3M3YI

Rna polymerase ii elongation complex c
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m3yI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m3yI02
1I3QI 5IP9I 2R7ZI 3PO2I 4QTUA 2J6AA 2R92I 2JNYA 3S1QI 5FLMI 1USPA 4NB9A 2B63I 4Y52I 1USPB 2JA5I 1VLAA 4MH4A 3PO3I 1TWHI 1YUAA 1DL6A 3D6WA 4QTTA 3I4NI 2HF1A 4A3EI 3RZOI 2E2II 1I6HI 1RLYA 4BBSI 1ZB9A 3VB9A 2DE6A 3GTQI 3GTOI 3GTMS 4A3BI 3HOYI 2F4MA 1WW9A 2DE7A 3GTKI 2NVYI 2PK7A 3M4OI 3S1NI 2NVXI 1RO4A 3S1MI 4NBBA 2JR6A 3EERA 1Y1VI 1TWGI 5CM2M 3U50C 3VMHA 2P3YA 3HOXI 2E2HI 3S15I 4NBHA 1NUIA 3ESWA 3GKQA 2RBLA 3VMIA 5C4JI 4NBCA 3HOZI 1N2FA 3GTPI 3CQZI 1Y1WI 2K5RA 3HOVI 3GTLI 3Q87A 1TWFI 5C4XI 4A3JI 5IP7I 3HOUI 4A3DI 4Y7NI 2NVTI 2JA7I 3GTJI 2BJOA 1ML8A 2AKLA 1SFOI 4A3II 3GCFA 2JA6I 5C44I 1PFTA 2YU9I 1R9TI 3I4MI 4NB8A 3GTGI 2DE5A 4A3FI 3LUSA 2E2JI 3M3YI 3PO3S 2JS4A 4NBFA 1X3ZA 4NBEA 3GTMI 4NOZA 3S2DI 4BBRI 2R93I 3FKII 3K7AI 3S14I 1WCMI 4X6AI 1TWAI 4A3LI 4BY1I 2NVQI 4BXXI 4NBAA 2KPIA 4NBGA 1ZB8A 2F4OA 2VUMI 1TFIA 3RZDI 3S1RI 3S17I 3H3VJ 1TWCI 1QYPA 4BY7I 1Y1VS 3I07A 3HOWI 1X3WA 3VMGA 1I50I 4XX2A 3S2HI 5C3EI 4A3GI 4A3KI 4A93I 1LQLA 3S16I 4A3CI 2JA8I 1L1OC 1K83I 4NBDA 3H0GI 4A3MI
chains in the Genus database with same CATH superfamily
1I3QI 1K8A2 2O4HA 2R7ZI 3G4SZ 3I561 4MD9A 1Q861 1AA6A 3CCJ1 2JNYA 1JWHC 1VQ71 1RO0A 2B63I 1USPB 1VQNZ 1VLAA 1YUAA 3CCUZ 3I4NI 3FQQA 3RZOI 2E2II 4S1TA 5IT9b 3IX0A 4BBSI 3IR7A 4RVDA 3GTMS 2V8IA 3J81f 3GTKI 3KIHA 3CPWY 1Q7Y1 3S1NI 1YI21 5FLXb 1RO4A 3MONA 1VQO1 1YIT1 3NDIA 2H85A 1VQLZ 1Q811 4MONA 2JUBA 2RBLA 3OW2Y 3CCL1 5C4JI 3G711 1K9M2 2EGTA 3BG0B 3J80f 2JIMA 3HOVI 1N8R1 3Q87A 2O53A 3CCQZ 1SIWA 1K732 1YJWZ 1SFOI 4A3II 1KRLA 1PFTA 4NB8A 4E33A 1YIJZ 2OOYB 1KD12 1YJN1 1JJ2Z 1YUKA 1M1K2 3S2DI 1WCMI 2KI7B 3CCE1 4X6AI 3J80b 2WAQA 2M48A 1VQ9Z 1ZB8A 2F4OA 2QKDA 2WB1A 3CC71 4BY7I 1Q16A 3I07A 3HOWI 3CC21 2OZKA 4MD8A 5D1OB 2W04A 3S16I 1L1OC 3CMAZ 3H0GI 4A3MI 3OW2Z 1KC82 1YJ9Z 1S721 2QRCB 3CME1 2R92I 3J7A4 3S1QI 5FLMI 2JA5I 1WJ2A 3MZLB 4RV9A 5T64A 3NDJA 1VQ4Z 3G4S1 2GTHA 2V8JA 4E2YA 2OTJZ 1K9M1 2VPZA 2DE7A 2W03A 2NVXI 1VQ5Z 1RNIA 2Q51A 4NBBA 2JR6A 2E7ZA 3TDHB 1K731 1JJ2Y 2E2HI 3HOXI 2V45A 3S15I 1ZH1A 2QREB 2VPXA 1VQ61 3VMIA 4NBCA 1WIIA 1RO2A 1KD11 1N2FA 2OOXB 2VUGA 1QVFY 2K5RA 4MD7A 1NP6A 1M1K1 3GTLI 2JIPA 1VQL1 1VQ8Z 1TWFI 4A3JI 1NJI2 2LIYA 3HOUI 4Y7NI 2JMOA 3GTJI 1ML8A 5C44I 2YU9I 1VQMZ 4AYBA 3G6E1 3GTGI 1VQKZ 2E2JI 3M3YI 2JS4A 3CCQ1 1VQ7Z 4NBEA 1YJW1 3FKII 3K7AI 3CC41 3F3PC 5A2Qf 4HGZA 1TWAI 1YIJ1 4A3LI 4BXXI 4NBAA 2VPWA 1KC81 2VF1A 3NH8A 4TNUA 1TFIA 3S1RI 1QYPA 3CCMZ 4NH1C 1X3WA 3I551 4HGYA 5C3EI 1VQPZ 1VQ91 4A93I 1LQLA 3IF8A 3QWUA 1Z03A 2PM9A 2IZ3A 1Q862 1M902 5A2Qb 1YHQZ 1Z01A 3PO2I 4QTUA 1QVFZ 4E32A 4E2XA 1K8A1 1USPA 4NB9A 4MRIA 4Y52I 2E9HA 3CMA1 3PO3I 2QA4Z 1TWHI 1KQSY 1YJ91 4QTTA 3HKZA 4A3EI 1RLYA 1ZB9A 3VB9A 4NFRA 2DE6A 2RPRA 1Q7Y2 4A3BI 2I3CA 3KIFA 3CCR1 1WW9A 2K3RA 2NVYI 2PK7A 4HH4A 5AN9F 3M4OI 1NJI1 1YJNZ 4RVFA 1Q812 1Y1VI 2OTLZ 2OTJ1 5CM2M 3CCEZ 3VMHA 2LEXA 2P3YA 1QVGY 2ZAEB 1NUIA 2GU2A 4CL1A 1Z02A 1VQ51 3HOZI 4MXUA 3GTPI 2YADA 2QEXZ 3CQZI 2Y0SA 1VQN1 3T4NB 5IP7I 3CCU1 2NVTI 2JA7I 3CCVZ 2HU9A 1FDIA 3NFZA 3D9XA 3GCFA 1S72Z 3CMEZ 3CCSZ 4DGLA 3GTMI 1X3ZA 1QF8A 3CXCZ 2LFUA 4NOZA 4BBRI 1KQSZ 3MZKB 1VQM1 1VQK1 4NBGA 3EEDA 1M901 4E2ZA 2RIQA 3CD6Z 3S17I 2V8KA 3H3VJ 3FQMA 2IZ4A 1W2BY 1Q822 3VMGA 2G2KA 3P5JB 4EWCA 1I50I 1WZNA 3I56Z 4DK1A 4A3GI 4A3KI 3CCJZ 5D1OA 1QVGZ 4A3CI 2JA8I 5C4XI 1K83I 1DL6A 3CCM1 3VTNA 5IP9I 1X0TA 2QRDB 1VQ6Z 4RVGA 2J6AA 1VQP1 3F3FC 2V3VA 4MH4A 3D6WA 1P9NA 2HF1A 1YHQ1 1YI2Z 2GTIA 1I6HI 1S7MA 1VQOZ 2IV2X 1YITZ 3GTQI 3GTOI 3G6EZ 3HOYI 2F4MA 2QA41 3J81b 2QLVB 2JIQA 3CCLZ 3NH5A 3S1MI 3G71Z 3CC4Z 3EERA 3D2LA 4DQYB 1TWGI 2Q4ZA 3U50C 3CXCY 3JAMf 4NBHA 3ESWA 3GKQA 2PMZA 2RHBA 1W2BZ 1Y8CA 2OTL1 1Y1WI 2P28A 3I55Z 4A3DI 5T6BA 1VQ41 2BJOA 2AKLA 2R6MA 3CPWZ 2JA6I 2QEX1 1R9TI 3I4MI 2DE5A 1RQFA 4A3FI 3LUSA 2QR1B 2NAPA 1Q821 3PO3S 2JIOA 3JAMb 3NH4A 4NBFA 3CCV1 3BG1B 1N8R2 2R93I 4RS4A 2JIRA 3CC7Z 3S14I 2VPYA 5LL6f 4BY1I 2NVQI 2KPIA 3CC2Z 3CCS1 5T67A 2AYDA 4RVHA 1QXFA 2RT9A 3TE5B 2VUMI 3RZDI 5D1PA 4E31A 1TWCI 1FDOA 3CCRZ 1Y1VS 5IT9f 1VQ81 2M6NA 4XX2A 3S2HI 3CD61 4E30A 4E2WA 4NBDA 5FLXf 3IFUA
chains in the Genus database with same CATH topology
1I3QI 1K8A2 2O4HA 2R7ZI 3G4SZ 3I561 4MD9A 1Q861 3CCJ1 2JNYA 1JWHC 1VQ71 1RO0A 2B63I 1USPB 1VQNZ 1VLAA 1YUAA 3CCUZ 3I4NI 3FQQA 3RZOI 2E2II 4S1TA 5IT9b 3IX0A 4BBSI 4RVDA 3GTMS 2V8IA 3J81f 3GTKI 3KIHA 3CPWY 1Q7Y1 3S1NI 1YI21 5FLXb 1RO4A 3MONA 1VQO1 1YIT1 3NDIA 2H85A 1VQLZ 1Q811 4MONA 2JUBA 2RBLA 3OW2Y 3CCL1 5C4JI 3G711 1K9M2 2EGTA 3BG0B 3J80f 3HOVI 1N8R1 3Q87A 2O53A 3CCQZ 1K732 1YJWZ 1SFOI 4A3II 1KRLA 1PFTA 4NB8A 4E33A 1YIJZ 2OOYB 1KD12 1YJN1 1JJ2Z 1YUKA 1M1K2 3S2DI 2KI7B 1WCMI 3CCE1 4X6AI 3J80b 2WAQA 2M48A 1VQ9Z 1ZB8A 2F4OA 2QKDA 2WB1A 3CC71 4BY7I 3I07A 3HOWI 3CC21 2OZKA 4MD8A 5D1OB 2W04A 3S16I 1L1OC 3CMAZ 3H0GI 4A3MI 3OW2Z 1KC82 1YJ9Z 1S721 2QRCB 3CME1 2R92I 3J7A4 3S1QI 5FLMI 2JA5I 3MZLB 4RV9A 5T64A 3NDJA 1VQ4Z 3G4S1 2GTHA 2V8JA 4E2YA 2OTJZ 1K9M1 2DE7A 2W03A 2NVXI 1VQ5Z 1RNIA 2Q51A 4NBBA 2JR6A 3TDHB 1K731 1JJ2Y 2E2HI 3HOXI 3S15I 1ZH1A 2QREB 1VQ61 3VMIA 4NBCA 1WIIA 1RO2A 1KD11 1N2FA 2OOXB 2VUGA 1QVFY 2K5RA 4MD7A 1NP6A 1M1K1 3GTLI 1VQL1 1VQ8Z 1TWFI 4A3JI 1NJI2 2LIYA 3HOUI 4Y7NI 2JMOA 3GTJI 1ML8A 5C44I 2YU9I 1VQMZ 4AYBA 3G6E1 3GTGI 1VQKZ 2E2JI 3M3YI 2JS4A 3CCQ1 1VQ7Z 4NBEA 1YJW1 3FKII 3K7AI 3CC41 3F3PC 5A2Qf 4HGZA 1TWAI 1YIJ1 4A3LI 4BXXI 4NBAA 1KC81 2VF1A 3NH8A 4TNUA 1TFIA 3S1RI 1QYPA 3CCMZ 4NH1C 1X3WA 3I551 4HGYA 5C3EI 1VQPZ 1VQ91 4A93I 1LQLA 3IF8A 3QWUA 1Z03A 2PM9A 2IZ3A 1Q862 1M902 5A2Qb 1YHQZ 1Z01A 3PO2I 4QTUA 1QVFZ 4E32A 4E2XA 1K8A1 1USPA 4NB9A 4MRIA 4Y52I 2E9HA 3CMA1 3PO3I 2QA4Z 1TWHI 1KQSY 1YJ91 4QTTA 3HKZA 4A3EI 1RLYA 1ZB9A 3VB9A 4NFRA 2DE6A 2RPRA 1Q7Y2 4A3BI 2I3CA 3KIFA 3CCR1 1WW9A 2K3RA 2NVYI 2PK7A 4HH4A 5AN9F 3M4OI 1NJI1 1YJNZ 4RVFA 1Q812 1Y1VI 2OTLZ 2OTJ1 5CM2M 3CCEZ 3VMHA 1QVGY 2P3YA 2ZAEB 1NUIA 2GU2A 4CL1A 1Z02A 1VQ51 3HOZI 4MXUA 3GTPI 2YADA 2QEXZ 3CQZI 2Y0SA 1VQN1 3T4NB 5IP7I 3CCU1 2NVTI 2JA7I 3CCVZ 2HU9A 3NFZA 3D9XA 3GCFA 1S72Z 3CMEZ 3CCSZ 4DGLA 3GTMI 1X3ZA 1QF8A 3CXCZ 2LFUA 4NOZA 4BBRI 1KQSZ 3MZKB 1VQM1 1VQK1 4NBGA 3EEDA 1M901 2RIQA 4E2ZA 3CD6Z 3S17I 2V8KA 3H3VJ 3FQMA 2IZ4A 1W2BY 1Q822 3VMGA 2G2KA 3P5JB 4EWCA 1I50I 3I56Z 4DK1A 4A3GI 4A3KI 3CCJZ 5D1OA 1QVGZ 4A3CI 2JA8I 5C4XI 1K83I 1DL6A 3CCM1 3VTNA 5IP9I 1X0TA 2QRDB 1VQ6Z 4RVGA 2J6AA 1VQP1 3F3FC 4MH4A 3D6WA 1P9NA 2HF1A 1YHQ1 1YI2Z 2GTIA 1I6HI 1S7MA 1VQOZ 1YITZ 3GTQI 3GTOI 3G6EZ 3HOYI 2F4MA 2QA41 3J81b 2QLVB 3CCLZ 3NH5A 3S1MI 3G71Z 3CC4Z 3EERA 4DQYB 1TWGI 2Q4ZA 3U50C 3CXCY 3JAMf 4NBHA 3ESWA 3GKQA 2PMZA 2RHBA 1W2BZ 2OTL1 1Y1WI 2P28A 3I55Z 4A3DI 5T6BA 1VQ41 2BJOA 2AKLA 2R6MA 3CPWZ 2JA6I 2QEX1 1R9TI 3I4MI 2DE5A 1RQFA 4A3FI 3LUSA 2QR1B 1Q821 3PO3S 3JAMb 3NH4A 4NBFA 3CCV1 3BG1B 1N8R2 2R93I 4RS4A 3CC7Z 3S14I 4BY1I 5LL6f 2NVQI 2KPIA 3CC2Z 3CCS1 5T67A 4RVHA 2RT9A 3TE5B 2VUMI 3RZDI 5D1PA 4E31A 1TWCI 3CCRZ 1Y1VS 5IT9f 1VQ81 2M6NA 4XX2A 3S2HI 3CD61 4E30A 4E2WA 4NBDA 5FLXf 3IFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I3Q I;  5IP9 I;  2R7Z I;  3PO2 I;  4QTU A;  2J6A A;  2R92 I;  2JNY A;  3S1Q I;  5FLM I;  1USP A;  4NB9 A;  2B63 I;  4Y52 I;  1USP B;  2JA5 I;  1VLA A;  4MH4 A;  3PO3 I;  1TWH I;  1YUA A;  1DL6 A;  3D6W A;  4QTT A;  3I4N I;  2HF1 A;  4A3E I;  3RZO I;  2E2I I;  1I6H I;  1RLY A;  4BBS I;  1ZB9 A;  3VB9 A;  2DE6 A;  3GTQ I;  3GTO I;  3GTM S;  4A3B I;  3HOY I;  2F4M A;  1WW9 A;  2DE7 A;  3GTK I;  2NVY I;  2PK7 A;  3M4O I;  3S1N I;  2NVX I;  1RO4 A;  3S1M I;  4NBB A;  2JR6 A;  3EER A;  1Y1V I;  1TWG I;  5CM2 M;  3U50 C;  3VMH A;  2P3Y A;  3HOX I;  2E2H I;  3S15 I;  4NBH A;  1NUI A;  3ESW A;  3GKQ A;  2RBL A;  3VMI A;  5C4J I;  4NBC A;  3HOZ I;  1N2F A;  3GTP I;  3CQZ I;  1Y1W I;  2K5R A;  3HOV I;  3GTL I;  3Q87 A;  1TWF I;  5C4X I;  4A3J I;  5IP7 I;  3HOU I;  4A3D I;  4Y7N I;  2NVT I;  2JA7 I;  3GTJ I;  2BJO A;  1ML8 A;  2AKL A;  1SFO I;  4A3I I;  3GCF A;  2JA6 I;  5C44 I;  1PFT A;  2YU9 I;  1R9T I;  3I4M I;  4NB8 A;  3GTG I;  2DE5 A;  4A3F I;  3LUS A;  2E2J I;  3M3Y I;  3PO3 S;  2JS4 A;  4NBF A;  1X3Z A;  4NBE A;  3GTM I;  4NOZ A;  3S2D I;  4BBR I;  2R93 I;  3FKI I;  3K7A I;  3S14 I;  1WCM I;  4X6A I;  1TWA I;  4A3L I;  4BY1 I;  2NVQ I;  4BXX I;  4NBA A;  2KPI A;  4NBG A;  1ZB8 A;  2F4O A;  2VUM I;  1TFI A;  3RZD I;  3S1R I;  3S17 I;  3H3V J;  1TWC I;  1QYP A;  4BY7 I;  1Y1V S;  3I07 A;  3HOW I;  1X3W A;  3VMG A;  1I50 I;  4XX2 A;  3S2H I;  5C3E I;  4A3G I;  4A3K I;  4A93 I;  1LQL A;  3S16 I;  4A3C I;  2JA8 I;  1L1O C;  1K83 I;  4NBD A;  3H0G I;  4A3M I; 
#chains in the Genus database with same CATH topology
 1I3Q I;  1K8A 2;  2O4H A;  2R7Z I;  3G4S Z;  3I56 1;  4MD9 A;  1Q86 1;  1AA6 A;  3CCJ 1;  2JNY A;  1JWH C;  1VQ7 1;  1RO0 A;  2B63 I;  1USP B;  1VQN Z;  1VLA A;  1YUA A;  3CCU Z;  3I4N I;  3FQQ A;  3RZO I;  2E2I I;  4S1T A;  5IT9 b;  3IX0 A;  4BBS I;  3IR7 A;  4RVD A;  3GTM S;  2V8I A;  3J81 f;  3GTK I;  3KIH A;  3CPW Y;  1Q7Y 1;  3S1N I;  1YI2 1;  5FLX b;  1RO4 A;  3MON A;  1VQO 1;  1YIT 1;  3NDI A;  2H85 A;  1VQL Z;  1Q81 1;  4MON A;  2JUB A;  2RBL A;  3OW2 Y;  3CCL 1;  5C4J I;  3G71 1;  1K9M 2;  2EGT A;  3BG0 B;  3J80 f;  2JIM A;  3HOV I;  1N8R 1;  3Q87 A;  2O53 A;  3CCQ Z;  1SIW A;  1K73 2;  1YJW Z;  1SFO I;  4A3I I;  1KRL A;  1PFT A;  4NB8 A;  4E33 A;  1YIJ Z;  2OOY B;  1KD1 2;  1YJN 1;  1JJ2 Z;  1YUK A;  1M1K 2;  3S2D I;  1WCM I;  2KI7 B;  3CCE 1;  4X6A I;  3J80 b;  2WAQ A;  2M48 A;  1VQ9 Z;  1ZB8 A;  2F4O A;  2QKD A;  2WB1 A;  3CC7 1;  4BY7 I;  1Q16 A;  3I07 A;  3HOW I;  3CC2 1;  2OZK A;  4MD8 A;  5D1O B;  2W04 A;  3S16 I;  1L1O C;  3CMA Z;  3H0G I;  4A3M I;  3OW2 Z;  1KC8 2;  1YJ9 Z;  1S72 1;  2QRC B;  3CME 1;  2R92 I;  3J7A 4;  3S1Q I;  5FLM I;  2JA5 I;  1WJ2 A;  3MZL B;  4RV9 A;  5T64 A;  3NDJ A;  1VQ4 Z;  3G4S 1;  2GTH A;  2V8J A;  4E2Y A;  2OTJ Z;  1K9M 1;  2VPZ A;  2DE7 A;  2W03 A;  2NVX I;  1VQ5 Z;  1RNI A;  2Q51 A;  4NBB A;  2JR6 A;  2E7Z A;  3TDH B;  1K73 1;  1JJ2 Y;  2E2H I;  3HOX I;  2V45 A;  3S15 I;  1ZH1 A;  2QRE B;  2VPX A;  1VQ6 1;  3VMI A;  4NBC A;  1WII A;  1RO2 A;  1KD1 1;  1N2F A;  2OOX B;  2VUG A;  1QVF Y;  2K5R A;  4MD7 A;  1NP6 A;  1M1K 1;  3GTL I;  2JIP A;  1VQL 1;  1VQ8 Z;  1TWF I;  4A3J I;  1NJI 2;  2LIY A;  3HOU I;  4Y7N I;  2JMO A;  3GTJ I;  1ML8 A;  5C44 I;  2YU9 I;  1VQM Z;  4AYB A;  3G6E 1;  3GTG I;  1VQK Z;  2E2J I;  3M3Y I;  2JS4 A;  3CCQ 1;  1VQ7 Z;  4NBE A;  1YJW 1;  3FKI I;  3K7A I;  3CC4 1;  3F3P C;  5A2Q f;  4HGZ A;  1TWA I;  1YIJ 1;  4A3L I;  4BXX I;  4NBA A;  2VPW A;  1KC8 1;  2VF1 A;  3NH8 A;  4TNU A;  1TFI A;  3S1R I;  1QYP A;  3CCM Z;  4NH1 C;  1X3W A;  3I55 1;  4HGY A;  5C3E I;  1VQP Z;  1VQ9 1;  4A93 I;  1LQL A;  3IF8 A;  3QWU A;  1Z03 A;  2PM9 A;  2IZ3 A;  1Q86 2;  1M90 2;  5A2Q b;  1YHQ Z;  1Z01 A;  3PO2 I;  4QTU A;  1QVF Z;  4E32 A;  4E2X A;  1K8A 1;  1USP A;  4NB9 A;  4MRI A;  4Y52 I;  2E9H A;  3CMA 1;  3PO3 I;  2QA4 Z;  1TWH I;  1KQS Y;  1YJ9 1;  4QTT A;  3HKZ A;  4A3E I;  1RLY A;  1ZB9 A;  3VB9 A;  4NFR A;  2DE6 A;  2RPR A;  1Q7Y 2;  4A3B I;  2I3C A;  3KIF A;  3CCR 1;  1WW9 A;  2K3R A;  2NVY I;  2PK7 A;  4HH4 A;  5AN9 F;  3M4O I;  1NJI 1;  1YJN Z;  4RVF A;  1Q81 2;  1Y1V I;  2OTL Z;  2OTJ 1;  5CM2 M;  3CCE Z;  3VMH A;  2LEX A;  2P3Y A;  1QVG Y;  2ZAE B;  1NUI A;  2GU2 A;  4CL1 A;  1Z02 A;  1VQ5 1;  3HOZ I;  4MXU A;  3GTP I;  2YAD A;  2QEX Z;  3CQZ I;  2Y0S A;  1VQN 1;  3T4N B;  5IP7 I;  3CCU 1;  2NVT I;  2JA7 I;  3CCV Z;  2HU9 A;  1FDI A;  3NFZ A;  3D9X A;  3GCF A;  1S72 Z;  3CME Z;  3CCS Z;  4DGL A;  3GTM I;  1X3Z A;  1QF8 A;  3CXC Z;  2LFU A;  4NOZ A;  4BBR I;  1KQS Z;  3MZK B;  1VQM 1;  1VQK 1;  4NBG A;  3EED A;  1M90 1;  4E2Z A;  2RIQ A;  3CD6 Z;  3S17 I;  2V8K A;  3H3V J;  3FQM A;  2IZ4 A;  1W2B Y;  1Q82 2;  3VMG A;  2G2K A;  3P5J B;  4EWC A;  1I50 I;  1WZN A;  3I56 Z;  4DK1 A;  4A3G I;  4A3K I;  3CCJ Z;  5D1O A;  1QVG Z;  4A3C I;  2JA8 I;  5C4X I;  1K83 I;  1DL6 A;  3CCM 1;  3VTN A;  5IP9 I;  1X0T A;  2QRD B;  1VQ6 Z;  4RVG A;  2J6A A;  1VQP 1;  3F3F C;  2V3V A;  4MH4 A;  3D6W A;  1P9N A;  2HF1 A;  1YHQ 1;  1YI2 Z;  2GTI A;  1I6H I;  1S7M A;  1VQO Z;  2IV2 X;  1YIT Z;  3GTQ I;  3GTO I;  3G6E Z;  3HOY I;  2F4M A;  2QA4 1;  3J81 b;  2QLV B;  2JIQ A;  3CCL Z;  3NH5 A;  3S1M I;  3G71 Z;  3CC4 Z;  3EER A;  3D2L A;  4DQY B;  1TWG I;  2Q4Z A;  3U50 C;  3CXC Y;  3JAM f;  4NBH A;  3ESW A;  3GKQ A;  2PMZ A;  2RHB A;  1W2B Z;  1Y8C A;  2OTL 1;  1Y1W I;  2P28 A;  3I55 Z;  4A3D I;  5T6B A;  1VQ4 1;  2BJO A;  2AKL A;  2R6M A;  3CPW Z;  2JA6 I;  2QEX 1;  1R9T I;  3I4M I;  2DE5 A;  1RQF A;  4A3F I;  3LUS A;  2QR1 B;  2NAP A;  1Q82 1;  3PO3 S;  2JIO A;  3JAM b;  3NH4 A;  4NBF A;  3CCV 1;  3BG1 B;  1N8R 2;  2R93 I;  4RS4 A;  2JIR A;  3CC7 Z;  3S14 I;  2VPY A;  5LL6 f;  4BY1 I;  2NVQ I;  2KPI A;  3CC2 Z;  3CCS 1;  5T67 A;  2AYD A;  4RVH A;  1QXF A;  2RT9 A;  3TE5 B;  2VUM I;  3RZD I;  5D1P A;  4E31 A;  1TWC I;  1FDO A;  3CCR Z;  1Y1V S;  5IT9 f;  1VQ8 1;  2M6N A;  4XX2 A;  3S2H I;  3CD6 1;  4E30 A;  4E2W A;  4NBD A;  5FLX f;  3IFU A; 
#chains in the Genus database with same CATH homology
 1I3Q I;  1K8A 2;  2O4H A;  2R7Z I;  3G4S Z;  3I56 1;  4MD9 A;  1Q86 1;  3CCJ 1;  2JNY A;  1JWH C;  1VQ7 1;  1RO0 A;  2B63 I;  1USP B;  1VQN Z;  1VLA A;  1YUA A;  3CCU Z;  3I4N I;  3FQQ A;  3RZO I;  2E2I I;  4S1T A;  5IT9 b;  3IX0 A;  4BBS I;  4RVD A;  3GTM S;  2V8I A;  3J81 f;  3GTK I;  3KIH A;  3CPW Y;  1Q7Y 1;  3S1N I;  1YI2 1;  5FLX b;  1RO4 A;  3MON A;  1VQO 1;  1YIT 1;  3NDI A;  2H85 A;  1VQL Z;  1Q81 1;  4MON A;  2JUB A;  2RBL A;  3OW2 Y;  3CCL 1;  5C4J I;  3G71 1;  1K9M 2;  2EGT A;  3BG0 B;  3J80 f;  3HOV I;  1N8R 1;  3Q87 A;  2O53 A;  3CCQ Z;  1K73 2;  1YJW Z;  1SFO I;  4A3I I;  1KRL A;  1PFT A;  4NB8 A;  4E33 A;  1YIJ Z;  2OOY B;  1KD1 2;  1YJN 1;  1JJ2 Z;  1YUK A;  1M1K 2;  3S2D I;  2KI7 B;  1WCM I;  3CCE 1;  4X6A I;  3J80 b;  2WAQ A;  2M48 A;  1VQ9 Z;  1ZB8 A;  2F4O A;  2QKD A;  2WB1 A;  3CC7 1;  4BY7 I;  3I07 A;  3HOW I;  3CC2 1;  2OZK A;  4MD8 A;  5D1O B;  2W04 A;  3S16 I;  1L1O C;  3CMA Z;  3H0G I;  4A3M I;  3OW2 Z;  1KC8 2;  1YJ9 Z;  1S72 1;  2QRC B;  3CME 1;  2R92 I;  3J7A 4;  3S1Q I;  5FLM I;  2JA5 I;  3MZL B;  4RV9 A;  5T64 A;  3NDJ A;  1VQ4 Z;  3G4S 1;  2GTH A;  2V8J A;  4E2Y A;  2OTJ Z;  1K9M 1;  2DE7 A;  2W03 A;  2NVX I;  1VQ5 Z;  1RNI A;  2Q51 A;  4NBB A;  2JR6 A;  3TDH B;  1K73 1;  1JJ2 Y;  2E2H I;  3HOX I;  3S15 I;  1ZH1 A;  2QRE B;  1VQ6 1;  3VMI A;  4NBC A;  1WII A;  1RO2 A;  1KD1 1;  1N2F A;  2OOX B;  2VUG A;  1QVF Y;  2K5R A;  4MD7 A;  1NP6 A;  1M1K 1;  3GTL I;  1VQL 1;  1VQ8 Z;  1TWF I;  4A3J I;  1NJI 2;  2LIY A;  3HOU I;  4Y7N I;  2JMO A;  3GTJ I;  1ML8 A;  5C44 I;  2YU9 I;  1VQM Z;  4AYB A;  3G6E 1;  3GTG I;  1VQK Z;  2E2J I;  3M3Y I;  2JS4 A;  3CCQ 1;  1VQ7 Z;  4NBE A;  1YJW 1;  3FKI I;  3K7A I;  3CC4 1;  3F3P C;  5A2Q f;  4HGZ A;  1TWA I;  1YIJ 1;  4A3L I;  4BXX I;  4NBA A;  1KC8 1;  2VF1 A;  3NH8 A;  4TNU A;  1TFI A;  3S1R I;  1QYP A;  3CCM Z;  4NH1 C;  1X3W A;  3I55 1;  4HGY A;  5C3E I;  1VQP Z;  1VQ9 1;  4A93 I;  1LQL A;  3IF8 A;  3QWU A;  1Z03 A;  2PM9 A;  2IZ3 A;  1Q86 2;  1M90 2;  5A2Q b;  1YHQ Z;  1Z01 A;  3PO2 I;  4QTU A;  1QVF Z;  4E32 A;  4E2X A;  1K8A 1;  1USP A;  4NB9 A;  4MRI A;  4Y52 I;  2E9H A;  3CMA 1;  3PO3 I;  2QA4 Z;  1TWH I;  1KQS Y;  1YJ9 1;  4QTT A;  3HKZ A;  4A3E I;  1RLY A;  1ZB9 A;  3VB9 A;  4NFR A;  2DE6 A;  2RPR A;  1Q7Y 2;  4A3B I;  2I3C A;  3KIF A;  3CCR 1;  1WW9 A;  2K3R A;  2NVY I;  2PK7 A;  4HH4 A;  5AN9 F;  3M4O I;  1NJI 1;  1YJN Z;  4RVF A;  1Q81 2;  1Y1V I;  2OTL Z;  2OTJ 1;  5CM2 M;  3CCE Z;  3VMH A;  1QVG Y;  2P3Y A;  2ZAE B;  1NUI A;  2GU2 A;  4CL1 A;  1Z02 A;  1VQ5 1;  3HOZ I;  4MXU A;  3GTP I;  2YAD A;  2QEX Z;  3CQZ I;  2Y0S A;  1VQN 1;  3T4N B;  5IP7 I;  3CCU 1;  2NVT I;  2JA7 I;  3CCV Z;  2HU9 A;  3NFZ A;  3D9X A;  3GCF A;  1S72 Z;  3CME Z;  3CCS Z;  4DGL A;  3GTM I;  1X3Z A;  1QF8 A;  3CXC Z;  2LFU A;  4NOZ A;  4BBR I;  1KQS Z;  3MZK B;  1VQM 1;  1VQK 1;  4NBG A;  3EED A;  1M90 1;  2RIQ A;  4E2Z A;  3CD6 Z;  3S17 I;  2V8K A;  3H3V J;  3FQM A;  2IZ4 A;  1W2B Y;  1Q82 2;  3VMG A;  2G2K A;  3P5J B;  4EWC A;  1I50 I;  3I56 Z;  4DK1 A;  4A3G I;  4A3K I;  3CCJ Z;  5D1O A;  1QVG Z;  4A3C I;  2JA8 I;  5C4X I;  1K83 I;  1DL6 A;  3CCM 1;  3VTN A;  5IP9 I;  1X0T A;  2QRD B;  1VQ6 Z;  4RVG A;  2J6A A;  1VQP 1;  3F3F C;  4MH4 A;  3D6W A;  1P9N A;  2HF1 A;  1YHQ 1;  1YI2 Z;  2GTI A;  1I6H I;  1S7M A;  1VQO Z;  1YIT Z;  3GTQ I;  3GTO I;  3G6E Z;  3HOY I;  2F4M A;  2QA4 1;  3J81 b;  2QLV B;  3CCL Z;  3NH5 A;  3S1M I;  3G71 Z;  3CC4 Z;  3EER A;  4DQY B;  1TWG I;  2Q4Z A;  3U50 C;  3CXC Y;  3JAM f;  4NBH A;  3ESW A;  3GKQ A;  2PMZ A;  2RHB A;  1W2B Z;  2OTL 1;  1Y1W I;  2P28 A;  3I55 Z;  4A3D I;  5T6B A;  1VQ4 1;  2BJO A;  2AKL A;  2R6M A;  3CPW Z;  2JA6 I;  2QEX 1;  1R9T I;  3I4M I;  2DE5 A;  1RQF A;  4A3F I;  3LUS A;  2QR1 B;  1Q82 1;  3PO3 S;  3JAM b;  3NH4 A;  4NBF A;  3CCV 1;  3BG1 B;  1N8R 2;  2R93 I;  4RS4 A;  3CC7 Z;  3S14 I;  4BY1 I;  5LL6 f;  2NVQ I;  2KPI A;  3CC2 Z;  3CCS 1;  5T67 A;  4RVH A;  2RT9 A;  3TE5 B;  2VUM I;  3RZD I;  5D1P A;  4E31 A;  1TWC I;  3CCR Z;  1Y1V S;  5IT9 f;  1VQ8 1;  2M6N A;  4XX2 A;  3S2H I;  3CD6 1;  4E30 A;  4E2W A;  4NBD A;  5FLX f;  3IFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...