  3I07 A;  5D1O B;  3F3F C;  2RPR A;  5FLX b;  4E2Z A;  2G2K A;  3RZD I;  3CC4 1;  3IF8 A;  3U50 C;  3VMG A;  1M90 1;  1Q82 2;  1S72 Z;  3CPW Y;  1L1O C;  3CC7 Z;  4E32 A;  1VQO Z;  1TWA I;  5A2Q f;  5C4J I;  3CCL Z;  1VQL Z;  1ZH1 A;  2R93 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...