3M3YI

Rna polymerase ii elongation complex c
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m3yI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m3yI02
2DE5A 2R7ZI 4A3KI 5C4JI 1ZB9A 2B63I 2RBLA 3GTGI 4A3BI 4Y52I 1RLYA 1Y1VI 2F4OA 3GTPI 5IP7I 2VUMI 3S2DI 2JA7I 2K5RA 1R9TI 3S16I 3Q87A 1X3WA 5C3EI 1SFOI 4BY7I 4QTUA 4A3GI 4A3II 3HOXI 3PO2I 2JR6A 3VMHA 3GTOI 3PO3S 1X3ZA 3GTKI 1TWHI 1RO4A 4A3EI 2P3YA 3VMIA 2JA6I 2NVQI 3HOWI 2DE7A 2R92I 3S2HI 4NBDA 2JA8I 4A93I 1LQLA 2NVTI 3RZOI 4BBSI 2HF1A 3CQZI 2JA5I 1TWAI 1TWFI 4NB9A 2J6AA 3S1NI 1ZB8A 3K7AI 1ML8A 2NVXI 3M3YI 5IP9I 4XX2A 4Y7NI 4NBFA 3I4MI 3S17I 3H3VJ 1Y1WI 3HOZI 1TFIA 2E2HI 1Y1VS 4A3FI 4A3JI 1USPB 1YUAA 2JS4A 4NBBA 3GTMI 4NBCA 3S1MI 3I4NI 1USPA 2AKLA 5FLMI 3RZDI 3GTJI 4A3CI 3GCFA 2YU9I 4MH4A 3GTLI 1WCMI 3HOVI 1QYPA 1PFTA 3U50C 1K83I 2E2II 1VLAA 3GKQA 3ESWA 3S14I 4NBEA 1N2FA 4NBAA 1I6HI 3I07A 3VB9A 2E2JI 2R93I 1DL6A 3EERA 4NB8A 5C44I 4A3DI 2F4MA 4BBRI 2BJOA 1L1OC 3HOYI 3M4OI 4NBHA 3H0GI 3VMGA 3PO3I 3LUSA 4NBGA 1I3QI 1NUIA 3S1QI 2DE6A 4NOZA 3S15I 2PK7A 1TWCI 2NVYI 3GTQI 4A3MI 3D6WA 2KPIA 1WW9A 3FKII 1TWGI 5CM2M 1I50I 3S1RI 5C4XI 4BY1I 4X6AI 4QTTA 4BXXI 3GTMS 3HOUI 4A3LI 2JNYA
chains in the Genus database with same CATH superfamily
2WB1A 2R7ZI 4A3KI 1M902 1ZB9A 1JJ2Y 3CME1 3T4NB 1Y8CA 1Q812 2V8KA 1QVGZ 1VQN1 3CC41 1Q861 4NH1C 3GTPI 4NFRA 5T67A 4A3II 1VQL1 2JR6A 3PO3S 3CCJ1 3CCSZ 2QA41 1KQSY 1RO4A 4A3EI 2P3YA 2JA6I 1YI21 2DE7A 3VTNA 3RZOI 5FLXf 2QKDA 2KI7B 1ML8A 1YJN1 4E2WA 2QEX1 2JMOA 2VPWA 1AA6A 2ZAEB 2O4HA 1VQO1 4NBFA 3I4MI 2VF1A 3G711 1M901 2JIRA 4A3FI 3CCS1 3CCQ1 3S1MI 3CCUZ 1Q811 1K732 3RZDI 3GTJI 1YJ91 3GTLI 3HOVI 1FDOA 4E2YA 1K83I 1VQ8Z 1VLAA 1K9M2 2IV2X 4NBEA 3TE5B 3I07A 3EERA 4BBRI 2QRDB 2OZKA 2HU9A 3J80f 2BJOA 4E2ZA 3HOYI 1WJ2A 2VPZA 1VQ9Z 3VMGA 3P5JB 2OTLZ 3CD61 4NOZA 4MD9A 1TWCI 1YIJ1 5T6BA 4S1TA 2QREB 3CC7Z 3J7A4 5CM2M 1I50I 1NJI1 1K8A1 4BXXI 2G2KA 1YITZ 1FDIA 2DE5A 2E7ZA 3NDJA 5C4JI 2JIQA 2RBLA 3CMEZ 1Q821 3JAMf 1K731 3GTGI 3MZKB 3CC4Z 1VQNZ 4A3BI 3MONA 1YJW1 3FQMA 2JA7I 2K5RA 3S16I 2I3CA 5A2Qf 1SFOI 1VQLZ 3PO2I 4EWCA 3VMHA 3CCJZ 1X3ZA 2OTJZ 1TWHI 3I56Z 1YI2Z 3S2HI 1LQLA 2HF1A 2JA5I 1TWAI 2J6AA 1YJNZ 3K7AI 2QEXZ 2NVXI 1N8R2 3NDIA 4RS4A 1VQOZ 3S17I 4RVHA 1VQM1 1VQK1 3H3VJ 3G71Z 1TFIA 1KC82 2E2HI 2OTJ1 2IZ4A 3CPWZ 3CCQZ 1QVFZ 3I561 4NBBA 3NH8A 4DK1A 1QVGY 3I4NI 2JIPA 1YJ9Z 5FLMI 4A3CI 1VQ71 2R6MA 4RVFA 2V45A 1WCMI 3U50C 1Q7Y2 3S14I 2K3RA 1DL6A 3IX0A 1NP6A 4NB8A 4MD8A 1KRLA 4MD7A 3CCM1 1M1K1 4E2XA 4NBHA 3H0GI 3CD6Z 3IF8A 3S15I 5LL6f 2WAQA 1YIJZ 2YADA 3GTQI 4DGLA 3CCL1 1WW9A 1Q16A 2W04A 1TWGI 2E9HA 2EGTA 2RPRA 2NVTI 3CCE1 3D2LA 2NAPA 1YJWZ 4Y52I 1ZH1A 2RHBA 1RLYA 1Y1VI 2F4OA 3CXCZ 5IP7I 3S2DI 1X3WA 1Q7Y1 2O53A 2PMZA 2GTHA 4AYBA 2JUBA 4E33A 3J80b 2JIMA 3GTKI 3D9XA 1X0TA 5IT9f 1W2BZ 3OW2Z 3CC2Z 4MRIA 3CCVZ 3HOWI 4E30A 2R92I 1WZNA 2LEXA 4NBDA 2V3VA 3NH5A 1Q862 1VQ4Z 4A93I 3HKZA 4BBSI 1Z01A 3CQZI 4NB9A 4HGYA 2VUGA 1ZB8A 3J81f 3KIFA 1S721 1VQ61 2GTIA 1K9M1 3FQQA 3IFUA 2V8JA 4XX2A 5IP9I 2V8IA 4Y7NI 1VQMZ 1VQKZ 2M48A 3I551 1Y1VS 4A3JI 3JAMb 2JS4A 2GU2A 3CC21 1JJ2Z 3CCV1 2OOYB 1Z03A 5D1OB 3TDHB 3G6E1 1VQ7Z 4DQYB 2YU9I 4MH4A 1VQ41 1VQ51 5A2Qb 5D1OA 1QYPA 2E2II 2IZ3A 1YHQ1 1N2FA 3F3FC 2R93I 4A3DI 2F4MA 2RT9A 4MXUA 3CCMZ 2M6NA 1L1OC 5AN9F 2Q4ZA 2AYDA 1RQFA 1KQSZ 1QXFA 2QR1B 3BG0B 4RV9A 1I3QI 4RVDA 1NUIA 3S1QI 2DE6A 1YUKA 2PK7A 3NH4A 2NVYI 3CCLZ 4A3MI 3D6WA 1WIIA 2KPIA 2VPYA 4BY1I 4X6AI 4QTTA 1P9NA 3CCR1 2QRCB 1Z02A 3CCEZ 3CPWY 1QVFY 3G4SZ 2B63I 5T64A 5FLXb 3EEDA 2VUMI 2Y0SA 2QLVB 1R9TI 1VQPZ 3Q87A 5C3EI 4BY7I 1S7MA 4QTUA 1N8R1 4A3GI 1NJI2 1QF8A 3HOXI 1K8A2 3GTOI 4TNUA 3BG1B 1KD12 1KC81 3VMIA 4MONA 2NVQI 3G4S1 1RO0A 4HGZA 1Q822 2W03A 4RVGA 2JA8I 3KIHA 1SIWA 1TWFI 3S1NI 1S72Z 1VQ6Z 2VPXA 1JWHC 2H85A 1VQP1 3M3YI 2PM9A 3MZLB 4E31A 2OOXB 3I55Z 1Y1WI 3HOZI 1USPB 1RNIA 1YUAA 3GTMI 4NBCA 3QWUA 1USPA 2LFUA 2AKLA 3G6EZ 3CXCY 3CCU1 4CL1A 4HH4A 3GCFA 1VQ5Z 3F3PC 1PFTA 1YHQZ 3GKQA 3ESWA 1VQ81 4NBAA 4E32A 3VB9A 3CMAZ 2E2JI 1I6HI 5C44I 2Q51A 1W2BY 3IR7A 3OW2Y 5IT9b 1KD11 3M4OI 2RIQA 1VQ91 3PO3I 3LUSA 4NBGA 2OTL1 2JIOA 3J81b 3NFZA 3CC71 3FKII 5D1PA 3S1RI 5C4XI 3CCRZ 3CMA1 1RO2A 2P28A 3GTMS 3HOUI 4A3LI 2QA4Z 2JNYA 1M1K2 1YIT1 2LIYA
chains in the Genus database with same CATH topology
2WB1A 2R7ZI 4A3KI 1M902 1ZB9A 1JJ2Y 3CME1 3T4NB 1Q812 2V8KA 1QVGZ 1VQN1 3CC41 1Q861 4NH1C 3GTPI 4NFRA 5T67A 4A3II 1VQL1 2JR6A 3PO3S 3CCJ1 3CCSZ 2QA41 1KQSY 1RO4A 4A3EI 2P3YA 2JA6I 1YI21 2DE7A 3VTNA 3RZOI 5FLXf 2QKDA 2KI7B 1ML8A 1YJN1 4E2WA 2QEX1 2JMOA 2ZAEB 2O4HA 1VQO1 4NBFA 3I4MI 2VF1A 3G711 1M901 4A3FI 3CCS1 3CCQ1 3S1MI 3CCUZ 1Q811 1K732 3RZDI 3GTJI 1YJ91 3GTLI 3HOVI 4E2YA 1VQ8Z 1K83I 1VLAA 1K9M2 4NBEA 3TE5B 3I07A 3EERA 4BBRI 2QRDB 2OZKA 2HU9A 3J80f 2BJOA 4E2ZA 3HOYI 1VQ9Z 3VMGA 3P5JB 2OTLZ 3CD61 4NOZA 4MD9A 1TWCI 1YIJ1 5T6BA 4S1TA 2QREB 3CC7Z 3J7A4 5CM2M 1I50I 1NJI1 1K8A1 4BXXI 2G2KA 1YITZ 2DE5A 3NDJA 5C4JI 2RBLA 3CMEZ 1Q821 3JAMf 1K731 3GTGI 3MZKB 3CC4Z 1VQNZ 4A3BI 3MONA 1YJW1 3FQMA 2JA7I 2K5RA 3S16I 2I3CA 5A2Qf 1SFOI 1VQLZ 3PO2I 4EWCA 3VMHA 3CCJZ 1X3ZA 2OTJZ 1TWHI 3I56Z 1YI2Z 3S2HI 1LQLA 2HF1A 2JA5I 1TWAI 2J6AA 1YJNZ 3K7AI 2QEXZ 2NVXI 1N8R2 3NDIA 4RS4A 1VQOZ 3S17I 4RVHA 1VQM1 1VQK1 3H3VJ 3G71Z 1TFIA 1KC82 2E2HI 2OTJ1 2IZ4A 3CPWZ 3CCQZ 1QVFZ 3I561 4NBBA 3NH8A 4DK1A 1QVGY 3I4NI 1YJ9Z 5FLMI 4A3CI 1VQ71 2R6MA 4RVFA 1WCMI 3U50C 1Q7Y2 3S14I 2K3RA 1DL6A 3IX0A 1NP6A 4NB8A 4MD8A 1KRLA 4MD7A 3CCM1 1M1K1 4E2XA 4NBHA 3H0GI 3CD6Z 3IF8A 3S15I 5LL6f 2WAQA 1YIJZ 2YADA 3GTQI 4DGLA 3CCL1 1WW9A 2W04A 1TWGI 2E9HA 2EGTA 2RPRA 2NVTI 3CCE1 1YJWZ 4Y52I 1ZH1A 2RHBA 1RLYA 1Y1VI 2F4OA 3CXCZ 5IP7I 3S2DI 1X3WA 1Q7Y1 2O53A 2PMZA 2GTHA 4AYBA 2JUBA 4E33A 3J80b 3GTKI 3D9XA 1X0TA 5IT9f 1W2BZ 3OW2Z 3CC2Z 4MRIA 3CCVZ 3HOWI 4E30A 2R92I 4NBDA 3NH5A 1Q862 1VQ4Z 4A93I 3HKZA 4BBSI 1Z01A 3CQZI 4NB9A 4HGYA 2VUGA 1ZB8A 3J81f 3KIFA 1S721 1VQ61 2GTIA 1K9M1 3FQQA 3IFUA 2V8JA 4XX2A 5IP9I 2V8IA 4Y7NI 1VQMZ 1VQKZ 2M48A 3I551 1Y1VS 4A3JI 3JAMb 2JS4A 2GU2A 3CC21 1JJ2Z 3CCV1 2OOYB 1Z03A 5D1OB 3TDHB 3G6E1 1VQ7Z 4DQYB 2YU9I 4MH4A 1VQ41 1VQ51 5A2Qb 5D1OA 1QYPA 2E2II 2IZ3A 1YHQ1 1N2FA 3F3FC 2R93I 4A3DI 2F4MA 2RT9A 4MXUA 3CCMZ 2M6NA 1L1OC 5AN9F 2Q4ZA 1RQFA 1KQSZ 2QR1B 3BG0B 4RV9A 1I3QI 4RVDA 1NUIA 3S1QI 2DE6A 1YUKA 2PK7A 3NH4A 2NVYI 3CCLZ 4A3MI 3D6WA 1WIIA 2KPIA 4BY1I 4X6AI 4QTTA 1P9NA 3CCR1 2QRCB 1Z02A 3CCEZ 3CPWY 1QVFY 3G4SZ 2B63I 5T64A 5FLXb 3EEDA 2VUMI 2Y0SA 2QLVB 1R9TI 1VQPZ 3Q87A 5C3EI 4BY7I 1S7MA 4QTUA 1N8R1 4A3GI 1NJI2 1QF8A 3HOXI 1K8A2 3GTOI 4TNUA 3BG1B 1KD12 1KC81 3VMIA 4MONA 2NVQI 3G4S1 1RO0A 4HGZA 1Q822 2W03A 4RVGA 2JA8I 3KIHA 1TWFI 3S1NI 1S72Z 1VQ6Z 1JWHC 2H85A 1VQP1 3M3YI 2PM9A 3MZLB 4E31A 2OOXB 3I55Z 1Y1WI 3HOZI 1USPB 1RNIA 1YUAA 3GTMI 4NBCA 3QWUA 1USPA 2LFUA 2AKLA 3G6EZ 3CXCY 3CCU1 4CL1A 4HH4A 3GCFA 1VQ5Z 3F3PC 1PFTA 1YHQZ 3GKQA 3ESWA 1VQ81 4NBAA 4E32A 3VB9A 3CMAZ 2E2JI 1I6HI 5C44I 2Q51A 1W2BY 3OW2Y 5IT9b 1KD11 3M4OI 2RIQA 1VQ91 3PO3I 3LUSA 4NBGA 2OTL1 3J81b 3NFZA 3CC71 3FKII 5D1PA 3S1RI 5C4XI 3CCRZ 3CMA1 1RO2A 2P28A 3GTMS 3HOUI 4A3LI 2QA4Z 2JNYA 1M1K2 1YIT1 2LIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE5 A;  2R7Z I;  4A3K I;  5C4J I;  1ZB9 A;  2B63 I;  2RBL A;  3GTG I;  4A3B I;  4Y52 I;  1RLY A;  1Y1V I;  2F4O A;  3GTP I;  5IP7 I;  2VUM I;  3S2D I;  2JA7 I;  2K5R A;  1R9T I;  3S16 I;  3Q87 A;  1X3W A;  5C3E I;  1SFO I;  4BY7 I;  4QTU A;  4A3G I;  4A3I I;  3HOX I;  3PO2 I;  2JR6 A;  3VMH A;  3GTO I;  3PO3 S;  1X3Z A;  3GTK I;  1TWH I;  1RO4 A;  4A3E I;  2P3Y A;  3VMI A;  2JA6 I;  2NVQ I;  3HOW I;  2DE7 A;  2R92 I;  3S2H I;  4NBD A;  2JA8 I;  4A93 I;  1LQL A;  2NVT I;  3RZO I;  4BBS I;  2HF1 A;  3CQZ I;  2JA5 I;  1TWA I;  1TWF I;  4NB9 A;  2J6A A;  3S1N I;  1ZB8 A;  3K7A I;  1ML8 A;  2NVX I;  3M3Y I;  5IP9 I;  4XX2 A;  4Y7N I;  4NBF A;  3I4M I;  3S17 I;  3H3V J;  1Y1W I;  3HOZ I;  1TFI A;  2E2H I;  1Y1V S;  4A3F I;  4A3J I;  1USP B;  1YUA A;  2JS4 A;  4NBB A;  3GTM I;  4NBC A;  3S1M I;  3I4N I;  1USP A;  2AKL A;  5FLM I;  3RZD I;  3GTJ I;  4A3C I;  3GCF A;  2YU9 I;  4MH4 A;  3GTL I;  1WCM I;  3HOV I;  1QYP A;  1PFT A;  3U50 C;  1K83 I;  2E2I I;  1VLA A;  3GKQ A;  3ESW A;  3S14 I;  4NBE A;  1N2F A;  4NBA A;  1I6H I;  3I07 A;  3VB9 A;  2E2J I;  2R93 I;  1DL6 A;  3EER A;  4NB8 A;  5C44 I;  4A3D I;  2F4M A;  4BBR I;  2BJO A;  1L1O C;  3HOY I;  3M4O I;  4NBH A;  3H0G I;  3VMG A;  3PO3 I;  3LUS A;  4NBG A;  1I3Q I;  1NUI A;  3S1Q I;  2DE6 A;  4NOZ A;  3S15 I;  2PK7 A;  1TWC I;  2NVY I;  3GTQ I;  4A3M I;  3D6W A;  2KPI A;  1WW9 A;  3FKI I;  1TWG I;  5CM2 M;  1I50 I;  3S1R I;  5C4X I;  4BY1 I;  4X6A I;  4QTT A;  4BXX I;  3GTM S;  3HOU I;  4A3L I;  2JNY A; 
#chains in the Genus database with same CATH topology
 2WB1 A;  2R7Z I;  4A3K I;  1M90 2;  1ZB9 A;  1JJ2 Y;  3CME 1;  3T4N B;  1Y8C A;  1Q81 2;  2V8K A;  1QVG Z;  1VQN 1;  3CC4 1;  1Q86 1;  4NH1 C;  3GTP I;  4NFR A;  5T67 A;  4A3I I;  1VQL 1;  2JR6 A;  3PO3 S;  3CCJ 1;  3CCS Z;  2QA4 1;  1KQS Y;  1RO4 A;  4A3E I;  2P3Y A;  2JA6 I;  1YI2 1;  2DE7 A;  3VTN A;  3RZO I;  5FLX f;  2QKD A;  2KI7 B;  1ML8 A;  1YJN 1;  4E2W A;  2QEX 1;  2JMO A;  2VPW A;  1AA6 A;  2ZAE B;  2O4H A;  1VQO 1;  4NBF A;  3I4M I;  2VF1 A;  3G71 1;  1M90 1;  2JIR A;  4A3F I;  3CCS 1;  3CCQ 1;  3S1M I;  3CCU Z;  1Q81 1;  1K73 2;  3RZD I;  3GTJ I;  1YJ9 1;  3GTL I;  3HOV I;  1FDO A;  4E2Y A;  1K83 I;  1VQ8 Z;  1VLA A;  1K9M 2;  2IV2 X;  4NBE A;  3TE5 B;  3I07 A;  3EER A;  4BBR I;  2QRD B;  2OZK A;  2HU9 A;  3J80 f;  2BJO A;  4E2Z A;  3HOY I;  1WJ2 A;  2VPZ A;  1VQ9 Z;  3VMG A;  3P5J B;  2OTL Z;  3CD6 1;  4NOZ A;  4MD9 A;  1TWC I;  1YIJ 1;  5T6B A;  4S1T A;  2QRE B;  3CC7 Z;  3J7A 4;  5CM2 M;  1I50 I;  1NJI 1;  1K8A 1;  4BXX I;  2G2K A;  1YIT Z;  1FDI A;  2DE5 A;  2E7Z A;  3NDJ A;  5C4J I;  2JIQ A;  2RBL A;  3CME Z;  1Q82 1;  3JAM f;  1K73 1;  3GTG I;  3MZK B;  3CC4 Z;  1VQN Z;  4A3B I;  3MON A;  1YJW 1;  3FQM A;  2JA7 I;  2K5R A;  3S16 I;  2I3C A;  5A2Q f;  1SFO I;  1VQL Z;  3PO2 I;  4EWC A;  3VMH A;  3CCJ Z;  1X3Z A;  2OTJ Z;  1TWH I;  3I56 Z;  1YI2 Z;  3S2H I;  1LQL A;  2HF1 A;  2JA5 I;  1TWA I;  2J6A A;  1YJN Z;  3K7A I;  2QEX Z;  2NVX I;  1N8R 2;  3NDI A;  4RS4 A;  1VQO Z;  3S17 I;  4RVH A;  1VQM 1;  1VQK 1;  3H3V J;  3G71 Z;  1TFI A;  1KC8 2;  2E2H I;  2OTJ 1;  2IZ4 A;  3CPW Z;  3CCQ Z;  1QVF Z;  3I56 1;  4NBB A;  3NH8 A;  4DK1 A;  1QVG Y;  3I4N I;  2JIP A;  1YJ9 Z;  5FLM I;  4A3C I;  1VQ7 1;  2R6M A;  4RVF A;  2V45 A;  1WCM I;  3U50 C;  1Q7Y 2;  3S14 I;  2K3R A;  1DL6 A;  3IX0 A;  1NP6 A;  4NB8 A;  4MD8 A;  1KRL A;  4MD7 A;  3CCM 1;  1M1K 1;  4E2X A;  4NBH A;  3H0G I;  3CD6 Z;  3IF8 A;  3S15 I;  5LL6 f;  2WAQ A;  1YIJ Z;  2YAD A;  3GTQ I;  4DGL A;  3CCL 1;  1WW9 A;  1Q16 A;  2W04 A;  1TWG I;  2E9H A;  2EGT A;  2RPR A;  2NVT I;  3CCE 1;  3D2L A;  2NAP A;  1YJW Z;  4Y52 I;  1ZH1 A;  2RHB A;  1RLY A;  1Y1V I;  2F4O A;  3CXC Z;  5IP7 I;  3S2D I;  1X3W A;  1Q7Y 1;  2O53 A;  2PMZ A;  2GTH A;  4AYB A;  2JUB A;  4E33 A;  3J80 b;  2JIM A;  3GTK I;  3D9X A;  1X0T A;  5IT9 f;  1W2B Z;  3OW2 Z;  3CC2 Z;  4MRI A;  3CCV Z;  3HOW I;  4E30 A;  2R92 I;  1WZN A;  2LEX A;  4NBD A;  2V3V A;  3NH5 A;  1Q86 2;  1VQ4 Z;  4A93 I;  3HKZ A;  4BBS I;  1Z01 A;  3CQZ I;  4NB9 A;  4HGY A;  2VUG A;  1ZB8 A;  3J81 f;  3KIF A;  1S72 1;  1VQ6 1;  2GTI A;  1K9M 1;  3FQQ A;  3IFU A;  2V8J A;  4XX2 A;  5IP9 I;  2V8I A;  4Y7N I;  1VQM Z;  1VQK Z;  2M48 A;  3I55 1;  1Y1V S;  4A3J I;  3JAM b;  2JS4 A;  2GU2 A;  3CC2 1;  1JJ2 Z;  3CCV 1;  2OOY B;  1Z03 A;  5D1O B;  3TDH B;  3G6E 1;  1VQ7 Z;  4DQY B;  2YU9 I;  4MH4 A;  1VQ4 1;  1VQ5 1;  5A2Q b;  5D1O A;  1QYP A;  2E2I I;  2IZ3 A;  1YHQ 1;  1N2F A;  3F3F C;  2R93 I;  4A3D I;  2F4M A;  2RT9 A;  4MXU A;  3CCM Z;  2M6N A;  1L1O C;  5AN9 F;  2Q4Z A;  2AYD A;  1RQF A;  1KQS Z;  1QXF A;  2QR1 B;  3BG0 B;  4RV9 A;  1I3Q I;  4RVD A;  1NUI A;  3S1Q I;  2DE6 A;  1YUK A;  2PK7 A;  3NH4 A;  2NVY I;  3CCL Z;  4A3M I;  3D6W A;  1WII A;  2KPI A;  2VPY A;  4BY1 I;  4X6A I;  4QTT A;  1P9N A;  3CCR 1;  2QRC B;  1Z02 A;  3CCE Z;  3CPW Y;  1QVF Y;  3G4S Z;  2B63 I;  5T64 A;  5FLX b;  3EED A;  2VUM I;  2Y0S A;  2QLV B;  1R9T I;  1VQP Z;  3Q87 A;  5C3E I;  4BY7 I;  1S7M A;  4QTU A;  1N8R 1;  4A3G I;  1NJI 2;  1QF8 A;  3HOX I;  1K8A 2;  3GTO I;  4TNU A;  3BG1 B;  1KD1 2;  1KC8 1;  3VMI A;  4MON A;  2NVQ I;  3G4S 1;  1RO0 A;  4HGZ A;  1Q82 2;  2W03 A;  4RVG A;  2JA8 I;  3KIH A;  1SIW A;  1TWF I;  3S1N I;  1S72 Z;  1VQ6 Z;  2VPX A;  1JWH C;  2H85 A;  1VQP 1;  3M3Y I;  2PM9 A;  3MZL B;  4E31 A;  2OOX B;  3I55 Z;  1Y1W I;  3HOZ I;  1USP B;  1RNI A;  1YUA A;  3GTM I;  4NBC A;  3QWU A;  1USP A;  2LFU A;  2AKL A;  3G6E Z;  3CXC Y;  3CCU 1;  4CL1 A;  4HH4 A;  3GCF A;  1VQ5 Z;  3F3P C;  1PFT A;  1YHQ Z;  3GKQ A;  3ESW A;  1VQ8 1;  4NBA A;  4E32 A;  3VB9 A;  3CMA Z;  2E2J I;  1I6H I;  5C44 I;  2Q51 A;  1W2B Y;  3IR7 A;  3OW2 Y;  5IT9 b;  1KD1 1;  3M4O I;  2RIQ A;  1VQ9 1;  3PO3 I;  3LUS A;  4NBG A;  2OTL 1;  2JIO A;  3J81 b;  3NFZ A;  3CC7 1;  3FKI I;  5D1P A;  3S1R I;  5C4X I;  3CCR Z;  3CMA 1;  1RO2 A;  2P28 A;  3GTM S;  3HOU I;  4A3L I;  2QA4 Z;  2JNY A;  1M1K 2;  1YIT 1;  2LIY A; 
#chains in the Genus database with same CATH homology
 2WB1 A;  2R7Z I;  4A3K I;  1M90 2;  1ZB9 A;  1JJ2 Y;  3CME 1;  3T4N B;  1Q81 2;  2V8K A;  1QVG Z;  1VQN 1;  3CC4 1;  1Q86 1;  4NH1 C;  3GTP I;  4NFR A;  5T67 A;  4A3I I;  1VQL 1;  2JR6 A;  3PO3 S;  3CCJ 1;  3CCS Z;  2QA4 1;  1KQS Y;  1RO4 A;  4A3E I;  2P3Y A;  2JA6 I;  1YI2 1;  2DE7 A;  3VTN A;  3RZO I;  5FLX f;  2QKD A;  2KI7 B;  1ML8 A;  1YJN 1;  4E2W A;  2QEX 1;  2JMO A;  2ZAE B;  2O4H A;  1VQO 1;  4NBF A;  3I4M I;  2VF1 A;  3G71 1;  1M90 1;  4A3F I;  3CCS 1;  3CCQ 1;  3S1M I;  3CCU Z;  1Q81 1;  1K73 2;  3RZD I;  3GTJ I;  1YJ9 1;  3GTL I;  3HOV I;  4E2Y A;  1VQ8 Z;  1K83 I;  1VLA A;  1K9M 2;  4NBE A;  3TE5 B;  3I07 A;  3EER A;  4BBR I;  2QRD B;  2OZK A;  2HU9 A;  3J80 f;  2BJO A;  4E2Z A;  3HOY I;  1VQ9 Z;  3VMG A;  3P5J B;  2OTL Z;  3CD6 1;  4NOZ A;  4MD9 A;  1TWC I;  1YIJ 1;  5T6B A;  4S1T A;  2QRE B;  3CC7 Z;  3J7A 4;  5CM2 M;  1I50 I;  1NJI 1;  1K8A 1;  4BXX I;  2G2K A;  1YIT Z;  2DE5 A;  3NDJ A;  5C4J I;  2RBL A;  3CME Z;  1Q82 1;  3JAM f;  1K73 1;  3GTG I;  3MZK B;  3CC4 Z;  1VQN Z;  4A3B I;  3MON A;  1YJW 1;  3FQM A;  2JA7 I;  2K5R A;  3S16 I;  2I3C A;  5A2Q f;  1SFO I;  1VQL Z;  3PO2 I;  4EWC A;  3VMH A;  3CCJ Z;  1X3Z A;  2OTJ Z;  1TWH I;  3I56 Z;  1YI2 Z;  3S2H I;  1LQL A;  2HF1 A;  2JA5 I;  1TWA I;  2J6A A;  1YJN Z;  3K7A I;  2QEX Z;  2NVX I;  1N8R 2;  3NDI A;  4RS4 A;  1VQO Z;  3S17 I;  4RVH A;  1VQM 1;  1VQK 1;  3H3V J;  3G71 Z;  1TFI A;  1KC8 2;  2E2H I;  2OTJ 1;  2IZ4 A;  3CPW Z;  3CCQ Z;  1QVF Z;  3I56 1;  4NBB A;  3NH8 A;  4DK1 A;  1QVG Y;  3I4N I;  1YJ9 Z;  5FLM I;  4A3C I;  1VQ7 1;  2R6M A;  4RVF A;  1WCM I;  3U50 C;  1Q7Y 2;  3S14 I;  2K3R A;  1DL6 A;  3IX0 A;  1NP6 A;  4NB8 A;  4MD8 A;  1KRL A;  4MD7 A;  3CCM 1;  1M1K 1;  4E2X A;  4NBH A;  3H0G I;  3CD6 Z;  3IF8 A;  3S15 I;  5LL6 f;  2WAQ A;  1YIJ Z;  2YAD A;  3GTQ I;  4DGL A;  3CCL 1;  1WW9 A;  2W04 A;  1TWG I;  2E9H A;  2EGT A;  2RPR A;  2NVT I;  3CCE 1;  1YJW Z;  4Y52 I;  1ZH1 A;  2RHB A;  1RLY A;  1Y1V I;  2F4O A;  3CXC Z;  5IP7 I;  3S2D I;  1X3W A;  1Q7Y 1;  2O53 A;  2PMZ A;  2GTH A;  4AYB A;  2JUB A;  4E33 A;  3J80 b;  3GTK I;  3D9X A;  1X0T A;  5IT9 f;  1W2B Z;  3OW2 Z;  3CC2 Z;  4MRI A;  3CCV Z;  3HOW I;  4E30 A;  2R92 I;  4NBD A;  3NH5 A;  1Q86 2;  1VQ4 Z;  4A93 I;  3HKZ A;  4BBS I;  1Z01 A;  3CQZ I;  4NB9 A;  4HGY A;  2VUG A;  1ZB8 A;  3J81 f;  3KIF A;  1S72 1;  1VQ6 1;  2GTI A;  1K9M 1;  3FQQ A;  3IFU A;  2V8J A;  4XX2 A;  5IP9 I;  2V8I A;  4Y7N I;  1VQM Z;  1VQK Z;  2M48 A;  3I55 1;  1Y1V S;  4A3J I;  3JAM b;  2JS4 A;  2GU2 A;  3CC2 1;  1JJ2 Z;  3CCV 1;  2OOY B;  1Z03 A;  5D1O B;  3TDH B;  3G6E 1;  1VQ7 Z;  4DQY B;  2YU9 I;  4MH4 A;  1VQ4 1;  1VQ5 1;  5A2Q b;  5D1O A;  1QYP A;  2E2I I;  2IZ3 A;  1YHQ 1;  1N2F A;  3F3F C;  2R93 I;  4A3D I;  2F4M A;  2RT9 A;  4MXU A;  3CCM Z;  2M6N A;  1L1O C;  5AN9 F;  2Q4Z A;  1RQF A;  1KQS Z;  2QR1 B;  3BG0 B;  4RV9 A;  1I3Q I;  4RVD A;  1NUI A;  3S1Q I;  2DE6 A;  1YUK A;  2PK7 A;  3NH4 A;  2NVY I;  3CCL Z;  4A3M I;  3D6W A;  1WII A;  2KPI A;  4BY1 I;  4X6A I;  4QTT A;  1P9N A;  3CCR 1;  2QRC B;  1Z02 A;  3CCE Z;  3CPW Y;  1QVF Y;  3G4S Z;  2B63 I;  5T64 A;  5FLX b;  3EED A;  2VUM I;  2Y0S A;  2QLV B;  1R9T I;  1VQP Z;  3Q87 A;  5C3E I;  4BY7 I;  1S7M A;  4QTU A;  1N8R 1;  4A3G I;  1NJI 2;  1QF8 A;  3HOX I;  1K8A 2;  3GTO I;  4TNU A;  3BG1 B;  1KD1 2;  1KC8 1;  3VMI A;  4MON A;  2NVQ I;  3G4S 1;  1RO0 A;  4HGZ A;  1Q82 2;  2W03 A;  4RVG A;  2JA8 I;  3KIH A;  1TWF I;  3S1N I;  1S72 Z;  1VQ6 Z;  1JWH C;  2H85 A;  1VQP 1;  3M3Y I;  2PM9 A;  3MZL B;  4E31 A;  2OOX B;  3I55 Z;  1Y1W I;  3HOZ I;  1USP B;  1RNI A;  1YUA A;  3GTM I;  4NBC A;  3QWU A;  1USP A;  2LFU A;  2AKL A;  3G6E Z;  3CXC Y;  3CCU 1;  4CL1 A;  4HH4 A;  3GCF A;  1VQ5 Z;  3F3P C;  1PFT A;  1YHQ Z;  3GKQ A;  3ESW A;  1VQ8 1;  4NBA A;  4E32 A;  3VB9 A;  3CMA Z;  2E2J I;  1I6H I;  5C44 I;  2Q51 A;  1W2B Y;  3OW2 Y;  5IT9 b;  1KD1 1;  3M4O I;  2RIQ A;  1VQ9 1;  3PO3 I;  3LUS A;  4NBG A;  2OTL 1;  3J81 b;  3NFZ A;  3CC7 1;  3FKI I;  5D1P A;  3S1R I;  5C4X I;  3CCR Z;  3CMA 1;  1RO2 A;  2P28 A;  3GTM S;  3HOU I;  4A3L I;  2QA4 Z;  2JNY A;  1M1K 2;  1YIT 1;  2LIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...