2GTHA

Crystal structure of the wildtype mhv coronavirus non-structural protein nsp15
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
370
structure length
348
Chain Sequence
SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYFITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 91
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gthA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gthA02
2GTIA 4RS4A 2GTHA 2RHBA 4S1TA 2H85A 2OZKA
chains in the Genus database with same CATH superfamily
4R8VA 1T9BA 3U3KA 2PANA 3T4XA 3OMLA 2YHSA 2JA6I 1BTOA 1FP6A 3CC41 2I3BA 4GXQA 1VRCA 1ZN8A 4JB8A 3OVMA 3IEXA 3CCQ1 1U1EA 2HXSA 3AF4A 3FSEA 1E61A 4FZRA 3NVDA 1TVMA 4HADA 3X1KA 4PG8A 1J06A 4MKZA 4KTVE 5GGXA 5CB8A 3OZBA 2VBIA 3LUAA 4X95A 4XOIA 1HNXB 4LZJA 1TZMA 2ZBPA 1SBZA 2W2TA 4E5UA 2WQ6A 1E2QA 5B4TA 3PXDA 4L8LA 1VB5A 3HS3A 2X7JA 4B3DA 4FE3A 421PA 1JHUA 2AYXA 4G1BA 2EJCA 3ANMA 2ZVQX 2FX3A 4UTZA 5CEJA 2FLWA 6Q21A 3ZDDA 1U2QA 2QN3A 2O6LA 1Q0LA 1MAHA 2A2ZA 2HFJA 1WAMA 4YRFA 3QVSA 1TUBA 3RLIA 4DIBA 8ADHA 2Y9PB 5IVDA 5HXAA 3SZGA 2XGGA 1WW2A 3G9UA 1GU1A 1URPA 3H4IA 4J1SA 4UHCA 2YDYA 5KVQA 4DWWA 3U44B 4OHKA 1NOJA 2EW8A 3TO5A 3EZLA 1XMOB 3VVCA 2E1RA 4UU1A 1YR2A 2OO7A 2RCNA 1VPVA 3PC4A 4Y2HA 5DK6A 4WT7A 1WXHA 3L2OB 3R6LA 4RJLA 3ZS9A 1FS6A 3BRWA 3QE2A 2BP7B 1ICEA 3QOFA 3AKDA 4QJ4A 1SJ9A 3CG4A 1U2GA 1QS0B 4DM7A 4KX3A 5JMOA 4W5RA 3L46A 2R9VA 3LA6A 5C7OO 4TWIA 5CDUA 3GGGA 3EZXA 2GCIA 4Q02A 2PBZA 5FNZA 5M2QA 2JI4A 4HAVA 5KYWB 2HCBA 1BG6A 2FFRA 4RK6A 1ZMXA 5AM4A 5BT9A 3U62A 3WAJA 3FTDA 5JC8A 1QC5B 1NUHA 2PGOA 4N5LA 4EQZA 5C2JB 1R9GA 4LJRA 1SUWA 1MVLA 2FOLA 3AF1A 4UBOA 4XVHA 5A1TA 4A3SA 2IYYA 4WZ6A 5AVOA 1L5YA 1HTBA 2PNJA 1Z9BA 3WL5A 2Q0HA 2F9MA 1OU0A 1M1XB 2C3PA 1NN3A 3NM4A 5FLMI 3HDQA 2P1DA 1N5RA 4XOUA 3H4VA 1GCUA 4XDYA 3GJ3A 3ZZUA 4RK4A 1JXOA 4RZUA 3G13A 1Z0KA 3ABSB 3LD9A 5BR4A 5HW0A 2O8BA 2PLRA 4MQ6A 4TMWA 3ZEIA 1AQ6A 1TXGA 3TOVA 2ZRKA 4JEIA 2ZJ5A 3PUZA 4JELA 4K9KA 3OTGA 3RRFA 3HJAA 3TGLA 1RLJA 4IRXA 4DK1A 2Z1DA 3EZ2A 4NHEA 5E3IA 3AVWA 2IHYA 3UK2A 1QFJA 1KS2A 3G1WA 2HO5A 4FEAA 4WY8A 1XAIA 5C8YF 1UXGA 3QH4A 4RENA 3ZOZA 3QI7A 2X4IA 4FCVA 4NOZA 1E9BA 3I73A 3O94A 1PX2A 1C7QA 2HRDA 1T24A 1ZRMA 3RG2A 1SNYA 3ZXYA 2G3YA 2GPWA 1YZLA 3A9TA 3AXTA 3GAZA 4KE6A 5IANA 1UWLA 1QR2A 4PGFA 1HZZA 3HKZA 2C92A 3LYAA 5MFPA 3VA7A 3W3AA 3KWJA 4Q4HB 1WTAA 2QTVA 5ALIA 3DB2A 1OXKB 2VNHA 1SRRA 4NZOA 2XX3A 5J2UB 3DL7A 3HKCA 5T64A 4N5IX 4YLEA 4LHWA 3W7BA 5F9MA 1I3NA 1MG5A 4H6PA 1U7WA 1F8UA 3BH0A 4QDJA 3IE0A 1NRWA 4L1KA 4AJOA 4HVCA 4WA8A 4NCBA 3FOBA 5HILA 1F4VA 4GPD1 4N3GA 3H2BA 5EE0A 2AI3A 1GPBA 3IQIX 3CCUZ 4WJKB 3SSMA 3A05A 5AT1A 1AHNA 1YGYA 3CLHA 1O58A 5EIEA 4Q00A 3LOQA 3DMYA 1VFNA 4HNGA 1Q17A 4I9HA 5EZ5A 4RVDA 3B7GA 4E7OA 3CRQA 3GJQA 3E2PA 2JFUA 2AMVA 5FTMA 1I1NA 2PIAA 2IZ4A 4M88A 3VVBA 9MHTA 5HTOA 2VQSA 4KR9A 2QL5A 3ND9A 3R7LA 4NB8A 1L5HB 2C5SA 2WHEA 3KUCA 3RVSA 1RC1A 3WGZA 1SCUA 2FPIA 3OCWA 4MQMA 3VPHA 4ZZ0A 1MFPA 4D1YA 5AVZA 1PSZA 3DSRA 2G4CA 2QTGA 2XVMA 3BFKA 3MWDA 3HB1A 2E89A 2B78A 2HGSA 2JGMA 5ALFA 2IBSA 3N7UA 1ADCA 1FYXA 1RAAA 4O3FA 3T54A 4EHJA 4QPCA 2B4TO 1RS0A 3HA2A 1SFOI 2IYUA 2YOHA 3PFNA 3A1CA 1XZBA 3TOCA 4OHYA 3FNHA 1MORA 1LV7A 2QWXA 3D5EA 1N25A 2Q46A 1RQPA 3JYNA 3VRHA 4CMEA 1RCTE 1Z6YA 5BQPA 1Q11A 2C31A 4JLUA 5CBPA 4GM1A 4MEBA 1HFKA 1MT3A 4KQHA 1JU4A 3RYTC 4YREA 3PC2A 2W2NA 2BZ1A 4ZMRA 3RFFA 1EXWA 2FPKA 2PX5A 3I6ZA 4O2AB 3M5WA 5HF8A 4J0QA 5FFFA 3DE0X 3WHKA 2D1SA 4KJXA 4YIKA 1XMVA 2Q6OA 3CW8X 2OA0A 3RIYA 3TQHA 1BCRB 2PD6A 4W5QA 3RH0A 1SU6A 2FSPA 1T8RA 3L7DA 3NHAA 4BMVA 1T91A 3EASA 4RDIA 1TWHI 1NDUA 1O0BA 3MZLB 4I9UA 1AV7A 3DHNA 1AGNA 4ZARA 1U8XX 4LA4A 4Q93A 2PWYA 1BE6A 3GFPA 4QD3A 2QEXZ 3SLGA 1QONA 4L85A 4RZ3A 4BTVA 4MB0A 2HNBA 4URFA 5DBHX 5IT9b 4U9IS 5F77A 2R00A 1SB9A 5HG0A 1JH9A 3MZ0A 1HC7A 1FQWA 3QPBA 5CLHA 4Z8YA 1OGIA 2P1RA 2FZKA 1E2JA 1Y5NA 2WJIA 2PYDA 4M1TA 4N01A 1KVUA 2VAVA 1OAKA 4YUWA 2KI5A 2W83A 2ZITA 5AKGA 3DQQA 2V7PA 1GWNA 2C2ZA 3H9BA 4LHSA 3RSGA 4LNUA 1KP3A 1JQBA 3GRYA 2HDWA 3U4HA 3SSAA 5AJVB 3GGPA 2WWFA 1PU2A 3HYNA 4EB8A 4NXNB 3J7A4 2G6BA 5T5QA 4O33A 4ZKDA 3HCCA 4EYSA 3ZK7A 1H4TA 3IPLA 3CFYA 3QVOA 4TMYA 3HADA 4GQIA 4RH3A 3LC0A 1Q7CA 3INGA 3BL5A 4NAHA 5SZHB 2G72A 3LTNC 5JQWA 1TW3A 1A7UA 4LY6A 3RTBA 2QEQA 4D3FA 2UUBB 2FWMX 4A8JC 2C5GA 4OQFA 4M1ZA 3PC8C 4TV9B 4CKXA 4Y1RB 2CMGA 2O07A 3JYOA 4J9VA 1M5UA 5DM4A 3KFVA 4J43A 1WB9A 2Q7OE 4CMAA 2Y4OA 1G38A 2G1UA 4WTOA 2H1WA 3DEAA 1Y5RA 3D2AA 5CRIA 1EM8B 1UZUA 2P4HX 4UBJA 5AI0A 5DM2A 3W8NA 3MCAA 2P2SA 1E77A 1B6RA 5D6OA 3ZX5A 2D1TA 3ZIUA 1CJBA 2AXNA 3F2IA 3KYCA 3MJRA 5J5VA 4AJKA 4RH0A 2VDRB 4QIHA 3C5HA 3LRPA 1IG0A 1ORVA 2IU4A 2JAXA 2EL9A 2YJTD 5E2IA 2R6HA 1IOLA 3K8YA 4BFYA 4ENVA 4CTNA 5EESA 1MABB 2QY9A 3B5IA 2VH2A 3O2SB 4KQ1A 4MRVA 1QX3A 4BZWA 4BNKA 2PH5A 3LXUX 5TE9A 4OI1A 5I45A 3GLFA 4N0PA 4BNVA 2ETVA 1YMVA 1JV2B 3BSSA 4PLVA 3G7UA 2V97A 3K9WA 3O4HA 1YB1A 1QV9A 2P90A 2ZJ8A 3N2LA 2I55A 3N0RA 4R0VA 5CYOA 1QRSA 3EWSA 4P58A 4J3FA 2QA4Z 2VHJA 2O8DA 1EX6A 2GCNA 1C3VA 4G0NA 1ULTA 5KZMB 1JQ5A 1MOSA 3Q0EA 3Q87A 4P22A 5JY6A 3DM5A 4AXBA 4RE6A 3O1IC 3ZWKA 3SGLA 3WK5A 4KQEA 4V0ME 1TKCA 3ZLVA 3ZGNA 1DS6A 1NX9A 2R7LA 1VA5A 3KDPA 1QCZA 4JJ4A 3ZE1B 4BNNA 4LC1A 5KYKA 1FX0A 4XDZA 2JHGA 4RFSA 3SMVA 2E82A 1G2PA 3H4MA 4W1RA 3M9WA 2PUJA 3P9ZA 3HP7A 1Y34E 1DOAA 1X80A 3TBFA 4KN5A 3OEYA 4OA5A 3KWFA 3EH2A 1Q3HA 4G56A 2NG1A 5AKZA 5D1OA 4OBEA 3WDLA 4E1BA 2P1ZA 4B5KA 1X1SA 3JZIA 1C41A 2FSVC 3DBHA 2OV6A 4XQEA 4QPJC 2PX3A 4R0MA 3UUGA 3TIIA 1QGYA 3T7DA 1H4SA 4Q15A 3FJ1A 1OAOA 2FEOA 3BHMA 3BULA 5FHRA 4PEVA 1U3TA 4R5MA 5EZYA 3GHYA 3OPNA 4NV1A 1ORWA 2X2EA 1JLRA 4G4IA 4I6EA 5GONA 5B3JA 1S7GA 3KALA 3ZY3A 5BWBA 4C0HA 5CCBA 4L4SA 3WK9A 3P9KA 4WHMA 1DWQA 4XX0B 3FIJA 3OW2Y 3JWHA 2JAPA 3QELA 1RTKA 1XK7A 1NVVR 4DDUA 3TKLA 1EFCA 3FKSA 3P9QA 4J4BA 2AK2A 2CHGA 3D31A 1QOPB 1QZ3A 4V24A 2BGWA 2GYWA 4TLMB 1FE8A 1N5KA 4NH4A 4RZIA 4BLVA 3FKJA 3K0AB 4NK4A 5GVSA 1KYXA 5G4KB 2L82A 3N76A 4YO8A 3NBFA 4Z9AA 5KX5A 2JDIA 3FYUA 3H97A 5A05A 2X0FA 4R2WA 4BQFA 1I8TA 1Q1AA 5EJGA 5TVGA 4M0FA 4OK3A 4AF6A 1YAJA 3SLRA 4C4ZA 4MKFA 2P6RA 3ZTYA 4IHKA 2ZIFA 1L6IA 5BMVA 1VPWA 2V58A 1QPGA 3L8MA 2ODBA 2BL4A 2W2QA 5GMOA 4UOEA 1JKJA 5T4EA 4WECA 4DV7B 1D5WA 4S05A 4I19A 2Y2VA 5CIWA 1VQL1 4QTZA 4C7XA 1J1UA 1GGKA 4UHJA 4G0XA 2F90A 4MIKA 4S1TA 2B35A 4MV7A 5ILOA 3IC5A 4H6VA 4O0LA 1G21E 3OQNA 2DFKB 4DY6A 1G5RA 4L74A 1R8JA 2X8WA 4BP9A 2FW0A 4UAUA 3TB4A 4QPDA 1K1EA 1VSQA 3EZYA 4MVCA 1TZ2A 1ZKMA 5CT6A 4EPTA 3WL3A 1EHIA 4XAQA 4KE9A 2H1IA 3SJ7A 5IEBA 5EJ8A 3MUNA 3UPUA 2XITA 1UOPA 5CVJA 2X8AA 5ERGB 2DCMA 1XXLA 3AF5A 3IALA 1GTMA 1Y6JA 2OQ2A 4INPA 1KI9A 2CNWD 2FHSA 4FFSA 4MVJD 1R64A 4M6WB 1NJ1A 1OH6A 3OE5A 1M0WA 1W1UA 2GCPA 4UAJA 1VKJA 1KEKA 2GEKA 4NX2A 1RXCA 3DPIA 4DLBA 4ND3A 3GB9A 1WD7A 1S3IA 1PL6A 1ZIDA 3JAKB 3QMMA 4KN8A 1K5DA 2PO7A 3D7RA 1AKEA 4PGHA 3VR5H 2PMBA 5T3UA 4F4DA 3B53X 4I4IA 4NU6A 4P4TA 1E4EA 1FFBA 3TTYA 4A8HA 2NT4A 3IEKA 3FI9A 1MX5A 3ESYA 4QRHA 1HNNA 4PRYA 2Q5FA 2PLNA 2ZI3A 2PSHA 3N9IA 5IARA 1RAHA 1BWSA 1KJYA 4MUGA 4PZEA 3AY6A 5C1PA 1LRJA 2XI4A 3PUWA 3EG5A 5A7GA 5KNBH 2VP3A 2OV4A 3GJSA 4C1BA 4EECA 4ZVRA 1TQDA 2X8JB 4AROA 1V1MA 1RI1A 3HXLA 3WP1B 4DMMA 2Z8YA 4J7UA 4QUGA 2QYTA 3N70A 3CVVA 4RGQA 4ZEVA 4OUDB 4D8YA 3R3ZA 3CEAA 1KAQA 3LQRA 3KJGA 3TAUA 4XVUA 1M34A 4JAVC 4YCAA 3N8HA 3RIXA 5ED0A 2JGFA 2XJ9A 3EIHA 1U04A 2PKRA 1XEFA 2QL7A 4G85A 3T41A 1QLJA 2VBGA 2XUPA 2DB3A 1XP5A 3L7LA 1NOKA 4Y9RA 2J9RA 5YASA 4RVHA 3DEIA 2WU1A 5K8TA 2XMCA 2YJNA 2BFDB 1DRKA 3CPJB 3F67A 3A2NA 1GPH1 1RZUA 3IJEB 2A9VA 4AJNA 4UUQA 1P9OA 1A9ZA 3R7AA 1Y3IA 3P5SA 2BGRA 2IT1A 3F78A 1AF4A 4OHCA 4RCZA 5C52B 2PH1A 2FXIA 3WLTA 1F0PA 1P2SA 3VO2A 3GTQI 2A0WA 5JHHB 5GZ6A 4EPYA 3BX1A 2VHVA 2C4HA 5LA6A 2QX6A 3C6YA 4EMBA 1PAUA 3K71B 2QW0X 1PTJA 4C2TA 4M9RA 1VXOA 2QZ9A 4JYBA 4WXHA 4BUCA 4EMTA 4C29A 1J56A 3H2GA 4MAAA 3AEQA 1WCWA 1ZIXA 2JJMA 3RNLA 4HDCA 1Q19A 2ZSUA 1G9SA 3PDUA 4H60A 4OF4A 5AQ1A 5G4LA 1K8A1 4MD8A 1JKXA 1XK6A 4KXLA 2C2GA 1Z33A 3NOXA 3CHYA 3NV9A 4G2NA 2C9MA 3SU8A 2V45A 3OHSX 1WCIA 1H1LA 1MB3A 2NVUA 2X3UA 4H4CA 1VQN1 4KBFA 4OHPA 2GEUA 1I4WA 1SZDA 2C3YA 3HPQA 3TLKA 2PX8A 2XVYA 4AU1A 4D4GA 4QWWA 4BUZA 1A50B 1IN4A 1G8SA 2OOXB 4H9GA 2GS9A 4LMAA 3WL4A 4A3CI 3ELWA 4HBGA 3VR6A 1I9CA 4DA9A 1POWA 1LK0A 2YZMA 2VSFA 1ZBQA 4NULA 4EGJA 2EIXA 2I78A 1DG3A 1KI8A 3L6RA 4Q18A 4XQ0A 3HJRA 5IUNC 4Y0NA 3BCHA 2DLCX 1YB7A 4FZJA 1SUDA 3LX5A 1LSJA 1SKMA 4ZO9A 4F2WA 2JGRA 5CXUA 3W4IA 1E79A 4Z2YA 1AQUA 2Z0MA 4MVJP 1S8FA 1EIWA 1W8DA 4C0LA 1W88B 2FUG1 2FJPA 3KXKA 1YOVA 5DBIA 5IJ0A 1QH1A 3W05A 1CHNA 4PAMA 2ZRNA 3PL1A 4GS5A 4C7KA 4ER7A 3EWIA 4OHUA 2VHTA 1M83A 2VDVE 3H6KA 5E6UB 2VQ6A 1TZBA 1R7RA 2HPVA 1T4DA 3GJ6A 5JVDB 3T06B 1VPEA 2OC9A 1Q5PA 4NPCA 5TQ0B 1KR5A 3UF0A 1PSDA 1CV2A 3QITA 4QTUB 2QT1A 2P6MA 3CMAZ 3OCYA 3C1TA 4U39A 3I6IA 1XZMA 5ITZA 1K732 1AA9A 1MH1A 3PRHA 1CRQA 3AF3A 4EG1A 2Q6VA 4R2MA 2IWHA 2NUAB 2DQYA 3ITKA 3WISA 4A0RA 4M87A 1ZJZA 1JHZA 4GZ3A 1JDZA 1KQSZ 2KB0A 3CR3C 2FGKA 1Q15A 3AOEC 1Q91A 1ABBA 3EGXB 3LNCA 4R3NA 3S1NI 1T1IA 1YUAA 1L5KA 1IK6A 3ZV3A 3EDOA 3EUFA 2O8CB 1ZBDA 1DAFA 2JLXA 3OPMA 1Y42X 4JQZA 4AM8A 1AGPA 4LWZA 1U7DA 1M901 1Y7TA 2E18A 2J0UB 4BFXA 1NNSA 3W2HA 1DO8A 1P0PA 4PZLA 1MAAA 3CQ9A 1KBQA 1K3FA 1OFVA 4JYPA 4DIUA 2J09A 2A4KA 3C97A 3CGGA 5L95A 1PJRA 3K70C 2Z98A 4JYMA 1WY7A 3TSZA 1L9XA 4AO6A 2QR5A 4XWYA 4UPDA 3EQ9A 2FAXA 3E8SA 1JAYA 1FTGA 2HIMA 3AEKA 2FOIA 3G2MA 1E2UA 2UUOA 1CIJA 3DE2X 3FAKA 4BAUA 1K4YA 4ZDKA 2ZBQA 4F9EA 4CEIA 1UINA 3D7MA 2H1OA 1Q77A 3L1JA 1WVMA 4QGSA 3CPEA 2HA6A 2OENG 4DDHA 1DT5A 4DBVO 1SBNE 3Q8XB 4HX5A 3Q6MA 3SX0A 4X6LA 4HMOA 3I58A 4HYYA 3VZBA 1AUVA 2Q6IA 5DNCA 1NJI1 1XTBA 2QUKA 1QYWA 1SXGA 1NBAA 3PCXA 4LDAA 1JHDA 3BKWA 1EBFA 2JNYA 1G21A 2J41A 4IDPA 3DOJA 4X20A 3LQ2A 4XA8A 4BP1A 4YMHA 1DJQA 3EB9A 4DLUA 2NV2B 3GEHA 1XRQA 2V7GA 3IEUA 4IRUB 3HNPA 4ZV7A 4F92B 1VQMZ 2X41A 3E4CA 1IUPA 3T3NA 5ECDA 5K05A 3VPSA 3A1UA 2G9NA 2Y05A 1WHTB 3FD8A 4JQOA 1YB6A 1SG6A 5I9TA 3S1AB 4GI1A 3PENA 2XTZA 3AI3A 1FFWA 2BZGA 3HY6A 3F3FC 2QSJA 4C4PA 4G89A 5CM8B 3GI1A 2X23A 2WUVA 1IBRA 1RHRA 1P17A 2YWFA 4CQMD 5HE9A 3Q8KA 2Q3HA 4LDZA 2C96A 2X4LA 1OZHA 2QZPA 4TXLA 1S01A 3AEZA 1R8XA 1PFVA 2J30A 3WQHA 2VLBA 1X7XB 4P3XA 3C3YA 4TT8A 3FQQA 1OYOA 2D0DA 2XVXA 4OOEA 1L7EA 1QV7A 5K0TA 1GITA 2IGTA 3R8FA 2NQTA 3OF5A 3KZVA 2XGJA 2GF9A 1TU0A 3MIIA 3O4FA 1BW9B 2FVYA 3CCM1 3ROTA 2WQZA 1QU3A 4JT4A 3L0SA 4LOAA 2FMFA 3ZQUA 5C4GB 1ZB9A 3CWZA 1Z16A 3P4XA 4A2WA 2QRQA 3FKQA 3W5BA 2DXIA 5DX0A 6REQB 1N2IA 3CRMA 4GPBA 5CR9A 3BRCA 3ETHA 4F84A 1RJDA 2AD1A 4RX1A 4RJIA 5C1IA 3GTJI 1PEDA 1OA0A 1Y3BE 2E85A 4P4SA 1MQ8B 4A3KI 1RDFA 5AUNB 3DCNA 2DUNA 1XELA 4I4CA 4BNLA 3EGDA 3ORQA 4NBGA 1XZLA 3LVBA 4DZZA 1G20B 4Q4JB 2FLVA 5TARA 2KLBA 2OCPA 1K63A 5IVKA 5DTQA 5JD3A 5BOSB 3D3KA 2NVOA 1D7OA 3ZD6A 1USVA 3SYNA 4AMBA 4LXXA 5KPJA 3DTYA 3GOHA 3F73A 1M0EA 1LBIA 4PZZA 2Q0XA 3DZ8A 4E32A 4IL5A 1MOZA 1GNPA 2WSIA 2WYVA 3KQQA 4XIIA 3VZDA 5BVGB 4F3TA 3KJEA 3Q3GE 4QOEA 2Y0PA 5JQGA 4KR7A 4V2IA 1WEKA 2PY6A 3ROPA 3EXHB 1RJ9B 5AHXA 3SC2B 4PBRA 2EP8A 3NUQA 2XCRB 2ZS8A 3TAXA 3K32A 3UWSA 2GO7A 3NVMB 2C59A 3KD2A 1AZSC 4K6OA 2QRHA 2Q3LA 4N0EA 2II6A 3SR4A 2G0AA 5IYZA 1W76A 4BFVA 3RVDA 1X74A 4CMIB 1CEXA 2WJVA 4OTZA 4XM1A 5G2OA 4Q3LA 4DLVA 3ROEA 3TL6A 2OCLA 4PS1A 1J09A 2PLAA 2CLFB 1C80A 3R4CA 1NBWB 1P3DA 5JDCC 3UQYS 4EG8A 5ECGC 4DSUA 3LPMA 4RY8A 5TVKA 4PHFA 2H7CA 1GT6A 1EX1A 5I4IA 3ZD9A 1G3IA 3MWJA 1M7GA 1N6PA 2DULA 2QPLA 2VT3A 2YWRA 2WNHA 3F49S 3Q2IA 4MGKR 4YQZA 4ND2A 5LMNB 1YDHA 2QNIA 4R54A 4RVFA 1PL8A 5EGNA 3PXCX 4LPSA 1OYYA 2E4VA 5EUBA 4A0SA 2C3UA 2PUDA 1I2CA 4ZOEA 2WZDA 3SNHA 3GLGE 1PI3A 4G5YA 1QAQA 3PV0A 1I01A 2BONA 4QQFA 2IJGX 1MO3A 3ENZA 2QTWB 1R0RE 3H5AA 1K6IA 1PZHA 2OORA 3FX2A 3A1FA 5AIAA 3GVHA 4EM6A 4HGZA 4IMIB 4XPIB 7MHTA 3CE9A 2D5LA 2GVNA 1QCDA 2FUNB 2Z5VA 2CJWA 3E81A 3H9JA 1ZD3A 4NHOA 5DSTA 4II3A 5LJLA 1TEZA 1P1IA 4RORA 3ZWMA 2JF0A 3FB1A 4ZALA 4YCCA 1A69A 3IUNA 3OQ6A 1JLLB 3DULA 4XTCS 2IUEA 4E5VA 3T3MB 4AJ9A 3EPHA 1YZ3A 1CQJB 3PUVA 3VPFA 4QOHA 3CO0S 2GDZA 4LF5B 2C95A 3DT6A 4B4VA 2R62A 2XMDA 2LRHA 4XWOA 4PLGA 3H5LA 5K45A 3CX6A 2PMCA 4LMBA 5ARDA 3TIFA 1EESA 3UXHA 3CF2A 4JBGA 1PK9A 1RWBA 3BXGA 2PT9A 4UEOA 3RS8A 4CDNA 2FR8C 3KIPA 3L4BC 3RSFA 3WMXA 2O1XA 4I6JA 5THXA 1VBMA 3L5KA 1J0CA 5CIYA 4Y2XA 4UTXA 3T9AA 1QLHA 2C99A 2I1QA 3CEJA 4B9EA 4POOA 2I1LA 5CFRA 1J0AA 2CFIA 3T7IA 3EC1A 1ZG3A 3FFTA 3OD1A 1OJLA 4UM9D 2R6FA 5A71A 3ZNNA 1HWYA 2J5XA 1LCIA 3G8BA 3KLPX 1IUOA 2XUHA 1VECA 1XDSA 3DZCA 4ON9A 1SQ0A 1WVIA 4OMCA 4UD2A 5JADA 3RODA 2W8BA 4XVQA 3V6MA 4WZBA 5CFMA 2CD7A 2UYOA 4A5OA 1O6CA 4E5DA 5FBVB 4F6LA 1XTQA 1X1AA 1IM2A 1YR6A 2Y1FA 3FPJA 2BI8A 1YITZ 4JVMA 4KZPA 4ER0A 4RIEA 2BFNA 2QX8A 4TL7A 5EI5A 1I50I 4CLDA 1LLUA 4FP9A 2DVMA 4QGBA 3AB8A 1Z38A 1QIDA 4G86A 3EFHA 1NUUA 1XRLA 3IP5A 3JSAA 1KI7A 3K0FB 2H52A 4QUEA 4UEWA 3V00A 2G7ZA 2MIIA 3VPXA 4M0UA 5TJHA 1U1GA 4EKDA 3SC3A 1O0CA 2C0CA 3FNBA 3DC2A 2QXUA 3C3MA 3RT1A 3O8QA 3A25A 3TQFA 1Z7GA 5H3LA 1CR2A 3PFFA 3ZY2A 3SDBA 1RLOA 1YXMA 2V5VA 1F12A 4BLWA 3ZXXA 2Q3FA 4ZAZA 1BA3A 3THWA 1JU9A 3B8EA 1NHWA 1VIVA 1V41E 4I5GA 3TLEA 1UQUA 2WU3A 4XYLA 1TYCA 2X42A 5ILGA 1VQ6Z 2I7XA 2PZEA 1P9RA 3EMBA 3U50C 1II8A 2GZ3A 3TPCA 3V80A 4ZCMA 5B1EA 1Q7GA 2GTPA 4NV3A 1VE1A 2H5JA 3L0DA 1WJ2A 4R8LA 2YZNA 3RS4A 5L3QB 2B20A 2O54A 2W2LA 1LY1A 1WNFA 4S1NA 5KQSA 2DE7A 5HOQA 2AWOA 3F4KA 1DLIA 1TUGA 4DMGA 2J0SA 2A9KA 4D5EA 4ZI2A 1VYHA 2HBQA 1PYOA 3CMMA 4J0KA 3VZSA 1H6AA 2PXAA 3A27A 5A3RA 5C46F 4V0SA 1U5BB 4QGFA 4XSHA 3RK1A 4D4HA 2P7IA 3WXMA 2PWBA 4CIAA 5KYYA 3Q41A 1HEIA 3B9QA 3SM3A 3VU8A 1VQK1 1NVTA 1LNSA 2Q5IA 2Y67A 2FETA 2D0IA 2F1RA 3CKMA 3EIFA 3IAFA 1OFTA 3KJFA 4M89A 2DOKA 4S2UA 3WRXA 3U9LA 2Q5EA 1L6RA 3UFXA 4Q4DA 4IGFA 4MVXA 2G17A 3IPCA 3V3TA 4C7OA 4MLCA 4IIYA 2BMDA 4HEQA 3N7AA 1KYQA 2GZDA 3CF0A 1N3BA 1QIHA 2QVCA 3NFRA 4Y6RA 2G8NA 2Q3BA 2TS1A 1Z4PX 4I99A 4ESEA 1MJGM 3PYXA 4O4JB 4D9MA 2P2CA 2R5NA 2X5JO 4ZK2A 4QYTA 2GCOB 4IWNA 3GMSA 4B9AA 4FJ2A 1EVZA 1GVHA 1AK2A 1G4UR 1P75A 2NADA 5C4IA 1NI4A 2PZMA 3HBMA 4N5NA 4DV5B 2BBTA 4AYWA 2JFGA 3L1UA 4FE4A 4P8RA 5IUJC 1JPVA 1NBEA 521PA 4HWKA 3HCOA 5IZCC 4N76A 2CBGA 3HDVA 2QR2A 2CVOA 2O8NA 3VNSA 4TTTS 1CZLA 4M7PA 5EP1A 4CVNA 1C1DA 3HBLA 2E4AA 3CVWA 2P9HA 3IKMB 3NORA 2N42A 1FK8A 5EINA 3GEGA 3KETA 2X6TA 1MO6A 3ELDA 4E31A 3DEHA 4BMYA 1SU8A 5BQ5A 5INTA 1XUOA 5MF6A 2OV2A 4PYJA 1SD1A 3HABA 2ZSEA 1OFHA 4JKYA 2XY4A 2AFIB 3L6CA 1VKOA 4JA0A 4K2HA 4RL6A 4Q3KA 4IWYA 3R7DA 2UDPA 3LF1A 4Z7OB 1UQRA 1EUQA 1OROA 1RAEA 3KPYA 5EE5B 1QLWA 4DSOA 4DRXA 1LJUA 2UUAB 1ZRNA 3I04A 4X8LA 4JLWA 4QSHA 5E7IA 5K3FB 3U60B 1KI3A 1EDZA 5KINB 3E9DA 2X8LA 2PMFA 4X61A 4A3II 3T1TA 2VRCA 1KE1A 1B93A 4RTPA 2GN8A 4LF9B 1QXSA 5DM1A 5FNVB 1N4AA 2QZJA 4BJ3A 1BRMA 2HXGA 2JFBA 4JBIA 1C3LA 2Q6LA 2QMOA 4N7JA 2P9GA 2VQDA 3IURA 4PLFA 5WRFA 1RPZA 3G89A 4LY3A 3IL2A 5LLDA 3HCEA 3HFSA 4LF4B 2RHGB 1XVIA 2FN3A 1SUAA 2I34A 3TSYA 3L77A 2GTHA 5LUBA 1GN8A 2HOQA 1UKBA 1EXNA 4UE6A 1GUZA 3S2ZA 5B2FA 2AN4A 3LFHA 5JZVA 1OI7A 4XEUA 1MX1A 2B4RO 4JEMA 3WKBA 1K7CA 1PJ3A 1UPCA 4BEWA 1OOEA 1IK4A 4L5JA 1RZRA 3LMKA 3VZPA 2C2OA 3ZGYA 3RBZA 3UGQA 5CDTA 3SYLA 1KMHB 4PLWA 1V95A 1V37A 3VMGA 2WJZB 5HZKA 1HKHA 3NNSA 3Q12A 1P8JA 1U0JA 1NZDA 3R41A 2HBZA 1JR4A 3IBCA 4JHXA 1DKUA 3D64A 4IIJB 2Z1NA 5TS3A 1MB0A 1PL7A 1SA0B 2BBSA 2NU6A 2RKBA 2ZP1A 4NG5A 1RO4A 4QGHA 4RPJA 3V8EA 2VQEB 4TLDA 3A2LA 4YB8A 3F74A 4YP1A 1HQYE 3QVGA 4KIJA 6AT1A 2W2MA 5JJLA 1E2DA 2QGNA 5CNMA 3RU3A 4YCNA 1QF7A 4JIMA 4DLLA 3AIKA 4HDKA 4TT3A 3I4NI 4UTOA 4Z4IA 1NV8A 1K7SN 2IYAA 2C8KA 1U0RA 3CPHA 3KO8A 5K0GA 3C7AA 4GWLA 4ARBA 1W5TA 4HWGA 4JLPA 1M75A 3WLMA 3RC9A 2ZR8A 4UBKA 1RPAA 4NMXB 4B6PA 2O0HA 1M66A 3NYIA 1KQGA 1DQNA 3OU6A 3FOCA 1QVRA 3HXMA 2WSYB 1S2GA 4JEUA 3TPZA 1EM6A 1XMIA 1S7CA 2OAQ1 3SSOA 1W36B 5B4VA 4WCFA 4D9IA 4Q9KA 2MSCB 2AWNA 1YJ9Z 3AR2A 1CZKA 3PCTA 1DBPA 4N3AA 5U4QA 2P9YA 3HL0A 3CC8A 4YJFB 3FUTA 1JU3A 5A2Qb 1ECBA 1ST3A 3ZHQA 5HKLA 3G02A 4DR5B 3W5JA 1EFLA 3ML1A 3QFHA 1XJWA 4J94A 1QTQA 2HSZA 4E21A 4ZP1A 1IXSB 3KHSA 2Y1CA 1U0NA 1EIZA 2H5LA 5AW8A 2RK6A 2DUUA 4W1SA 5IVIA 1FJHA 4ZWNA 4EY3A 1FLNA 1P1HA 1NE7A 4HB2A 4WXEA 4BX3A 3F3PC 3CV3A 4QQ8A 5EYPB 5KC9A 2F3RA 3OFSA 3ZGVA 2GJ4A 4DR3B 1JEQA 3L0PA 4CCYB 5B2EA 1JG4A 2P27A 4FZVA 2BC9A 4LK2A 3PX7A 4DPKA 2WTEA 2P3OA 1TYBE 2JK1A 4MLPA 1YE3A 1BROA 2FJUA 1QIMA 2BI7A 3IVAA 2GH1A 2V3WA 2XUFA 2DECA 1DCFA 5GY7A 1E2IA 2QYSA 5JAHA 1JFFA 1XVVA 2C0QA 3Q7IA 2H59A 4Q3BA 2AX4A 2Z2JA 4JP2A 1M7BA 3LRTA 3R0QA 2H31A 4D9CA 1CUZA 2QP4A 2QUBA 4RD6A 1KK3A 4NZMA 2EIHA 2JLQA 1G7CA 1KMIY 1LS1A 2MSDB 1TB4A 2QM7A 1MV5A 2ZBVA 3K1AB 4DV0B 4ZYZA 2YN2A 1E2BA 1FFDA 2HK7A 3HB5X 4JT8A 4XGNA 5B6PA 1D5CA 1Q2UA 2W9XA 1W9MA 3ZHBA 7REQA 4EHLA 1WXEA 3OM0A 3DO6A 3GRFA 3USCS 4F46A 3TXAA 4IIVA 3KSRA 4D4KA 2RHTA 2RFLA 2AN5A 4MONA 2JVKA 2VDOB 2WFZA 3D3NA 4BGUA 4BLTA 3GLUA 4MUJA 3UCEA 5M5BA 4KXNA 2FMTA 5C9ZA 3ZYZA 1HYQA 1L7BA 2AZDA 2JNWA 3NPAA 3PPYA 5D8DA 4BRSA 1QFZA 1U2DA 2CXXA 2YRFA 3DV0A 4HRYA 4EF6A 1ZP6A 1YJBA 3HKBA 4TN5A 1FRQA 3I4CA 3IVMA 5BSRA 2KQUA 3CC7Z 3SOZA 3QWUA 2JCVA 3KLMX 4YMUA 3RQSA 4YRKA 4V0OA 3AVPA 5LP6B 2IIPA 5HQ3A 1U7OA 4IHAA 4WWHA 1TAUA 2QRGA 5LM3A 1BYUA 2JHAA 5IXJA 5B7PA 3A4IA 5JXWA 2ZSHA 3JTEA 4FFPA 1AIPA 3ORSA 5AO9A 2A6PA 1NLZA 3ZWPA 1DEOA 1XOIA 5M29A 4QYSA 1EFDN 4FGJA 4LOKA 4O2BA 1JRLA 4CL0A 3VH3A 5KS2A 2ID4A 2C78A 4IV8A 1G6HA 1P80A 1WLSA 4Y6LA 4W5NA 2RHJA 4HYTA 3W77A 4F4UA 4QNMA 1G3UA 1CC1S 4KUEA 1VDZA 3GZJA 5FL7D 4LKRA 1T2FA 5BNIA 1BKYA 4BO4A 4B80A 3OTIA 2FN8A 4EPWA 1X19A 3DGFC 1K7FB 3K0SA 3L8CA 1JL3A 4RPCA 3MCVA 4PTLA 3UT6A 4EKIA 1LKZA 4TVKA 3S6JA 1COZA 4P34A 5IDXA 2OZEA 3SKVA 1PVDA 3O3OB 3TGWA 1CR1A 4G9BA 4FU0A 1M2OB 3V34A 3ESRA 4AICA 1JIVA 3BE4A 1VQ8Z 3AV0B 3ZV6A 3VSAA 2HJSA 5FI3A 5AXAA 1Y8ZA 1L7OA 3AF0A 3R0VA 4YAJA 4TN1A 4GOJA 4Q1CA 5CJPA 2YN0A 1NPTO 3I1FA 3IAM6 3CCCA 3R44A 4OKNA 3TQSA 5B3KA 5CTJA 4E30A 1PIWA 3IR7A 2GUGA 2PRIA 4OM8A 1C0EA 1NUAA 2P6UA 3OCZA 1BVYF 3BUSA 5HIAA 2WB1A 5SZKB 3ZZ1A 3IT0A 1VLQA 2RGUA 5KYVA 2Z57A 3W7AA 4QPPA 3HYLA 1TF5A 2W2OA 2FWRA 4DPMA 3PGMA 5DGTA 3A06A 4AKIA 2OLEA 3BN3A 4ZU6X 5KWIA 4IHJB 4Q9DA 2YV1A 3GGDA 4D3XA 4QUDA 5SYNA 3TRFA 4NFRA 4QXQA 3V4VB 1M1UA 1WSAA 3QYPA 5LWQA 1E5VA 5H4GA 3QLVC 1N7JA 4W4TA 3F71A 3AL3A 4C04A 2GN1A 3R3WA 2OTJZ 1ZN2A 5FTWA 5MN6A 3TI9A 4AKSA 1IQRA 3ADBA 2PM8A 3ZW8A 1PR0A 4L27A 3T5DA 4BEJA 3PSAA 3I6MA 2IQIA 4HWTA 4JUAA 3HZRA 3ZLTA 5CA1A 4KW7A 4LXIA 2K6GA 5CB4B 5EE9A 5HKKA 1YRHA 1KI6A 1Z36A 1S89A 2EG9A 4RAQA 5CBKA 4YRJA 2Y93A 2IVFA 4FZ3A 3UHPA 5JLJA 2NQ2C 4MA0A 1I9GA 4OK5A 3FGNA 2BCJQ 3H2YA 3SFVA 4Q9IA 1V71A 3VPBA 5JJ5A 1L0BA 3EFOB 3MJDA 3WIVA 1Q2XA 5CFPA 3EG9A 4A73A 4JNKA 3OJFA 4HGQA 2I22A 1MCZA 1UL1X 1HO3A 2RAVA 4LYFA 2CUKA 2O52A 4P3OA 1F1BA 3OJEA 3W8FA 4PNEA 5BN4A 2XNDD 5T57A 5CIQA 1YQ9A 1ECPA 1GCOA 1RSZA 3O93A 1YQWA 5IXSA 5JWOA 1NW8A 1R1DA 3LP5A 1B74A 4ZYTA 2H7YA 4GU5A 2XR1A 1G4HA 3M3PA 2HH9A 3EJ6A 1RI5A 3GLHB 4PTZA 4MEJA 5DU2A 3OPVA 8OHMA 2IXTA 1BKDR 1ZUWA 4F6CA 5K0SA 1CUDA 5BSVA 2W7TA 3COVA 4EYQA 3B82A 1ETUA 5JMTA 1DKNA 4YDRA 2ZBGA 2EQ5A 1LQ2A 2XMBA 1TFIA 3N2KA 1XTPA 1YMUA 1HG1A 1KDZA 3UC5A 3T5GA 4FBMA 1B42A 3W6UA 1G5TA 3QBDA 5G0TA 5BMOA 4R05A 1RP1A 3G6E1 1MJFA 3GZ4A 4YRTA 2APJA 2BLLA 1Z3CA 4RO0A 1NNEA 1P81A 2WD7B 2JCBA 1UAAA 3KJIA 3IQHX 4BKQA 1DINA 1WXDA 1ZNWA 5A0FA 2DU8A 3VC7A 4A10A 3TRJA 4RTOA 4FLFA 1DO2A 3D1JA 2OLJA 2FFAA 4LIPD 3O1LA 3W90A 2QORA 2HU5A 1LPBB 2PRSA 3UOWA 5A4KA 4PRZA 1JAXA 2HUPA 4JSTA 4RHUA 4MRRA 5E4YA 2ONJA 1U8ZA 2YJ4A 2X0NA 3MWFA 1R37A 4GZ6A 4GVPA 1PNTA 2IFTA 4BCBA 3AUAA 3VTAA 3ISJA 2L18A 4JJEA 4PVCA 4FN4A 2HJGA 2QX9A 2V7BA 5A4AA 3I0ZA 3VYUB 3RHZA 1JH8A 4TTSA 1Y6GA 2XXAA 5BQOA 1P60A 4P36A 3UNXA 4D6PA 3V8VA 2GBFA 5B1YA 3T5AA 1I6KA 3NEJA 1AOXA 1F38A 2BSQA 2ZB3A 3DWEX 2EW2A 2O1WA 3COPA 1TUBB 3TVYA 3SJBA 3IHWA 4PFKA 2BIFA 1D2HA 1M2FA 2AGVA 2HPAA 1YS7A 1C7EA 4MCHA 2GK7A 1BMTA 1H6CA 5ADVA 5LQSA 4DMLA 5T6BA 3IUJA 1AQYA 5EJ6A 5T7BA 3B38A 4P33A 2VUGA 1CW2B 2HO4A 2IDZA 1L7QA 4PYMA 2R4QA 3EUEA 5D6NA 4MYHA 2HJRA 5EKTA 5AOVA 3D54D 5AESA 4DT1A 2ID9A 2J3HA 2NNWB 4ZVVA 2PMZA 1FXWA 4WXRA 3RLFA 3WWPA 4BQSA 3C3WA 3W8DA 3GTKI 1Z5GA 3GF4A 4Q9LA 2I99A 4X93A 5C80A 1ZHOA 3DYIA 3IR5A 1Q1GA 4YHHB 4UATA 2A9RA 3P9YA 4IQ4A 2I54A 3IT2A 3KPJA 3U6BA 1VJDA 1Z4KA 2Q1SA 3LUJA 4HAXA 4LRSB 5DN6A 1U0FA 1WXQA 1L4KA 2QD4A 3IIIA 3QU5A 1FP2A 1RKVA 2YXEA 3SKXA 3PQCA 5DX8A 4DRYA 2G7MC 2FYTA 2V54A 2BFOA 5ECYA 3UK6A 1UODA 3ZUPA 4B3RB 4NCHA 2QYOA 3E27A 3F8TA 3EPKA 5DTMA 1S02A 2CZGA 1L5MA 1NPDA 2JEYA 2Q3CA 5DF1A 3SS9X 1L7MA 4YV0A 1UC9A 3GTLI 4ZYUA 1V8ZA 3PF9A 3K72B 3ZLUA 4C0QC 1ZVQA 4BIMA 1UBJS 3HBAA 3QVWA 5L3VA 1I4TD 1QO0D 3U7GA 3L7YA 5FJJA 3WNQA 2JGEA 3I52A 5LBTA 1VE9A 1YJN1 3MJVA 5IK2D 4NECA 2XQIA 4P7JA 2XNSA 1ZH2A 4DOMA 3GA0A 1AXEA 1Y1PA 2QSUA 2C3OA 3H8SA 4UD6A 2QLTA 2VJPA 2H48A 1ENOA 1RWKA 3MT7A 4GQBA 4XYMA 1P3JA 1ZGJA 2R65A 4TYWA 4Z4GA 2FX5A 1PK8A 3GTPI 3KKEA 1VBNA 1XZIA 3K0HA 4I50F 2FCAA 1DKOA 1NAIA 4N3BA 4RKWA 4FBLA 1X9GA 3I9FA 2RH5A 4JC8A 4M0LA 4O4HF 1FS4A 4FMCB 4ALMA 1QPBA 4B74A 4CF5A 4YAGA 4ZYLA 4J4HA 2W4MA 4LYGA 2CNDA 4YN3A 4TMXA 4BZZA 4CHTA 3KIHA 2B63I 1EVIA 2CMDA 2E55A 3CS3A 5DYGA 4B0OA 1JJAA 4MR9B 1WP4A 1Z73A 3AEYA 1Q95A 2I33A 2IYEA 1OBHA 1KTVA 2BHTA 2QTVB 3FDXA 4ZC1A 5BSWA 4OQDA 4DQDA 2IU6A 3F5MA 4LYEA 4YCDA 5JSHA 4CT5A 5BW8A 1WMBA 1WA5A 4X0EA 3U56A 2ES4A 4FYHA 4OCZA 4OYHA 5BSFA 2L69A 2HPHA 2CLEB 4J07A 2ZZKA 2CLIB 3JQ9C 1SHTX 4CWAA 1YJ8A 4IHJF 4ZXFA 3FPGA 2VK2A 1QJ4A 2VYQA 4KFTA 3VYSB 2M2IA 2J5RA 1A5BB 3D2LA 3U4DA 2FWIA 1N2OA 1RM4A 2DWUA 1MN6A 1JKMA 1QGUA 3PC7A 2GZAA 3AUFA 1O3YA 4PG4A 1T10A 3LYHA 2VWQA 4ES6A 2HDHA 3A6FA 5G0VA 2HUNA 3TDKA 1VB3A 3I1JA 4OREX 3CYFA 3SP1A 2IA5A 3T1HB 2FQQA 2QGFA 5CB4F 1YZUA 5CVDA 3SDZA 2JAUA 5EZ6B 2QG6A 1ZOSA 2HT6A 3O0DA 4MQ5A 3ZJYA 3GMTA 1A4IA 3MEQA 3EAFA 5T8KC 3OOWA 4AY5A 1ECCA 4PG7A 1YZQA 2FPIB 2HKIA 1SQ6A 4YDSA 4ZYYA 2R7NA 2AV6A 3CZ5A 1XDUA 3OE4A 1T36B 4EG4A 4KNYA 3MWDB 4ZOAA 1H2XA 3GQVA 4DXHA 1G60A 1R66A 2NP6A 1A71A 2O2XA 4Z0HO 4J1TA 4FFBB 4UM9B 3LKVA 3H2HA 3INYA 4LV5B 1PRYA 4QXRA 4JUBA 4IV5A 1DEXA 1FMLA 1KA9H 3KUDA 3Q98A 4M86A 5IC5A 3ZCRA 1GRNA 3IHLA 3EDYA 5AR1A 1S2DA 4XCVA 4AY4A 2J0QA 1ZD5A 2PUAA 4C3UA 3VH4A 4GKBA 4D3DA 2JI6A 3QUSA 2R1ZA 1T25A 5CPFA 3GGOA 3VR3A 3S8EA 2VTKA 4GRAA 5G0WA 3DF9A 1K4MA 5U1PA 2FWNA 4JFRA 1ILEA 2P9EA 4KR3A 1VKRA 4YMSA 5JYBA 4D3ZA 1BO6A 1FSFA 4WLEA 4BO0A 4EK9A 4RTSA 1UDAA 4HDOB 3DO8A 1JR6A 3AC0A 4ARUA 3WV5A 2VYVD 4QDOA 3LIPA 5JS2A 2CXRA 3TJMA 4WLUA 2GHRA 5B5SA 3RS9A 2EJTA 2Q4RA 5JISA 1UP7A 3RUAA 4MDFA 1KS9A 4CKBA 1YBMA 1SHKA 2QROA 4DABA 5B30A 2OBNA 4MDHA 4H3VA 4TXNA 2CB0A 4DDKA 5KNCH 2CFOA 5TQ2A 2CLOB 4KAFA 1I4LD 1YI0A 1TM7E 2HGZA 1OX6A 3RVPA 3HJCA 2OHOA 1JEEA 3JZMA 3H9EO 3LO5A 4J2TA 3ZCUA 3OJWA 3AIOA 4K9MA 4KKXB 4I1OA 1KDPA 4ACAA 3BWCA 4HQ0A 4DCTA 2WYHA 4OH1A 4ZCLA 1Z0UA 2ZSKA 1YACA 4BUJA 5BPHA 1EBUA 1C4OA 1IY2A 4O4LA 4PG6A 3L8GA 2PRYA 4BFLA 3BXFA 5IEJA 2UXBB 3I2FA 4YTEA 3ADPA 5K0NA 3AHIA 1WR8A 3DLHA 1YL7A 1VQ51 3JR7A 4L3VA 4BO2A 3BXEA 2QMYA 2EJWA 1TECE 3LDGA 4QYIA 3V6LA 4C4RA 2OAGA 3B1JA 4MKHA 1AS3A 3MT8A 4V38A 4LV6A 1WBDA 2HR1A 2V65A 3D2CA 2I4NA 3D6FA 4ZT2A 3STUA 3CMCO 3FCSB 4MUFA 1ENPA 5D3QA 2XGSA 1UOOA 2FB9A 3B6JA 3QEOA 3MTIA 1E7MA 3AKEA 3B12A 1X7WA 3GUUA 3N1UA 4UUMA 1RYEA 5D1HA 3RVJA 2R7KA 3TEFA 5BN3A 4E12A 3JRNA 1CDZA 4MWDA 3SHQA 1ZR4A 3WQRA 4GZMA 4NCAA 3A2MA 5CCEA 3M6UA 3WVNA 4AQ7A 4ARZB 1KRLA 2ILTA 2WWXA 3LUCA 3SF0A 5ALNA 1J4AA 1JHMA 2WOOA 3LU1A 3L79A 4R1MA 2J08A 2DZDA 1FDSA 1XAHA 3KYCB 4CPDA 4C4XA 2HBYA 5J4LA 3R77A 1GY8A 2P4EA 2G6TA 3O75A 4UXHA 2VDNB 4HNAB 1NQTA 2DHEA 3QVVA 3HOYI 1TWCI 4L5AA 1AQJA 4FGZA 4QAJA 3SJUA 1FSPA 3SX2A 1WUKS 3GLFB 2A33A 4WOCA 1GTL1 3V1LA 1XVTA 3WLJA 1EXMA 4DHEA 3H9UA 3I83A 3PE4A 1C4KA 2C2KA 2Y4NA 2XVZA 1V1JA 5H83A 1EFRD 5BYBA 2Q5QA 3KAKA 2C5AA 5J4YA 1OHHA 2IHJA 1D6SA 4GUAA 4XX1A 2F3SA 1Q0TA 3L9XA 3ZWAA 5JSZB 3OAAA 1WW8A 1AN9A 1NBOA 2Z56A 2JASA 2A35A 4MJ7A 3QV2A 4YP9A 2WNSA 3EDMA 3CW9A 1LVUA 2VHZA 3GCFA 1HFWA 2HCRA 1VBKA 1YU9A 2FEAA 3Q87B 4A92A 2QTFA 2OG1A 4DJDC 1BDBA 5H5JA 5G0SA 4HMPA 4TUYB 4OYLA 5JDIC 3VNVA 1E2LA 4N39A 2VIIA 1FX0B 2ADOA 3LT1A 2VRCD 4FGWA 4RFSB 1NOIA 5L3RA 1U8CB 2FZVA 2PH7A 5D85A 4YPVA 1THZA 2V4UA 1I5EA 3BE8A 3BA6A 3CUYA 5AHWA 3RBVA 2HCTA 3W5HA 5HIMA 4D0LB 3WOHA 1MQ9A 5KWVA 1AMNA 4JI4B 3RV4A 1DJMA 2KW5A 3GPLA 1VCNA 2Z09A 1T8PA 1B43A 1AK1A 2FWAA 4PONA 4TM7A 5D1OB 2GEDA 2PKQO 4MK4A 1KKMA 4KXXA 3W9YA 3GJZA 4FMCF 4LDPA 3B6IA 3ETNA 3Q5EA 3DBHB 4IUCS 1UIRA 1R5BA 3AI2A 4Q6BA 1P2TA 2XHEA 2B4QA 3DNPA 4LHEA 4TLEA 3DMRA 4JLVA 5EZYB 2YOGA 4RJJA 3BJRA 2SBTA 4QVGA 2X9LA 4CUKA 1U3GA 2GJ8A 5GONB 1QO7A 1BX1A 2IE8A 4TWBA 3T1YB 4F4IA 5JNLA 3ZWYA 3K70D 4YEDA 4K9SA 3EGEA 4LRUA 2JCXA 3R0ZA 5D1NA 3P2JA 3QELB 4JMPA 2D8MA 3NT4A 2J9YB 4UU7A 1IQPA 1IMOA 1B4DA 1F8YA 1RZ3A 1R9NA 1V9CA 3KKNA 3LBAA 5DDIP 2HWYA 3LBFA 4RY2A 3HSKA 1UKCA 4AECA 2E4WA 2Q0QA 2XCLA 4JENA 3FOFC 2IL1A 1XCOA 2HD4A 1XD9A 3L4EA 3OBIA 4KMOA 4E88A 1VKNA 2YXPX 2PN1A 3A0RB 1CS4C 1E89A 1TCBA 3FYUB 4ITRC 3JD2A 4IX1A 1ORRA 1TCAA 2P68A 2XCUA 4FYYA 4NFYA 5HIIA 3S8YA 4TWJA 5CEEA 3NMUF 1B2RA 4WLFA 4FMBB 4ZCPA 3UAGA 5BMVB 3T7AA 4YP6A 4B3IA 4EENA 1R4ZA 2MSNA 2P0YA 1EX9A 1J5PA 2CLDX 3INRA 2Y1GA 4G9GA 4E11A 1SXPA 1JKJB 1UPXA 3Q3JB 2G09A 3ZVLA 2COEA 3I4FA 1ADGA 1NN5A 4AAYA 4X97A 2KPOA 5EJEA 5JAOA 1O94C 4LGCA 3HOXI 4JEHA 5IAAA 4RD0A 1JEDA 4K6KA 1Q20A 4PZYA 4DJFC 2C2XA 2QR1B 1WUTA 2D0PB 2IU3A 4GD3Q 4L07A 4R5HA 3SXPA 3WLSA 4E0BA 2HDOA 1IVNA 3B6KA 1JYFA 1XT6A 1HLFA 1Q50A 3CTMA 1NWCA 3PU6A 4HN9A 2ZWOA 1QH8A 3MRXA 4Q4LA 4QVKA 1HYBA 2QKDA 1UBNA 2P9BA 5GGYA 5AVRA 1JT2A 3B3QA 2NZWA 1FUIA 5HUHA 4LVOA 1MO4A 3LI2A 2BCEA 4F1KA 4CKWA 2UVPA 5NULA 2HV9A 3OSZA 2O14A 4IY1A 1BC5A 5ANRB 5LDHA 3TNYA 3TBHA 1Q12A 1OLOA 1M1YE 1E32A 2BLNA 1EUZA 3EGCA 3RFCA 4HQKA 2IEGA 1JB1A 4MAFA 4CTKA 3GRPA 1XVLA 5FPPA 2QN6A 2ZEJA 5CP8A 5K0BA 3UKDA 2LFUA 4EBFA 1RHKA 4MQ4A 2X86A 5KI6A 1HDOA 3EJWA 3IRVA 5FO1A 1S0UA 2ZULA 2VCYA 2A9JA 1NBME 3I05A 1K5PA 1ML8A 3D8RA 4JSYA 4KFUA 4NRDA 3V33A 4DIEA 4NPAA 3WK7A 1QFYA 3H86A 1ONPA 2P9ZA 1FBTA 2YICA 4W7SA 2CNOA 1ISJA 2QLVB 1BFUA 4GUDA 3DBLA 1V1MB 2OFFA 2VG8A 4JKOA 1NQWA 3CCJZ 1WNTA 2B1QA 4FIDA 1K2VN 5AUOB 2VF8A 1FFEA 1Z6XA 3P4YA 2WWVD 3NJRA 1N8R1 4NONA 1N2EA 5HA5A 4DADA 4MYDA 1M34B 4ZMSA 2VJMA 2QTRA 1Q0SA 2WFLA 3TLAA 3SFZA 4AKEA 1JDBB 1KNXA 3PHGA 3TR5A 1NP3A 4M0KA 3RJZA 4JWTA 4QO7A 1IZ8A 3OZGA 1KZ7B 1E3SA 2QA5A 3CD6Z 3DMTC 3G4S1 4ZIRA 1XMPA 3BWVA 1NW9B 3QBEA 1CQZA 2QM8A 2RK3A 3H1PA 1I2ZA 5MGBA 1NR7A 3CISA 3BXOA 3CSDA 5D3ZA 3HJFA 1SBHA 3GR6A 3HVUA 5EPUA 1HQCA 4IIGA 4UNQA 5EXTA 3TBKA 1Y80A 3TLZA 1UBOS 1XTUA 4W9RA 1LDGA 1BQ4A 1XQ9A 1YVUA 2VKTA 4I1YA 3UPDA 4O4IA 4DREA 5C5CA 3MMPA 2J6CA 2D06A 4IH4A 4GYYA 4TTAA 2JA2A 2IODA 1I6WA 5IP7I 2IZOA 5FFNA 2CNKA 5JH7A 1ATIA 3DDHA 1U1DA 4IRMA 1UH5A 5KEIA 4G5XA 2GJ9A 3ZWCA 2RJNA 3L0YA 2TECE 4JC5A 1Z2EA 4NARA 1M5RA 3ZDFA 1WCIB 2XYHA 1RWWA 3QLTA 4X6UA 3BS4A 2NVUB 1IBLB 1UQTA 1CQPA 1USPA 3QTBA 3UHJA 1USWA 4Q7EA 1SVIA 3VSEA 1J2TA 4EKGA 2YJGA 3DV9A 2VL7A 4TYNA 1C9JA 1O9GA 1P4RA 3PDWA 1DL5A 3GNQA 1UR5A 5K6RA 3NC4A 3U0VA 3CXRA 3C7DB 3EBLA 1PJLA 3NR2A 5JNUA 1WBBA 2GX6A 3IT1A 4RPGA 1E3WA 2QLBA 3OQBA 3PPIA 3K09C 2WM9B 1AKRA 3RUCA 5CLJA 1Q7BA 3MRTA 3KTFA 3S2SA 1MRSA 2RDMA 3TW0A 3I55Z 5TT0A 3NIGB 1H69A 2ZI5A 1EP3B 4I5IA 1B26A 3VYWA 4MGYR 1E18A 2C4MA 3QJYA 4ESHA 5A02A 3H2KA 2RGNA 1NQVA 1ZEMA 1XD2B 2N0SA 3FGPA 3SYRA 2PK7A 5EMJA 3DDSA 8ATCA 1YOVB 2CFSA 2DGDA 2QV0A 5DVZA 3PEYA 3LECA 1G3RA 3RTCA 3BREA 1I7NA 2QU7A 3THSA 4ZV4A 2VF7A 3K30A 4OYRA 5B58C 2QMQA 4BNDA 5AW7A 3O47A 4PHHA 1KH1A 4FXPA 4NS4A 1Q0PA 1UM9A 2OHIA 2W43A 4F7DA 2COUA 3B3AA 3VR5D 5KIAA 1PS8A 5EZYF 2VSYA 4CI9A 3PT5A 3UZUA 2UXCB 2CJYA 3QX8A 3GPIA 5CDFE 1AKMA 5GONF 3REGA 1OXUA 3DYVA 2VNAA 5D2CA 5LC1A 4C5CA 2JEOA 2C5BA 3PQDA 2OGSA 2HV8A 4M9XA 3ZQKA 5JXGA 4XE5A 1KEPA 3UGKA 5ESXA 3U80A 1I94B 4OU4A 5ITZB 3VHLB 4YT8A 4KAAA 5ABPA 4EUEA 4KQ2A 3WZMA 4WFQA 4XQ9A 4PWZA 4BX2A 5HRCA 3M6XA 4IMPA 1KDOA 3CSSA 1YKFA 1M54A 1J5XA 5CUQA 5HIJA 1OPRA 3IIKA 4YP7A 2JAOA 2YMPA 3FAZA 5KX5F 3MM4A 3DUFB 4F4FA 2QBYB 2C97A 2PGAA 5LYJB 4DCNA 1UDBA 2W90A 3CZMA 4ZCQA 1RC8A 5DW3A 1W2BY 3WIDA 1H5NA 1N2CA 2IBMA 2NIPA 3J7AC 2H9IA 4WKCA 3O7WA 1W85A 3ZHYA 1RRCA 3PKJA 1SCQA 3DS8A 4HS4A 4QXAA 3DNFA 1J25A 4UASA 4B4KA 2QNRA 3F5DA 4LSMA 2CNLA 5AVYA 4J16C 2R4UA 4ZO4A 3AEKB 2OHGA 4AURA 1C7ZA 5A7FA 3M4NA 5JFGA 2XIQA 1Q1ZA 3L0OA 3WBKA 4RNCA 4I1UA 9LDTA 3KKZA 4MWSA 5DNVA 1LNQA 3WJ7A 3JQ7B 5LQUA 4ERXA 2YNMA 4X54A 5KU1A 3WLIA 3JATA 3FY4A 2JLSA 3I4MI 5CGZA 1WXXA 3LHFA 1ZRSA 1DKQA 1J2EA 3KVOA 4BQOA 1X0VA 3UAWA 1CNFA 1LPAB 1ARZA 3WYDA 2Z6UA 2RIQA 2TMGA 5JSQA 3NDRA 1DRUA 2ZIAA 3RASA 5JD5A 4ND8A 4BECA 4CR8A 3PNSA 4GBJA 1G21B 4MW4A 5JNTA 1H6BA 4K8OA 1P0IA 2B9VA 3ESZA 4FB5A 2BGNA 4P32A 3KYBA 2ECOA 2W6IA 3K96A 3QA3E 1CB7A 4FN5A 1XMSA 4R3WA 3DTTA 1UMBB 3AJ9A 5A0TA 5JJIA 3N8DA 1AKUA 3C3XA 3G59A 1M8GA 1TK2A 3MCUA 4DSZA 2IY7A 1N5OX 2NYUA 1KEVA 2A1TR 1P9NA 3ID6C 1W48A 4Q19A 1TD1A 4FD2A 1RYMA 3PXXA 4PNHA 1GADO 1M1YA 1EHCA 1T9GR 1X42A 2ATCA 4R9VA 1K9VF 2FWJA 5F52A 1Y4SA 2IX9A 1ACLA 3PVCA 1DAMA 2DHRA 3QRWA 3B52X 3K53A 5TSDA 1U98A 1IXRC 4R9UC 1N8SA 3NTLA 3DAYA 3TQRA 3MAJA 3DQZA 1NMQA 1UJNA 2R8YA 2AEEA 2WHPA 4EG7A 1EUCA 4KQGA 2ST1A 4AY2A 3ONNA 5FORA 2H1LA 1O5TA 3GJXC 4HC4A 1OKKD 4BN0A 3DDZX 4GR5A 3NTOA 4YS6A 1UMDA 4L3WA 5AM0A 3ZWQA 4AP9A 4NZZA 1X7DA 4K6FA 1TA9A 4Z53A 4MJXA 3IP7A 4XWGA 3PP8A 3KPUA 5JZOA 4YRLA 2NUBA 1KR2A 3FBWA 3ZE9A 1ORIA 4JD5A 1V5EA 1W6UA 1AKYA 1O9HA 5LL6P 3OMWA 2P9TA 1C1XA 1M8JA 2O0MA 1XEAA 3AJRA 3HHEA 1E1YA 5ESRA 4FR0A 1WPRA 1DKPA 5FI0B 5PGMA 5K0JA 2QE7D 4A3GI 3AUUA 4BNTA 2EFHB 4DUYB 3PKIA 1OILA 3MJFA 1ISGA 1GPWB 2ESRA 3FJOA 4M99A 4P4SB 3OJOA 1E0SA 2IIQA 3EGDB 1SPBS 5I6DA 1I2MA 5EWJA 5B12A 1UWCA 1H5UA 3SQWA 2YJ6A 5E9WA 2O2HA 3FSGA 1ZS9A 1YJ91 2FY8A 2R6CA 4G36A 4ILKA 1QP7A 2IPNA 3R6TA 2HWWA 5LA6F 4B45A 1C8VB 3BORA 3J81b 1SFRA 5B1DA 4W5HA 2NQ8A 5KTRA 2BEJA 2KYRA 2R8BA 3FPSA 1PJCA 2PT5A 2W5UA 2PS0A 2X3YA 3LXRA 3SZ3A 5HKBA 1DLJA 1P6QA 3MFQA 4O2RA 2ZETA 1U99A 3DGEC 3WLQA 3JZAA 3PDCA 5JSFA 1DX4A 2YJ5A 4QLOA 2EF1A 2DE5A 1Z6ZA 2ONKA 3BFXA 4C6SA 4BYMA 5M04A 3BDAA 3K0BA 4C22A 4PC1A 2IPAB 1Q1NA 2EXXA 1XXHA 1UBFA 2PYZA 3F6YA 4GSLA 2HU2A 4IIFA 3U17A 4CJXA 5CFNA 1FPQA 4N8EA 3TPFA 4MJ3A 5L7WA 2E4YA 3RFTA 2V9PA 3RIGA 1E58A 5H81A 2ASEA 2PUBA 1CTQA 3ZV7A 1GL7A 1TK3A 2ZXFA 3OLYA 5K2OA 5DGDA 1U8YA 4ZANA 1F14A 3K94A 2WWYA 4C87A 4EH1A 5B6JA 2FF7A 3OQIB 3GG9A 5JZMA 3S81A 4LBWA 4YGYA 3PBKA 4MMXB 1UBCA 3FLMA 4NBNA 3F3SA 4C4AA 1GKKA 1C4WA 1K6MA 1X1TA 3T61A 1WZ2A 2DUWA 2IPMA 4ZI7F 1WABA 2ECPA 2WYIA 5H3HA 1Y6ZA 3WHIA 4A0GA 4ZCTA 1J0DA 1PKEA 4I5DA 1SXJA 3UFBA 1RQXA 3E84A 2GYUA 2QRUA 4NNPA 4UM7A 3TE5B 1P45A 2RI0A 4CM9A 5DTJA 5FLKA 3QY0A 1KZGB 5FBZA 1FP1D 1SM4A 1LI4A 2A9PA 3PJEA 4JS0A 3SCZA 5IJZA 5E1OA 1E0JA 2W6QA 2MCFA 5J4VA 1KEZA 1V16A 1SCBA 1LC3A 2VPTA 2CJWB 1Y82A 2IPLA 1WSWA 3F6CA 1E1DA 4MVYA 2F6RA 5EIBC 4YC7A 4QTTB 1KXJA 4MITA 1VLJA 3BMCA 2AC7A 2JLWA 2Y27A 3K2EA 3Q7PA 4QM6A 1QRAA 1IULA 1YNOA 1YVRA 3GCWA 1LD3A 3C43A 4A3BI 4LXHA 1T8WA 1W30A 1HYGA 3BOSA 4W7IA 3BICA 3WOVA 5KOYA 1KZ1A 2I03A 5KYUB 2WF7A 1E2KA 5CDFA 2FG5A 2R60A 4FX5A 4G09A 2R6GA 4WX2B 1CRLA 3I28A 5HK9A 3H83A 5KOHA 5CJJA 4I4LA 4U2BA 2EEZA 5FPYA 3UB2A 4X6YA 1U1CA 2BSXA 3QIVA 4PAGA 5AK5A 3SIPA 1WF3A 2JZOA 3O8RA 3KOXA 2WM2A 3JU3A 3IPRA 2HA4A 4GIBA 3WC4A 2V7QD 1ES9A 4L6IA 4DCOA 1VPTA 4DQUA 1QZTA 1FSZA 2YS7A 2GKGA 2EFGA 3FGZA 3ER6A 3OA0A 5JO9A 4CNQA 5BWNA 3TGPA 4PFJA 2Q1WA 2VHQA 5EKUA 4HJXA 4K28A 2VHXA 2B2XA 3KZ1E 1ZD2P 4U8HA 2D3WA 4ER6A 3G0BA 2W8BB 4HF7A 5TXGA 1RBMA 5I9MA 4F91B 4CV3A 2O0LA 3DA8A 3FZQA 2FSVA 3C0KA 3NKLA 1QBGA 3GDHA 1UAGA 1W46A 2C04A 3PK0A 1T3TA 4IOKA 1BMFA 4IZ6A 1O97C 4QFCA 3BWYA 1NW7A 3EVTA 1K5GA 4NATA 3KQOA 1M1NB 2I71A 3CINA 5DYWA 3TD2A 3VJMA 2CLSA 1SXHA 4RXTA 2GKOA 4UCWA 5COQA 1Y3DE 4KGDA 4F06A 4FYIA 2JKZA 2ZBUA 3NUGA 4CTJA 5BOSA 1GKIA 1GU0A 4J3JA 3RHFA 3V4SA 2FLKA 3ANNA 1C14A 2V4MA 3A9VA 3IMKA 3NU1A 4L7VA 4JI1B 4BP8A 1JX6A 4RGYA 2MYNA 3W9BA 3HY3A 2OGZA 3C3KA 3O8QB 1VI2A 4NMHA 3WHPA 5KHLB 3KEMA 5EKSA 1H2ZA 3RYHB 3WGKA 2QDXA 3ADDA 4B3XA 3ZIAD 3ZJ5A 2BEWB 2VTEA 3NUZA 3C8MA 5BXYA 4CFZA 4E5KA 4ENQA 2A7QA 5EZQA 3RRYA 4OHMA 1W0CA 1P5RA 5CYFA 1FLAA 3B2QA 1U4SA 1OWNA 2ZJ6A 3C4VA 3EIEA 3F47A 3GT3A 3S0JA 3A3NA 4DSNA 1RXSA 3VR4D 5E7MA 4ZT7A 4X92A 1O57A 1R9JA 2O2JA 2H0AA 4OJMX 4QFBA 4RY9A 2V7TA 4D46A 2FZ4A 3W8EA 2Y6UA 1KJZA 3AUSA 4HRAA 4WK6A 1XTSA 1XPOA 4RA6A 1ZU4A 2H16A 1GT91 2P79A 3OSUA 3U7IA 4BLUA 2ZBFA 4E14A 5KYNA 2NP7A 1VQ71 1YMQA 2YINC 3ZQ4A 1KGSA 3CVXA 1UC8A 5DYTA 5A4DA 2IYNA 4J9UE 4F85A 3EDCA 1YFKA 1J2YA 2QRNA 1ISIA 3EY4A 3VYRB 2E21A 4BS9A 3IDOA 5FEUA 1NRJB 2V7UA 4K9NA 1UXOA 1GQ2A 4O08A 1ZVVA 1XCLA 4KX5A 3PDIA 1N7GA 5JS8A 5KNDD 3LQ4A 3VB9A 2W6OA 3IKJA 1VMIA 4MNTA 3W2TA 3D7SA 4BBAA 2BFBA 1WD5A 1RQ2A 3W6ZA 5DM60 3VBCA 3AFGA 3ZOKA 4GOOD 1OY1A 2AEFA 2B6NA 3OC0A 4JUDX 4LYYA 3IILA 3C3DA 3DZIA 3UJ6A 4C43A 1UBHS 5JR3A 1YUKA 3UFXB 2YKGA 3DD1A 5J2TA 4C7OB 3ZXUB 1KWGA 3OWOA 2LVBA 3G8DA 4FGKA 1G5PA 5AYVA 3WNBA 3LUPA 5AK4A 2A92A 1T1EA 1WRBA 3AY3A 4REOA 5JO0A 1JHQA 1R5JA 1A2OA 1EVQA 3PVSA 3U37A 1ZK3A 2P5TB 1RWOA 3IKTA 2FQWA 1QK4A 2DX7A 4R1OA 1NI4B 5DGCA 4HTFA 1OGJA 1JNXX 1L1RA 1BD3A 2C2MA 5CX1A 1PZMA 5ENDA 3R0IA 5FRDA 4BHTA 1KSFX 1YE5A 3LXXA 4PY2A 3ZV5A 4BRZA 4DGSA 1SOUA 4ZN6A 2FN9A 5JQGF 4H3KB 1T1GA 3FPKA 4P80A 4HL6A 1LDNA 2V0GA 5HFNA 3EARA 3BG0B 1XQXA 3KYJB 4G1FA 4R1LA 3ZUGA 1P5ZB 1YZFA 5IYZF 2Q51A 4WW0A 1VI6A 3BB1A 3ZDQA 4ZT5A 5JANA 4CLHA 2D1FA 1D1PA 3FTNA 3JQAA 4E5NA 3DB1A 2FPMA 3QLUA 4P98A 2XRZA 4EHAA 2B34A 1OB2A 4AULA 2LE0A 1YZTA 4L8VA 1V39A 3OZUA 3PJRA 3O3CA 1C3OA 4YLGA 1LXCA 2QMEA 4RC9A 3HA5A 3QYAA 4RYLA 2Z2IA 1DQZA 5TGDA 5IWCA 3UHFA 2DWCA 2GUWA 4E5PA 4NBLA 1NVMB 1A8SA 1SGWA 3IH5A 4LJ8A 3RSQA 2I2DA 3WFJA 1S3SA 3WGMA 721PA 2CN1A 3R3JA 1GG8A 3WRYA 5FI5A 2A30A 2QTMA 1TE2A 3BF8A 2FSSA 1IHXA 2V59A 1NR1A 3BC1A 3WYNA 2F64A 2JD2A 3BGVA 4MI6A 3DM9B 1NUIA 2ZYIA 3RSHA 1G0OA 1XZCA 3ASZA 3LPAA 1K8A2 1SOMA 3UWMA 3GLGB 1KOFA 2YL2A 1G5HA 4XYBA 3M3DA 3VI3B 3K35A 3L06A 3BWEA 5DISB 3ZDRA 3CZ9A 4GWGA 3Q9SA 5CLLA 3I561 4EA6A 4ENWA 3GJTA 1W2GA 1RXVA 4HXGA 4O5AA 1GPJA 2HREA 2XAUA 4PXAA 3CLRC 4QLAA 5FBRB 1RKBA 1Z5OA 4DEXA 5I8PA 3G9QA 1T2DA 3MAGA 1K731 5AMXA 4HLUA 1DELA 2XUOA 4RF4A 3U4QA 1UT6A 2CJXA 1GAXA 3NT2A 2QRKA 4KO8A 5F5LA 1ZO8A 4QT4A 1L8AA 3WYEA 3CLTC 1GPDG 2XNJA 1PJ4A 2PGNA 3FUXA 1NJ6A 4GPEA 1BJKA 4JJ6A 1AO0A 3IQDB 2OOKA 2AI2A 3KPVA 2YDXA 4G5FA 1QTNA 3FTQA 3CR7A 3M2TA 1NM5C 3P20A 3T7EA 1VG8A 3EFEA 4RK5A 2Y0SA 3CR8A 2VRWA 2ANCA 1C0LA 2NU6B 2WMYA 2V7WA 3H5WA 2RAUA 2KPIA 4J3NA 3WKDA 1CRPA 9ATCA 3ERCA 4NBAA 2ZT8A 4H18A 3QVGB 1QDLB 3RRJA 1N3YA 4M0EA 4Y67A 2ZAEB 1XEWY 3DTVA 2ZCJA 3GYGA 5FB3A 1Z07A 2FZLA 1Z47A 3TSOA 1X0XA 2YOFA 3DBOB 4JROA 4YQFA 1ZINA 2CBXA 2Q4DA 5JQGB 1FCJA 4UQLA 2O59A 1DBIA 1DT3A 2RH9B 2HA3A 2QXTA 2XDQA 4RTRA 1AHIA 1ZJJA 2CUNA 1XJCA 5CD9A 4YBZA 2GN6A 5SZIA 3UHOA 4M8IA 1DC5A 3TQCA 1KBOA 1S8AA 4JHLA 5KTSA 1DQSA 1O8BA 5LWHA 3SEQA 4BAGA 1X77A 3PC6A 1DTWA 4XQGA 5K99A 3FTEA 2PRKA 4UJ3A 3M8KA 4K86A 4WCFB 3Q3HA 3A6EA 4U7PB 4NG4A 1KY4A 2XXJA 3N87A 1RPTA 2G70A 3HJTA 4PPNA 3GVXA 5DB4A 3P0IA 1AE1A 2W6PA 2OCBA 2WJYA 2FPUA 2FFHA 5C8ZA 1T6ZA 1FL9A 4M7OA 1S8NA 2WD8A 3SE0A 1UBUS 3WWOA 3G68A 5KVAA 3HVKA 3RSLA 2UUPA 1YQTA 3UTCA 5AJUA 3MGCA 2D62A 3GWGA 2XCIA 4A6PA 3RQIA 4IIBA 3LDFA 3UK0A 1JXQA 1V1RB 3A1WA 1JEQB 5TPZD 1U7PA 4ICIA 1P1FA 2YVQA 2DFVA 4YH1A 3PUHA 5EKDA 1E6KA 1GRRA 1GGEA 3KXIA 2JLAA 2SNIE 2MR6A 2YY7A 3BMOB 3NAGA 1E1QD 4KYIB 2OXIA 5FO0A 1I2DA 1JP7A 3O82A 4K0RA 3UN1A 1DIGA 2GEBA 2SHKA 4G0VA 4P53A 3DYBA 1ISFA 4R1UA 1OFGA 1T2VA 3KQYA 4TM8A 3UV6A 4Y2TA 2ASVA 1N6OA 1BMQA 4B5LA 5HIKA 1IMJA 1HR0B 3VOBA 4K8RB 1L7VC 2DFPA 3R7WB 2PJDA 1WQ4A 4PPYA 4HFNA 1XCPA 4IBOA 1IIBA 1ZC3A 1GG2A 2WINI 4V1CA 1SKUA 1SHUX 7REQB 2O53A 3F46A 4WDQA 1U0OC 1S3FA 1E5XA 4WXMA 1Z83A 3B3GA 1V5GA 2Z83A 1YIJ1 2P30A 3DZJA 1SBIA 3L8ZA 3ELUA 1P44A 1NMYA 3UOAB 4M2LA 3DXFA 5EZSA 5IRCD 1QIGA 4CM8A 2FG7C 3CUKA 4YCBA 4REQA 3I9KA 1M6WA 4QOFA 1J99A 2BEUB 2ENUA 3MJHA 3DV0B 3FCXA 2V98A 2GFHA 3IAEA 2B8NA 1YB2A 1F2UA 4BGDA 1A72A 2ODQA 3F5QA 1RBYA 2DJIA 3UHAA 5F51A 3QXGA 3T0IA 3OA2A 1NI3A 5GADl 2WHQA 2IS4A 2AZTA 2ZAOA 4GOXA 4XYGA 2NV6A 2XDYA 4MW9A 1J70A 3LA8A 3QOYA 4EB6A 5ES3A 1ZNZA 4MV4A 4WNYA 3KUKA 1K27A 1X2BA 3F4LA 3M9LA 1QF8A 1QVFY 4P08A 5KDLA 3G5MA 4O2BB 3PI6A 4RVUA 2R7ZI 1R5NA 1U0GA 2AJDA 3KTAA 5HQJA 4Z51A 4AI6A 2QAGA 2QRZA 1QIEA 3K9LA 1SKYE 3VX4A 1Y7LA 5FCDA 1E63A 2ILVA 3QNWA 4IZOA 4D9EA 3KS9A 4IFBA 1H65A 2FPGA 3NX4A 4IGAA 4NEQA 4ZZIA 1TMKA 5EJ4A 2VTBB 2H2HA 2J7PA 1DBSA 3MWEA 4FLEA 2HA7A 3ENNA 2J9GA 3ZW7A 4V3BA 4JT9A 1ORDA 3L8EA 1KJ9A 4M37A 1L1EA 5CT9A 4LDJA 4AQYB 3X2EA 1I3OA 1KDRA 2OHXA 2WIGA 2XIJA 1RXIA 2ZAMA 3D3EA 1I36A 5E6RB 5E95A 5IW8A 3TCNA 4B8YA 4Y9TA 2P2YA 4CL1A 2ZCVA 1Z0IA 2O0JA 3BMQA 3ROKA 3BHIA 4J6EA 1GGNA 1H8EA 1Z7WA 1OX4A 4W1PA 3QPWA 2BSAA 4FC7A 3O2JA 5H16A 4FFOA 4D02A 5K0LA 3TKAA 1YRLA 3AVYA 1IOVA 5FULA 3ZY5A 5F9FA 3KHUA 4DV3B 4KTTE 2IIVA 3P7MA 3WYBA 3IPAA 4DLWA 5KKAA 1U6JA 2OCKA 2V5AA 4ZCIA 3S1LA 3OZTA 2CHVA 2YN4A 1RQNA 2OMKA 4S1OA 1Y1LA 4JVOA 2PDAA 1T5HX 3MJCA 4UAGA 1CNMA 1ZL0A 2LDXA 4K6HA 3A36A 3JAMA 4C4YA 2CXTA 2AR0A 3CBQA 3KOMA 3RZDI 4MVJH 4LMPA 5HK8A 4LJKA 4ZAGA 4X90A 3QF7A 1A5AB 1FMTA 2M1ZA 4Y2QA 1PYDA 3A1SA 2OZLB 5KOJA 3EIXA 2I3GA 4FYWA 2EKBA 3J7TA 3RDPA 4CIWA 1NF2A 2QQEA 4G4GA 4X3PA 4D79A 4BYGA 3RJTA 2JFFA 5DM70 4AYBA 2HSJA 3EGVA 1VI5A 2VDJA 4C2AA 1KI6B 4BN4A 2XMZA 4PBTA 1S2MA 1K7EB 1GFIA 2X0RA 1VZ2A 2Q2QA 3FF4A 4KQKA 2K2QB 3CCSZ 2DPHA 2PK3A 3EXHC 3LWZA 3QMPA 5DHPA 4ZVUA 3T3GA 3W2FA 3BMNA 2X7XA 1P74A 1W0JD 2ZJ3A 2GEVA 4JNCA 2XKBA 1RM3A 2YYYA 2TSYB 2VRBA 1Z22A 3EG9B 4U63A 1CLEA 1SC6A 3WICA 3DE5X 4RPKA 3WZLA 5A2GA 3OIDA 1FVFA 4IF4A 4X7BA 1BVUA 4TL8A 1OFUA 3LCUA 4FNAA 2LV8A 5I3ZA 5BN4B 1U3DA 5EWMB 2QRPA 4BXOA 1HYEA 4IUDS 1XZ8A 1T4BA 5JCPA 1HFJA 1Q6ZA 3O90A 1B6SA 1L4EA 4LG1A 2JLRA 3M1IA 3M6VA 1QRUA 3IEVA 3O1JC 4D98A 1PFKA 2BBOA 1LDBA 1TM5E 2OWDA 1HFEL 4MR8A 3TDMA 4ETWA 3GW8A 1P9WA 4QGAA 3IS3A 2QM0A 4YUVA 1JG7A 3IB6A 4BVLA 1FYWA 3EA0A 1G3QA 3I9JA 3KRTA 4UMFA 1DUIA 5FQOA 4QWMA 1E0KA 5JFTA 9LDBA 5BVHA 3SS7X 4Y3UA 3RADC 1YF3A 4GYJA 2AOUA 4UMDA 1Q92A 3V7NA 1TAGA 2AHRA 1NRXA 3SBOA 1J8YF 2FH5B 1TKAA 3CC4Z 4HAWA 3VSCA 4QO8A 3W5UA 4EAQA 2I29A 4JBLA 4EYKA 1NDHA 5C32A 4M8LA 4W5TA 1QYVA 4QNRA 2LUOA 3E5RA 3ITNA 4AMVA 1RR6A 3N6RA 4DQKA 2RJ3A 4X45A 2Y99A 2J33A 2XOKA 3TZQA 2XF2A 5EERA 1NBMD 4F3KA 1M1K1 2R87A 4YMIA 4F6RB 4MINA 5AK3A 3ITDA 1XYVA 1A97A 4FOTA 1W29A 1Z82A 4TL9A 1Q21A 3LOPA 4OLFA 2MTBA 3ZCSA 1CY0A 1NVVQ 1DPGA 2SECE 2ODWA 2Y6VA 2XBLA 2E2JI 4G07A 4MR7B 3ET4A 4MYCA 4RD2A 5ALHA 1NATA 1DIOB 1RLYA 2NZVG 1F4PA 1LLDA 5KNBA 1QQTA 2ZSFA 3AM5A 3OZAA 4X1KA 1ZAYA 1HV8A 5D1PA 1U3UA 2JJYA 2N46A 3EODA 3T15A 4C6TA 1TFUA 4MWEA 3GCGA 5JEEA 4TYMA 1RYHA 1NX6A 3HE3A 4EFKA 1SK9A 2R11A 3ACDA 2OBFA 1B8NA 4X8MA 3IMGA 3IVXA 5IX8A 3CCV1 1GPKA 2PL9A 4WEQA 2HK9A 4KDFA 1BSVA 4NMWA 3I9LA 3WLHA 3WKCA 4R84A 4F4JA 4CETA 1Z8FA 3NH5A 4NPHA 2E2HI 4PCLA 1RHUA 1DIRA 2QHXA 3LZCA 3NTRA 4OQQA 1WDMA 1ZVMA 2IOQA 3I42A 2DY1A 4ITUA 4C6HA 4PX5A 2WTMA 4EJSA 4NWIA 4F2DA 1PJSA 5EC8A 3NRJA 3P8ZA 1GXSA 5A3SA 3Q40A 3QFRA 2WAAA 1Z6TA 1CRZA 3U2QA 2CHQA 1JVNA 3LGXA 3S4YA 4DDTA 3JVIA 5CHYA 2V3CC 2YIMA 3EGOA 2QD1A 3DWIA 3IP6A 3EVGA 3MRSA 4QREA 2I67A 1CYDA 1OZAA 4RVNA 1UDCA 4R01A 3S44A 3VPGA 4D8WA 1NN0A 1AURA 2IYLD 1CPYA 4TSKA 1G7SA 1WZCA 4DR7B 4BB6A 1Z63A 1ADBA 1R0BA 2HNAA 2PCJA 4YV7A 2CMHA 2DYKA 2QN1A 2Y68A 2G5PA 3LLCA 1SURA 1EU1A 1VKZA 1X7ZB 1CP2A 3C70A 3DBRB 1C2YA 3KXLA 3UCFA 4X3CA 1GZDA 3DT8A 2OP1A 3NXKA 4LXQA 1QRRA 3RFXA 2D4HA 2Z8YM 1TTPB 3F6RA 4LJYA 4Z9YA 4HN4B 3DH0A 3FCYA 3FDFA 4MULA 1FOEB 2Z2YA 3W2EA 3HJNA 5IP5A 3CZRA 5FOWA 3KSBC 2Z6VA 4MD9A 2HHCA 3WK6A 2P5UA 3DEFA 4F5EA 3CF6R 1QG0A 4X5OA 3DHWC 3VHXA 2HT1A 3GEBA 3A2KA 1DHRA 1NKSA 1OTHA 2POQX 1ZGAA 4JLMA 4IIDA 4LRTB 2UZIR 3D8TA 3OFNA 1ZK1A 1JJ2Y 3VH2A 3UENA 3U3XA 2AZMA 1KYYA 2GM9A 4TVSA 1CERA 3UJ3X 2AB0A 4R1QA 3Q1LA 4NCIA 1Y81A 1L5GB 4U9UA 4U3JA 1OLXA 3EUAA 3WQSB 4AKHA 3DL2A 4WOPA 5C3EI 5DNYB 1G8KA 2ZTMA 1IATA 3MWKA 3WSWA 4YASA 1IJFA 1XU9A 3STXA 3RYCB 1CZOA 3FUUA 4J0EA 3MGGA 3O21A 4CMBA 3PF8A 5KREA 4DA7A 3LLMA 4R8KA 2JGNA 3C7KA 4QARA 4DLZA 5CDYA 5AVSA 1FDOA 3NLLA 5EMLA 3C3BA 3HM2A 3K2BA 1O94D 4PF1A 4AYXA 5JECA 2XCSB 1MGOA 2QX4A 3IR6A 5NLLA 2X1VA 2QTLA 2IGBA 4N6GA 5JXJA 1A8HA 3EW9A 1PJQA 3H1BA 2Z30A 4A91A 2XBUA 1DI0A 4TMTA 4NDNE 2CW5A 4XWAA 5AKHA 5B1IA 2IIBA 1UKAA 3K0EA 1FNMA 4DFDA 2V0CA 4Q9JA 4L5BA 5CA1F 4HZIA 1A88A 1QVAA 3V97A 1I3QI 5J1SB 2FEKA 3INTA 4NBCA 2WV9A 3C8UA 1QWSA 3FFAA 2ZUWA 4GEGA 2JJ1A 4EO4A 5ICC