3M3YI

Rna polymerase ii elongation complex c
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 11
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m3yI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m3yI02
1I6HI 1SFOI 3S15I 3GTQI 1TWCI 3GTGI 3K7AI 4BY7I 3GTOI 2E2II 4A3BI 1R9TI 4BY1I 3VMIA 3GTLI 4A93I 2NVYI 2JA5I 4NBAA 4NB9A 1TWFI 3U50C 2R92I 2P3YA 2PK7A 3S16I 3PO3I 4NBDA 4NB8A 3VB9A 3S1RI 3VMGA 3GTPI 1Y1VS 4BBRI 3S14I 5C44I 2NVQI 3RZDI 1L1OC 1X3ZA 1TFIA 2K5RA 1Y1VI 3GTKI 3GKQA 5C4XI 3EERA 2HF1A 1X3WA 2JA8I 4Y52I 3RZOI 5IP7I 2JS4A 4QTUA 2R93I 3PO2I 1I3QI 2NVTI 3CQZI 3PO3S 3M4OI 1NUIA 3S2HI 3GTMS 1ZB9A 4A3GI 1ZB8A 3H3VJ 4Y7NI 3D6WA 4A3CI 4NBGA 2J6AA 4NBEA 2E2JI 2JNYA 5FLMI 3I4MI 4QTTA 4BBSI 3HOYI 1DL6A 4A3LI 3GTMI 3HOVI 4NBFA 1TWHI 2F4MA 4A3II 3S1QI 2AKLA 2VUMI 1RLYA 4NBCA 3S1MI 2E2HI 1USPA 3LUSA 3HOWI 4MH4A 3M3YI 3S17I 4A3KI 2B63I 1ML8A 3HOXI 1PFTA 2BJOA 4XX2A 3VMHA 1TWAI 2RBLA 3GCFA 3I07A 4A3JI 1LQLA 1WCMI 3S1NI 2JR6A 4A3MI 1K83I 3Q87A 2F4OA 2KPIA 3GTJI 4NBBA 3HOUI 4A3FI 2JA7I 2NVXI 1USPB 2DE6A 4X6AI 3ESWA 1TWGI 1I50I 2JA6I 5C3EI 5IP9I 4NBHA 2YU9I 5C4JI 1WW9A 3HOZI 5CM2M 1Y1WI 4A3DI 1RO4A 2DE7A 1QYPA 3I4NI 4BXXI 2R7ZI 1VLAA 3S2DI 1N2FA 4A3EI 2DE5A 1YUAA 3FKII 4NOZA 3H0GI
chains in the Genus database with same CATH superfamily
4BY7I 3CCUZ 5D1OA 1R9TI 1N8R2 3G6EZ 3CCEZ 4E33A 4NB9A 1KC81 1TWFI 3CC4Z 1W2BY 3U50C 1FDOA 4NH1C 2PK7A 3PO3I 1S721 3CC2Z 2JIMA 4HGZA 1Q821 3CMEZ 2NVQI 1VQ4Z 3RZDI 1X3ZA 3GTKI 3GKQA 5C4XI 1VQ5Z 2JA8I 5IP7I 2OZKA 2VPWA 1YIJ1 1QVGY 5A2Qf 3PO3S 1NUIA 4A3GI 3H3VJ 2OTL1 2J6AA 3P5JB 4QTTA 2QLVB 2R6MA 1DL6A 3GTMI 1TWHI 4MD8A 2QEX1 1KD11 2AKLA 2VUMI 3CMA1 2E2HI 4MH4A 1NJI1 3M3YI 1RO0A 1K9M1 4HGYA 1NP6A 3VMHA 3JAMf 3OW2Z 3NDJA 5A2Qb 4A3MI 2KPIA 3GTJI 1Q7Y2 1VQN1 2W04A 2JA7I 2PM9A 3CCM1 4E2WA 3J81f 3CD61 4X6AI 2JUBA 1VQPZ 3CCV1 2JA6I 2PMZA 1YJ9Z 1VQ61 5C4JI 3CCJZ 1WW9A 3FQQA 3JAMb 1S7MA 1M1K1 4MONA 2R7ZI 3S2DI 3F3FC 1N2FA 3MZKB 2DE5A 1YUAA 2V8IA 3FKII 3H0GI 3MONA 3IR7A 1I6HI 3S15I 1KC82 1VQLZ 3K7AI 1WIIA 4E32A 1W2BZ 3GTOI 3VMIA 4S1TA 3GTLI 1VQ9Z 2JA5I 1Q16A 2R92I 2P3YA 2G2KA 1YI21 2P28A 3S1RI 3VMGA 3EEDA 5C44I 1YHQZ 1QVGZ 5T6BA 1YIT1 4CL1A 2K5RA 3NH5A 2W03A 1VQ7Z 3KIHA 3CPWY 2HU9A 3I551 1KRLA 1VQKZ 2AYDA 3RZOI 1FDIA 1Q811 1I3QI 3CQZI 1RNIA 5D1PA 3MZLB 2QRDB 1P9NA 2QKDA 1VQ81 4NBEA 2WAQA 2E2JI 2JNYA 3I561 2M48A 4BBSI 4A3LI 1K9M2 3VTNA 1M902 3S1QI 1RQFA 4EWCA 1RLYA 1K732 3CC7Z 1Z01A 3CCU1 3HOWI 3QWUA 3S17I 4A3KI 3G6E1 3CCLZ 3CCE1 3BG0B 3CC41 3HOXI 3CCSZ 4XX2A 2RBLA 4A3JI 1RO2A 1Q861 3CC21 1YJNZ 3CME1 1VQ41 2Q4ZA 3J80f 2K3RA 2DE6A 3HKZA 1VQ51 2VPZA 3CCRZ 3NFZA 5IP9I 2QR1B 2IV2X 1RO4A 1QYPA 1N8R1 3I4NI 1JWHC 3D9XA 1Z02A 2QA4Z 1K8A2 3NDIA 2JMOA 3J80b 2VPXA 2LFUA 3GTGI 3CCQZ 3G71Z 4RVFA 2E2II 2JIQA 4BY1I 4DGLA 1VQOZ 2RHBA 4NBAA 4RVDA 2QA41 4NBDA 4NB8A 2JIOA 3VB9A 1KQSY 1YJWZ 3GTPI 1Y1VS 1VQP1 4E2YA 3CPWZ 2I3CA 1Q812 1L1OC 3F3PC 1QF8A 2RPRA 2OTJZ 1WJ2A 3EERA 1QXFA 1YJ91 4Y52I 3J81b 3CCJ1 5T64A 4QTUA 2NVTI 1ZB9A 3CXCY 1Q822 1ZB8A 2V3VA 4Y7NI 3IX0A 4A3CI 4NBGA 5FLMI 4TNUA 3I4MI 3TDHB 4NBFA 4MD9A 2OTJ1 1VQL1 3S1MI 1YUKA 1VQMZ 2OOXB 1Q7Y1 1VQ91 5FLXf 3KIFA 4E31A 2O53A 1PFTA 1TWAI 3GCFA 1WCMI 3S1NI 1KD12 2GTHA 2JR6A 3IFUA 3Q87A 2VPYA 1ZH1A 1YHQ1 1NJI2 2JIRA 2QRCB 2E9HA 1S72Z 2NVXI 4E30A 1USPB 3NH4A 1VQ71 3ESWA 1VQK1 2V45A 4MD7A 1JJ2Y 1I50I 5IT9f 2KI7B 5C3EI 4DQYB 1QVFY 4NBHA 2YU9I 5FLXb 4RS4A 1YIJZ 1Y1WI 4BXXI 1Z03A 3IF8A 3CC71 1VLAA 2OTLZ 2GTIA 3CCL1 4NOZA 4RV9A 1SFOI 3GTQI 2QEXZ 2QREB 1TWCI 3CCS1 3CMAZ 2VF1A 4A3BI 3FQMA 2IZ3A 1YJN1 1KQSZ 4A93I 5IT9b 2NVYI 1M1K2 2GU2A 2RIQA 4MXUA 3S16I 2ZAEB 4AYBA 4BBRI 3S14I 2VUGA 2LEXA 3CCR1 1TFIA 1VQNZ 5D1OB 1Y1VI 5T67A 3CCMZ 1M901 3CD6Z 3CXCZ 3G4SZ 2HF1A 1X3WA 3BG1B 4RVGA 2WB1A 3CCVZ 1K731 2JS4A 2R93I 3PO2I 2Y0SA 3M4OI 3S2HI 3GTMS 3D6WA 1VQ6Z 2V8KA 3HOYI 4DK1A 3HOVI 2F4MA 4A3II 2RT9A 4NBCA 3G4S1 3CCQ1 4E2ZA 3T4NB 3G711 1USPA 3LUSA 1SIWA 5AN9F 2EGTA 1VQO1 2B63I 3TE5B 1ML8A 2BJOA 2H85A 1X0TA 3I07A 1LQLA 2E7ZA 1WZNA 1YJW1 3J7A4 2LIYA 1K83I 2F4OA 3D2LA 4NBBA 1JJ2Z 4A3FI 3HOUI 2M6NA 4MRIA 3OW2Y 1YI2Z 2Q51A 1QVFZ 4E2XA 1TWGI 2YADA 1Q862 1K8A1 1YITZ 1Y8CA 4NFRA 3NH8A 3I55Z 2IZ4A 2O4HA 3HOZI 5CM2M 5LL6f 4HH4A 4A3DI 2DE7A 1AA6A 2OOYB 1VQM1 4RVHA 2JIPA 4A3EI 1VQ8Z 2NAPA 3I56Z 2V8JA
chains in the Genus database with same CATH topology
4BY7I 3CCUZ 5D1OA 1R9TI 1N8R2 3G6EZ 3CCEZ 4E33A 4NB9A 1KC81 1TWFI 3CC4Z 1W2BY 3U50C 4NH1C 2PK7A 3PO3I 1S721 3CC2Z 4HGZA 1Q821 3CMEZ 2NVQI 1VQ4Z 3RZDI 1X3ZA 3GTKI 3GKQA 5C4XI 1VQ5Z 2JA8I 5IP7I 2OZKA 1YIJ1 1QVGY 5A2Qf 3PO3S 1NUIA 4A3GI 3H3VJ 2OTL1 2J6AA 3P5JB 4QTTA 2QLVB 2R6MA 1DL6A 3GTMI 1TWHI 4MD8A 2QEX1 1KD11 2AKLA 2VUMI 3CMA1 2E2HI 4MH4A 1NJI1 3M3YI 1RO0A 1K9M1 4HGYA 1NP6A 3VMHA 3JAMf 3OW2Z 3NDJA 5A2Qb 4A3MI 2KPIA 3GTJI 1Q7Y2 1VQN1 2W04A 2JA7I 2PM9A 3CCM1 4E2WA 3J81f 3CD61 4X6AI 2JUBA 1VQPZ 3CCV1 2JA6I 2PMZA 1YJ9Z 1VQ61 5C4JI 3CCJZ 1WW9A 3FQQA 3JAMb 1S7MA 1M1K1 4MONA 2R7ZI 3S2DI 3F3FC 1N2FA 3MZKB 2DE5A 1YUAA 2V8IA 3FKII 3H0GI 3MONA 1I6HI 3S15I 1KC82 1VQLZ 3K7AI 1WIIA 4E32A 1W2BZ 3GTOI 3VMIA 4S1TA 3GTLI 1VQ9Z 2JA5I 2R92I 2P3YA 2G2KA 1YI21 2P28A 3S1RI 3VMGA 3EEDA 5C44I 1YHQZ 1QVGZ 5T6BA 1YIT1 4CL1A 2K5RA 3NH5A 2W03A 1VQ7Z 3KIHA 3CPWY 2HU9A 3I551 1KRLA 1VQKZ 3RZOI 1Q811 1I3QI 3CQZI 1RNIA 5D1PA 3MZLB 2QRDB 1P9NA 2QKDA 1VQ81 4NBEA 2WAQA 2E2JI 2JNYA 3I561 2M48A 4BBSI 4A3LI 1K9M2 3VTNA 1M902 3S1QI 1RQFA 4EWCA 1RLYA 1K732 3CC7Z 1Z01A 3CCU1 3HOWI 3QWUA 3S17I 4A3KI 3G6E1 3CCLZ 3CCE1 3BG0B 3CC41 3HOXI 3CCSZ 4XX2A 2RBLA 4A3JI 1RO2A 1Q861 3CC21 1YJNZ 3CME1 1VQ41 2Q4ZA 3J80f 2K3RA 2DE6A 3HKZA 1VQ51 3CCRZ 3NFZA 5IP9I 2QR1B 1RO4A 1QYPA 1N8R1 3I4NI 1JWHC 3D9XA 1Z02A 2QA4Z 1K8A2 3NDIA 2JMOA 3J80b 2LFUA 3GTGI 3CCQZ 3G71Z 4RVFA 2E2II 4BY1I 4DGLA 1VQOZ 2RHBA 4NBAA 4RVDA 2QA41 4NBDA 4NB8A 3VB9A 1KQSY 1YJWZ 3GTPI 1Y1VS 1VQP1 4E2YA 3CPWZ 2I3CA 1Q812 1L1OC 3F3PC 1QF8A 2RPRA 2OTJZ 3EERA 1YJ91 4Y52I 3J81b 3CCJ1 5T64A 4QTUA 2NVTI 1ZB9A 3CXCY 1Q822 1ZB8A 4Y7NI 3IX0A 4A3CI 4NBGA 5FLMI 4TNUA 3I4MI 3TDHB 4NBFA 4MD9A 2OTJ1 1VQL1 3S1MI 1YUKA 1VQMZ 2OOXB 1Q7Y1 1VQ91 5FLXf 3KIFA 4E31A 2O53A 1PFTA 1TWAI 3GCFA 1WCMI 3S1NI 1KD12 2GTHA 2JR6A 3IFUA 3Q87A 1ZH1A 1YHQ1 1NJI2 2QRCB 2E9HA 1S72Z 2NVXI 4E30A 1USPB 3NH4A 1VQ71 3ESWA 1VQK1 4MD7A 1JJ2Y 1I50I 5IT9f 2KI7B 5C3EI 4DQYB 1QVFY 4NBHA 2YU9I 5FLXb 4RS4A 1YIJZ 1Y1WI 4BXXI 1Z03A 3IF8A 3CC71 1VLAA 2OTLZ 2GTIA 3CCL1 4NOZA 4RV9A 1SFOI 3GTQI 2QEXZ 2QREB 1TWCI 3CCS1 3CMAZ 2VF1A 4A3BI 3FQMA 2IZ3A 1YJN1 1KQSZ 4A93I 5IT9b 2NVYI 1M1K2 2GU2A 2RIQA 4MXUA 3S16I 2ZAEB 4AYBA 4BBRI 3S14I 2VUGA 3CCR1 1TFIA 1VQNZ 5D1OB 1Y1VI 5T67A 3CCMZ 1M901 3CD6Z 3CXCZ 3G4SZ 2HF1A 1X3WA 3BG1B 4RVGA 2WB1A 3CCVZ 1K731 2JS4A 2R93I 3PO2I 2Y0SA 3M4OI 3S2HI 3GTMS 3D6WA 1VQ6Z 2V8KA 3HOYI 4DK1A 3HOVI 2F4MA 4A3II 2RT9A 4NBCA 3G4S1 3CCQ1 4E2ZA 3T4NB 3G711 1USPA 3LUSA 5AN9F 2EGTA 1VQO1 2B63I 3TE5B 1ML8A 2BJOA 2H85A 1X0TA 3I07A 1LQLA 1YJW1 3J7A4 2LIYA 1K83I 2F4OA 4NBBA 1JJ2Z 4A3FI 3HOUI 2M6NA 4MRIA 3OW2Y 1YI2Z 2Q51A 1QVFZ 4E2XA 1TWGI 2YADA 1Q862 1K8A1 1YITZ 4NFRA 3NH8A 3I55Z 2IZ4A 2O4HA 3HOZI 5CM2M 5LL6f 4HH4A 4A3DI 2DE7A 2OOYB 1VQM1 4RVHA 1VQ8Z 4A3EI 3I56Z 2V8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6H I;  1SFO I;  3S15 I;  3GTQ I;  1TWC I;  3GTG I;  3K7A I;  4BY7 I;  3GTO I;  2E2I I;  4A3B I;  1R9T I;  4BY1 I;  3VMI A;  3GTL I;  4A93 I;  2NVY I;  2JA5 I;  4NBA A;  4NB9 A;  1TWF I;  3U50 C;  2R92 I;  2P3Y A;  2PK7 A;  3S16 I;  3PO3 I;  4NBD A;  4NB8 A;  3VB9 A;  3S1R I;  3VMG A;  3GTP I;  1Y1V S;  4BBR I;  3S14 I;  5C44 I;  2NVQ I;  3RZD I;  1L1O C;  1X3Z A;  1TFI A;  2K5R A;  1Y1V I;  3GTK I;  3GKQ A;  5C4X I;  3EER A;  2HF1 A;  1X3W A;  2JA8 I;  4Y52 I;  3RZO I;  5IP7 I;  2JS4 A;  4QTU A;  2R93 I;  3PO2 I;  1I3Q I;  2NVT I;  3CQZ I;  3PO3 S;  3M4O I;  1NUI A;  3S2H I;  3GTM S;  1ZB9 A;  4A3G I;  1ZB8 A;  3H3V J;  4Y7N I;  3D6W A;  4A3C I;  4NBG A;  2J6A A;  4NBE A;  2E2J I;  2JNY A;  5FLM I;  3I4M I;  4QTT A;  4BBS I;  3HOY I;  1DL6 A;  4A3L I;  3GTM I;  3HOV I;  4NBF A;  1TWH I;  2F4M A;  4A3I I;  3S1Q I;  2AKL A;  2VUM I;  1RLY A;  4NBC A;  3S1M I;  2E2H I;  1USP A;  3LUS A;  3HOW I;  4MH4 A;  3M3Y I;  3S17 I;  4A3K I;  2B63 I;  1ML8 A;  3HOX I;  1PFT A;  2BJO A;  4XX2 A;  3VMH A;  1TWA I;  2RBL A;  3GCF A;  3I07 A;  4A3J I;  1LQL A;  1WCM I;  3S1N I;  2JR6 A;  4A3M I;  1K83 I;  3Q87 A;  2F4O A;  2KPI A;  3GTJ I;  4NBB A;  3HOU I;  4A3F I;  2JA7 I;  2NVX I;  1USP B;  2DE6 A;  4X6A I;  3ESW A;  1TWG I;  1I50 I;  2JA6 I;  5C3E I;  5IP9 I;  4NBH A;  2YU9 I;  5C4J I;  1WW9 A;  3HOZ I;  5CM2 M;  1Y1W I;  4A3D I;  1RO4 A;  2DE7 A;  1QYP A;  3I4N I;  4BXX I;  2R7Z I;  1VLA A;  3S2D I;  1N2F A;  4A3E I;  2DE5 A;  1YUA A;  3FKI I;  4NOZ A;  3H0G I; 
#chains in the Genus database with same CATH topology
 4BY7 I;  3CCU Z;  5D1O A;  1R9T I;  1N8R 2;  3G6E Z;  3CCE Z;  4E33 A;  4NB9 A;  1KC8 1;  1TWF I;  3CC4 Z;  1W2B Y;  3U50 C;  1FDO A;  4NH1 C;  2PK7 A;  3PO3 I;  1S72 1;  3CC2 Z;  2JIM A;  4HGZ A;  1Q82 1;  3CME Z;  2NVQ I;  1VQ4 Z;  3RZD I;  1X3Z A;  3GTK I;  3GKQ A;  5C4X I;  1VQ5 Z;  2JA8 I;  5IP7 I;  2OZK A;  2VPW A;  1YIJ 1;  1QVG Y;  5A2Q f;  3PO3 S;  1NUI A;  4A3G I;  3H3V J;  2OTL 1;  2J6A A;  3P5J B;  4QTT A;  2QLV B;  2R6M A;  1DL6 A;  3GTM I;  1TWH I;  4MD8 A;  2QEX 1;  1KD1 1;  2AKL A;  2VUM I;  3CMA 1;  2E2H I;  4MH4 A;  1NJI 1;  3M3Y I;  1RO0 A;  1K9M 1;  4HGY A;  1NP6 A;  3VMH A;  3JAM f;  3OW2 Z;  3NDJ A;  5A2Q b;  4A3M I;  2KPI A;  3GTJ I;  1Q7Y 2;  1VQN 1;  2W04 A;  2JA7 I;  2PM9 A;  3CCM 1;  4E2W A;  3J81 f;  3CD6 1;  4X6A I;  2JUB A;  1VQP Z;  3CCV 1;  2JA6 I;  2PMZ A;  1YJ9 Z;  1VQ6 1;  5C4J I;  3CCJ Z;  1WW9 A;  3FQQ A;  3JAM b;  1S7M A;  1M1K 1;  4MON A;  2R7Z I;  3S2D I;  3F3F C;  1N2F A;  3MZK B;  2DE5 A;  1YUA A;  2V8I A;  3FKI I;  3H0G I;  3MON A;  3IR7 A;  1I6H I;  3S15 I;  1KC8 2;  1VQL Z;  3K7A I;  1WII A;  4E32 A;  1W2B Z;  3GTO I;  3VMI A;  4S1T A;  3GTL I;  1VQ9 Z;  2JA5 I;  1Q16 A;  2R92 I;  2P3Y A;  2G2K A;  1YI2 1;  2P28 A;  3S1R I;  3VMG A;  3EED A;  5C44 I;  1YHQ Z;  1QVG Z;  5T6B A;  1YIT 1;  4CL1 A;  2K5R A;  3NH5 A;  2W03 A;  1VQ7 Z;  3KIH A;  3CPW Y;  2HU9 A;  3I55 1;  1KRL A;  1VQK Z;  2AYD A;  3RZO I;  1FDI A;  1Q81 1;  1I3Q I;  3CQZ I;  1RNI A;  5D1P A;  3MZL B;  2QRD B;  1P9N A;  2QKD A;  1VQ8 1;  4NBE A;  2WAQ A;  2E2J I;  2JNY A;  3I56 1;  2M48 A;  4BBS I;  4A3L I;  1K9M 2;  3VTN A;  1M90 2;  3S1Q I;  1RQF A;  4EWC A;  1RLY A;  1K73 2;  3CC7 Z;  1Z01 A;  3CCU 1;  3HOW I;  3QWU A;  3S17 I;  4A3K I;  3G6E 1;  3CCL Z;  3CCE 1;  3BG0 B;  3CC4 1;  3HOX I;  3CCS Z;  4XX2 A;  2RBL A;  4A3J I;  1RO2 A;  1Q86 1;  3CC2 1;  1YJN Z;  3CME 1;  1VQ4 1;  2Q4Z A;  3J80 f;  2K3R A;  2DE6 A;  3HKZ A;  1VQ5 1;  2VPZ A;  3CCR Z;  3NFZ A;  5IP9 I;  2QR1 B;  2IV2 X;  1RO4 A;  1QYP A;  1N8R 1;  3I4N I;  1JWH C;  3D9X A;  1Z02 A;  2QA4 Z;  1K8A 2;  3NDI A;  2JMO A;  3J80 b;  2VPX A;  2LFU A;  3GTG I;  3CCQ Z;  3G71 Z;  4RVF A;  2E2I I;  2JIQ A;  4BY1 I;  4DGL A;  1VQO Z;  2RHB A;  4NBA A;  4RVD A;  2QA4 1;  4NBD A;  4NB8 A;  2JIO A;  3VB9 A;  1KQS Y;  1YJW Z;  3GTP I;  1Y1V S;  1VQP 1;  4E2Y A;  3CPW Z;  2I3C A;  1Q81 2;  1L1O C;  3F3P C;  1QF8 A;  2RPR A;  2OTJ Z;  1WJ2 A;  3EER A;  1QXF A;  1YJ9 1;  4Y52 I;  3J81 b;  3CCJ 1;  5T64 A;  4QTU A;  2NVT I;  1ZB9 A;  3CXC Y;  1Q82 2;  1ZB8 A;  2V3V A;  4Y7N I;  3IX0 A;  4A3C I;  4NBG A;  5FLM I;  4TNU A;  3I4M I;  3TDH B;  4NBF A;  4MD9 A;  2OTJ 1;  1VQL 1;  3S1M I;  1YUK A;  1VQM Z;  2OOX B;  1Q7Y 1;  1VQ9 1;  5FLX f;  3KIF A;  4E31 A;  2O53 A;  1PFT A;  1TWA I;  3GCF A;  1WCM I;  3S1N I;  1KD1 2;  2GTH A;  2JR6 A;  3IFU A;  3Q87 A;  2VPY A;  1ZH1 A;  1YHQ 1;  1NJI 2;  2JIR A;  2QRC B;  2E9H A;  1S72 Z;  2NVX I;  4E30 A;  1USP B;  3NH4 A;  1VQ7 1;  3ESW A;  1VQK 1;  2V45 A;  4MD7 A;  1JJ2 Y;  1I50 I;  5IT9 f;  2KI7 B;  5C3E I;  4DQY B;  1QVF Y;  4NBH A;  2YU9 I;  5FLX b;  4RS4 A;  1YIJ Z;  1Y1W I;  4BXX I;  1Z03 A;  3IF8 A;  3CC7 1;  1VLA A;  2OTL Z;  2GTI A;  3CCL 1;  4NOZ A;  4RV9 A;  1SFO I;  3GTQ I;  2QEX Z;  2QRE B;  1TWC I;  3CCS 1;  3CMA Z;  2VF1 A;  4A3B I;  3FQM A;  2IZ3 A;  1YJN 1;  1KQS Z;  4A93 I;  5IT9 b;  2NVY I;  1M1K 2;  2GU2 A;  2RIQ A;  4MXU A;  3S16 I;  2ZAE B;  4AYB A;  4BBR I;  3S14 I;  2VUG A;  2LEX A;  3CCR 1;  1TFI A;  1VQN Z;  5D1O B;  1Y1V I;  5T67 A;  3CCM Z;  1M90 1;  3CD6 Z;  3CXC Z;  3G4S Z;  2HF1 A;  1X3W A;  3BG1 B;  4RVG A;  2WB1 A;  3CCV Z;  1K73 1;  2JS4 A;  2R93 I;  3PO2 I;  2Y0S A;  3M4O I;  3S2H I;  3GTM S;  3D6W A;  1VQ6 Z;  2V8K A;  3HOY I;  4DK1 A;  3HOV I;  2F4M A;  4A3I I;  2RT9 A;  4NBC A;  3G4S 1;  3CCQ 1;  4E2Z A;  3T4N B;  3G71 1;  1USP A;  3LUS A;  1SIW A;  5AN9 F;  2EGT A;  1VQO 1;  2B63 I;  3TE5 B;  1ML8 A;  2BJO A;  2H85 A;  1X0T A;  3I07 A;  1LQL A;  2E7Z A;  1WZN A;  1YJW 1;  3J7A 4;  2LIY A;  1K83 I;  2F4O A;  3D2L A;  4NBB A;  1JJ2 Z;  4A3F I;  3HOU I;  2M6N A;  4MRI A;  3OW2 Y;  1YI2 Z;  2Q51 A;  1QVF Z;  4E2X A;  1TWG I;  2YAD A;  1Q86 2;  1K8A 1;  1YIT Z;  1Y8C A;  4NFR A;  3NH8 A;  3I55 Z;  2IZ4 A;  2O4H A;  3HOZ I;  5CM2 M;  5LL6 f;  4HH4 A;  4A3D I;  2DE7 A;  1AA6 A;  2OOY B;  1VQM 1;  4RVH A;  2JIP A;  4A3E I;  1VQ8 Z;  2NAP A;  3I56 Z;  2V8J A; 
#chains in the Genus database with same CATH homology
 4BY7 I;  3CCU Z;  5D1O A;  1R9T I;  1N8R 2;  3G6E Z;  3CCE Z;  4E33 A;  4NB9 A;  1KC8 1;  1TWF I;  3CC4 Z;  1W2B Y;  3U50 C;  4NH1 C;  2PK7 A;  3PO3 I;  1S72 1;  3CC2 Z;  4HGZ A;  1Q82 1;  3CME Z;  2NVQ I;  1VQ4 Z;  3RZD I;  1X3Z A;  3GTK I;  3GKQ A;  5C4X I;  1VQ5 Z;  2JA8 I;  5IP7 I;  2OZK A;  1YIJ 1;  1QVG Y;  5A2Q f;  3PO3 S;  1NUI A;  4A3G I;  3H3V J;  2OTL 1;  2J6A A;  3P5J B;  4QTT A;  2QLV B;  2R6M A;  1DL6 A;  3GTM I;  1TWH I;  4MD8 A;  2QEX 1;  1KD1 1;  2AKL A;  2VUM I;  3CMA 1;  2E2H I;  4MH4 A;  1NJI 1;  3M3Y I;  1RO0 A;  1K9M 1;  4HGY A;  1NP6 A;  3VMH A;  3JAM f;  3OW2 Z;  3NDJ A;  5A2Q b;  4A3M I;  2KPI A;  3GTJ I;  1Q7Y 2;  1VQN 1;  2W04 A;  2JA7 I;  2PM9 A;  3CCM 1;  4E2W A;  3J81 f;  3CD6 1;  4X6A I;  2JUB A;  1VQP Z;  3CCV 1;  2JA6 I;  2PMZ A;  1YJ9 Z;  1VQ6 1;  5C4J I;  3CCJ Z;  1WW9 A;  3FQQ A;  3JAM b;  1S7M A;  1M1K 1;  4MON A;  2R7Z I;  3S2D I;  3F3F C;  1N2F A;  3MZK B;  2DE5 A;  1YUA A;  2V8I A;  3FKI I;  3H0G I;  3MON A;  1I6H I;  3S15 I;  1KC8 2;  1VQL Z;  3K7A I;  1WII A;  4E32 A;  1W2B Z;  3GTO I;  3VMI A;  4S1T A;  3GTL I;  1VQ9 Z;  2JA5 I;  2R92 I;  2P3Y A;  2G2K A;  1YI2 1;  2P28 A;  3S1R I;  3VMG A;  3EED A;  5C44 I;  1YHQ Z;  1QVG Z;  5T6B A;  1YIT 1;  4CL1 A;  2K5R A;  3NH5 A;  2W03 A;  1VQ7 Z;  3KIH A;  3CPW Y;  2HU9 A;  3I55 1;  1KRL A;  1VQK Z;  3RZO I;  1Q81 1;  1I3Q I;  3CQZ I;  1RNI A;  5D1P A;  3MZL B;  2QRD B;  1P9N A;  2QKD A;  1VQ8 1;  4NBE A;  2WAQ A;  2E2J I;  2JNY A;  3I56 1;  2M48 A;  4BBS I;  4A3L I;  1K9M 2;  3VTN A;  1M90 2;  3S1Q I;  1RQF A;  4EWC A;  1RLY A;  1K73 2;  3CC7 Z;  1Z01 A;  3CCU 1;  3HOW I;  3QWU A;  3S17 I;  4A3K I;  3G6E 1;  3CCL Z;  3CCE 1;  3BG0 B;  3CC4 1;  3HOX I;  3CCS Z;  4XX2 A;  2RBL A;  4A3J I;  1RO2 A;  1Q86 1;  3CC2 1;  1YJN Z;  3CME 1;  1VQ4 1;  2Q4Z A;  3J80 f;  2K3R A;  2DE6 A;  3HKZ A;  1VQ5 1;  3CCR Z;  3NFZ A;  5IP9 I;  2QR1 B;  1RO4 A;  1QYP A;  1N8R 1;  3I4N I;  1JWH C;  3D9X A;  1Z02 A;  2QA4 Z;  1K8A 2;  3NDI A;  2JMO A;  3J80 b;  2LFU A;  3GTG I;  3CCQ Z;  3G71 Z;  4RVF A;  2E2I I;  4BY1 I;  4DGL A;  1VQO Z;  2RHB A;  4NBA A;  4RVD A;  2QA4 1;  4NBD A;  4NB8 A;  3VB9 A;  1KQS Y;  1YJW Z;  3GTP I;  1Y1V S;  1VQP 1;  4E2Y A;  3CPW Z;  2I3C A;  1Q81 2;  1L1O C;  3F3P C;  1QF8 A;  2RPR A;  2OTJ Z;  3EER A;  1YJ9 1;  4Y52 I;  3J81 b;  3CCJ 1;  5T64 A;  4QTU A;  2NVT I;  1ZB9 A;  3CXC Y;  1Q82 2;  1ZB8 A;  4Y7N I;  3IX0 A;  4A3C I;  4NBG A;  5FLM I;  4TNU A;  3I4M I;  3TDH B;  4NBF A;  4MD9 A;  2OTJ 1;  1VQL 1;  3S1M I;  1YUK A;  1VQM Z;  2OOX B;  1Q7Y 1;  1VQ9 1;  5FLX f;  3KIF A;  4E31 A;  2O53 A;  1PFT A;  1TWA I;  3GCF A;  1WCM I;  3S1N I;  1KD1 2;  2GTH A;  2JR6 A;  3IFU A;  3Q87 A;  1ZH1 A;  1YHQ 1;  1NJI 2;  2QRC B;  2E9H A;  1S72 Z;  2NVX I;  4E30 A;  1USP B;  3NH4 A;  1VQ7 1;  3ESW A;  1VQK 1;  4MD7 A;  1JJ2 Y;  1I50 I;  5IT9 f;  2KI7 B;  5C3E I;  4DQY B;  1QVF Y;  4NBH A;  2YU9 I;  5FLX b;  4RS4 A;  1YIJ Z;  1Y1W I;  4BXX I;  1Z03 A;  3IF8 A;  3CC7 1;  1VLA A;  2OTL Z;  2GTI A;  3CCL 1;  4NOZ A;  4RV9 A;  1SFO I;  3GTQ I;  2QEX Z;  2QRE B;  1TWC I;  3CCS 1;  3CMA Z;  2VF1 A;  4A3B I;  3FQM A;  2IZ3 A;  1YJN 1;  1KQS Z;  4A93 I;  5IT9 b;  2NVY I;  1M1K 2;  2GU2 A;  2RIQ A;  4MXU A;  3S16 I;  2ZAE B;  4AYB A;  4BBR I;  3S14 I;  2VUG A;  3CCR 1;  1TFI A;  1VQN Z;  5D1O B;  1Y1V I;  5T67 A;  3CCM Z;  1M90 1;  3CD6 Z;  3CXC Z;  3G4S Z;  2HF1 A;  1X3W A;  3BG1 B;  4RVG A;  2WB1 A;  3CCV Z;  1K73 1;  2JS4 A;  2R93 I;  3PO2 I;  2Y0S A;  3M4O I;  3S2H I;  3GTM S;  3D6W A;  1VQ6 Z;  2V8K A;  3HOY I;  4DK1 A;  3HOV I;  2F4M A;  4A3I I;  2RT9 A;  4NBC A;  3G4S 1;  3CCQ 1;  4E2Z A;  3T4N B;  3G71 1;  1USP A;  3LUS A;  5AN9 F;  2EGT A;  1VQO 1;  2B63 I;  3TE5 B;  1ML8 A;  2BJO A;  2H85 A;  1X0T A;  3I07 A;  1LQL A;  1YJW 1;  3J7A 4;  2LIY A;  1K83 I;  2F4O A;  4NBB A;  1JJ2 Z;  4A3F I;  3HOU I;  2M6N A;  4MRI A;  3OW2 Y;  1YI2 Z;  2Q51 A;  1QVF Z;  4E2X A;  1TWG I;  2YAD A;  1Q86 2;  1K8A 1;  1YIT Z;  4NFR A;  3NH8 A;  3I55 Z;  2IZ4 A;  2O4H A;  3HOZ I;  5CM2 M;  5LL6 f;  4HH4 A;  4A3D I;  2DE7 A;  2OOY B;  1VQM 1;  4RVH A;  1VQ8 Z;  4A3E I;  3I56 Z;  2V8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...