2GTHA

Crystal structure of the wildtype mhv coronavirus non-structural protein nsp15
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
370
structure length
348
Chain Sequence
b'SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYFITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 91
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gthA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gthA02
2RHBA 2H85A 2GTIA 2GTHA 4RS4A 4S1TA 2OZKA
chains in the Genus database with same CATH superfamily
2RHLA 1ZRHA 2MINA 2XCUA 1NPYA 3LLUA 1QOZA 5CHEA 3RRNA 4FZ5A 2XV1A 1ZVMA 2XQIA 4WV3A 3RVSA 2ZSIA 4GX2A 1EX1A 4LWZA 5EUQB 2JC3A 4B3JA 3B3FA 1C80A 3OM8A 4OJTA 4WFQA 1KMHA 4FYVA 1H9CA 1U7WA 1SG0A 2OOYB 2PSHA 2FP4B 2RGBA 3FCUB 2YMMA 3OUZA 4G0YA 2H1SA 3GMDA 1HGXA 2AWNA 5F3RA 4DILA 4I4TA 4JWKA 2JATA 1VL0A 1RXWA 2NTYC 2YTZA 3BIJA 3KZXA 3WGJA 2W03A 2VNKA 4LRWA 1GA6A 3HS3A 4Y6PA 1E8MA 4MROA 4W63A 1ZM4A 3CLRC 3U4AA 1PLLA 2UYOA 4YH1A 1WLYA 2GBFA 3CUYA 3VKVA 3AR9A 1HQDA 2P7HA 1V16A 3KZNA 3MT7A 5G3ZA 5LR6A 2ZATA 3OPYI 4MPRA 4Z9YA 1MC8A 4PRLA 3GIDA 4RA9B 4AN1A 1NTRA 4M60A 4B34A 1QZZA 1XL0A 1TGVA 1E1LA 1TPZA 3OZGA 3W8NA 3DDHA 3WBKA 2CMGA 4WKCA 5ARDA 4Y1RA 2OZKA 3PNVA 3AIKA 3CCEZ 1ZA1A 4RX1A 3IEKA 2REQB 4NEHB 5KX5A 5DYWA 2XB8A 1FIUA 5EC8A 4GMKA 3DEYX 4E32A 4TYNA 1WP4A 1ZU4A 2FG7C 2VBCA 1F06A 3IEPA 1LDGA 1WSWA 1NDHA 3KV3O 3Q85A 3V7WA 3C24A 3OW2Y 2C5FA 4KH1A 5TNXA 5L4SA 3KQPA 4X7BA 4FEYA 1U0EA 4IQGA 5K0FA 3OCYA 3SE0A 5ECWA 1W5TA 3BFXA 4IGEA 3KWMA 3OJ0A 4MD7A 1YJ91 1G6HA 1A5TA 1Q1EA 2Q27A 3EVNA 3AJ9A 2VJMA 3FLMA 3GUCA 4D4GA 1EVYA 2L17A 3R4VA 5JJCA 5MGNA 4B6OA 4F56A 3WMFA 3D9QX 2NUAA 4R9NA 3WWEA 3FHLA 4EDHA 3K8YA 5IXYA 7GPBA 3TSAA 3VYWA 2GRAA 1Q0PA 4PTZA 4B6RA 4H4CA 3U16A 4IMIB 3QP9A 3V7YA 4UAJA 5C3EI 1IE3A 5A4MS 1AQIA 4ZI7B 1SUAA 1Y9ZA 2BF7A 3HJGA 3QBTA 4KK3A 4R8RA 4DNQA 4GSKA 1HDGO 1M1K1 1CIJA 1LB1B 1XRLA 1T9DA 1Q0LA 3P2OA 1YO6A 2JGDA 3ED5A 4HGZA 1IQRA 3CLSD 2VK2A 2Q51A 3QENA 2G0TA 1II8B 3KQQA 4O4LF 1Y9DA 4WBXC 4LZAA 1FZTA 2WICA 4MWOA 1Z68A 2EFJA 2A92A 5DH9A 2ZZNA 1GVHA 1Z6AA 5EKTA 4BZPA 3SX2A 1HDOA 4DYHA 4I1RA 1IM5A 4R51A 1FFHA 1FB5A 3HBAA 5SYNA 3UKOA 1KMNA 2QM3A 3A9WA 2Y68A 3IA7A 1KDVA 3KXPA 3UXHA 1ORWA 4DG5A 1Y6JA 2BISA 1LZLA 1PWZA 3IE0A 2HF1A 3ONVA 4FFBB 3GTMI 4HEQA 4U5XA 4NARA 1WV0A 2NZVG 5GOZA 5F1YA 3VSAA 4UULA 4YMHA 2C9CA 1L8AA 4L8WB 4BMNA 5JNUA 2D6FA 3P45A 3AVTA 3DF7A 1E2IA 1ZJ4A 1FNMA 4DJFC 3R7FA 1Q0HA 1PLJA 1WR8A 1YR1A 3KWLA 3BRWD 3DEZA 5TVKA 1T24A 4AG6A 2NAFA 3E58A 3F6PA 3DAHA 2ZAYA 3AF4A 1YHYA 1RXIA 2Z3WA 1HFEL 2HF8A 2F1JA 3AWDA 1SQGA 3FDJA 3G68A 3KAPA 3MIZA 4MDHA 4YAGA 4TWZA 5JEDA 5KQLA 4WN3A 5JH7A 2QIPA 4NBAA 1I4EB 4QPNA 3NWEA 5EIXA 1HL7A 1M6WA 2YBEA 1OU0A 1QF7A 3N9IA 4UNQA 4WY2A 3U44A 1E77A 1WSDA 2DSTA 1MO4A 3F9IA 2W8BB 4NCXA 3LDAA 3RVNA 4BU1A 3TFQA 4ARSA 2JJQA 1OROA 4PICA 1M0EA 2FMUA 3DMHA 1NN0A 3HCEA 1RYMA 4RS4A 4IKEA 4E6EA 3TCXB 1K68A 2OSBA 4YASA 3AQ4A 4MCJA 5ER9A 3SF0A 4DMFA 2FW8A 2A9FA 4C78A 5DW0A 1VZ2A 2ECOA 3WNBA 4MLDA 4B5LA 1K8YB 4G65A 3HP4A 5LZ9A 1SVOA 3CCQZ 3AHIA 5HEKA 1P73A 2QXUA 5AVKA 2AZTA 1XFAA 3HOWI 2PZJA 4GQBA 3VYUB 4AYTA 1DAEA 2W00A 2PZKA 2H8GA 1P7WA 4MLPA 4Q47A 4QRIA 4MJXA 3FXAA 2JGLA 1PNRA 2QRQA 5JTUA 2J9FA 3BMQA 5DWVA 5F1OA 3HYRA 4LFAB 2FFBA 3F6BX 3PNSA 3MWYW 3AF1A 5CYOA 4MIKA 3H2YA 2QAGA 3Q72A 3EZGA 2C82A 1ZMOA 4MO9A 3SQNA 4AO8A 5CYPA 1CUCA 1RAFA 3EWAA 1GV1A 1IPEA 3N8DA 4PPQA 5G0UA 5FWAA 5JFTA 2BP7B 3F7TA 1KP9A 1VPWA 1N2IA 1V5FA 4OK5A 2Y0DA 2UUOA 4L27A 4LZNA 4R3NA 3QY0A 1YS2X 2VPYA 1GNQA 2VAPA 4TM8A 4C21A 1ZOIA 5FPKA 2YV3A 4X1KB 1VL5A 3IAM1 2XJ4A 3LT2A 4Y6OA 5L40A 2Y4OA 2R5FA 1S7GA 3Q5DA 8AT1A 4OBXA 5EP2A 4RFSA 1SKQA 3I4FA 4OYYA 3SZMA 3AUAA 1UBGA 2OHXA 4WKBA 3I9JA 5H9WA 1PT6A 1BMQA 1IM8A 5BSRA 4F4IA 4EZBA 3B3GA 2QUJA 3WLPA 4AY5A 1SCAA 2H92A 3I30X 3ADDA 4PXSA 3RKSA 4V0OA 3VU1A 5TEVA 2XB4A 2EKBA 4U7DA 4DV5B 1J20A 1GCIA 1DQZA 3C6MA 4K6CA 4P4GA 4W1SA 3OX2A 4HH0A 4MB0A 4FIZA 5D51S 4EF6A 1YI8A 1FLVA 2VUUA 3D4NA 4L85A 2GO1A 3K71B 2CDBA 1SKBA 4YR7A 2VFAA 4OF4A 5FL3A 3U19A 2A7XA 2W2TA 1C3OB 4HQKA 3ND9A 1U2EA 4E11A 1DEKA 1NJ1A 3NT2A 1KYIA 3MPUA 3OX1A 4MW7A 4I55B 4H1HA 4BLQA 4CKXA 3ZJTA 1C7ZA 2H2IA 4BUCA 4K9OA 5IARA 3GJYA 2WIKA 2D1SA 4Y2VA 3WZLA 4Z4EA 1KYWA 1R4ZA 1BDIA 4NDNE 3OLXA 3LVRE 3Q2OA 1N6HA 2PSEA 2X1LA 3C4QA 1FDVA 4D1YA 1CULC 1E2PA 2PKEA 1SBIA 1ZBQA 2MJLA 1M5RA 4AY6A 1JR4A 3BWEA 2WYHA 3L7MA 3OVMA 3KIHA 3NHLA 5CDHA 1RC8A 1IK6A 1TUEA 1Y8RA 4BKPA 1RXUA 2HJ9A 2YWRA 1Q22A 4OHCA 2ECPA 3ZCTA 4V0SA 2XWJI 2K5UA 1R0YA 1K63A 1CG6A 2BR3A 1KPGA 4JAVC 2IS4A 2NU8B 2QMYA 5EPUA 2BI7A 2GHRA 4PRKA 5JYEA 1IL0A 1VQ51 4ZYUA 1T9ZA 5C8YB 1Z0ZA 1U2QA 1XU4A 1Z36A 2ZDHA 1L5KA 1VPTA 1VQ61 2IOHA 1HYEA 1KSJA 3HMQA 3ZHVA 1EWTA 1KS9A 4XWAA 4AY4A 1LLUA 3K35A 3C15C 3CF0A 2CNDA 3GT0A 2ZIWB 3Q9NA 4RABA 5H83A 5DM60 5BW5A 4GMDA 1AV6A 3MJSA 4PAOA 5A5EA 1T35A 2XE6A 2F9MA 3IQDB 3UMSA 3CURA 5F7XA 3TYXA 3F71A 2AXNA 4CBVA 4RSGA 4AUKA 121PA 2GK4A 1Y8QB 3IXLA 1R6UA 1U0SY 1RKQA 4NH0A 4LJRA 2WC1A 4JZYA 4EX7A 4BLWA 2JDIA 3ANTA 4TV8B 4CLOA 5K3EA 3UT5B 4JFRA 3HA5A 1TWAI 4GICA 1SVLA 4GKKB 1ZAKA 5IPFA 1RAAA 3S14I 4QHYA 4WZZA 3I01M 1OLSA 2IUEA 3DJYA 1CUVA 3L49A 3N75A 5CH3A 1VSTA 3HU2A 4RH3A 3CNOA 1GFWA 1T6BY 2TMGA 4IH1A 2NIPA 1N1DA 3OZ7A 4ZZ0A 2OORC 3DTVB 4IJ6A 1QHGA 3QKTA 1SUSA 3O91A 1GZUA 4G4SP 4NBDA 1TYDE 4M3NA 1PFQA 3W2TA 3MMSA 1PEAA 4IZOA 4K9NA 4JELA 2O1WA 2D62A 2KE5A 1WXHA 5A7FA 5BXYA 1DI0A 1JHVA 2LDBA 4QG7A 2G8NA 4HXFB 4URWR 3COYA 3EODA 2B8TA 3A7EA 2KM1A 4BFZA 3DD5A 4IWYA 4XQCA 2RHBA 5C35A 1HR0B 1UT5A 2JD2A 3C3BA 4F9TA 3Q8MA 2DLNA 2PL5A 3R5SA 4HDRB 4E0BA 3AFIA 2X8JB 5K8CA 3VI4B 4K8RB 2PMEA 3L4KA 1DRJA 2Z09A 4KQWA 4TT8A 3PDIB 3WFIA 5JSZA 1G6KA 4Y9TA 2NWQA 1U7OA 4FJ0A 5HKLA 5AVSA 3K70D 3DE4X 1P0IA 5FBLB 3OM1A 3DHWC 5E4JA 4MEJA 1P17A 5D85A 1SB8A 4KQJA 1A8UA 2QRHA 3ESQA 4M8SA 3WSTA 4C4ZA 4ZV4A 2H08A 1T4GA 2QNRA 4R8MA 5F73A 2F3UA 4AUMA 1JJAA 4CMKA 3ETLA 2YZ7A 1W93A 2A5LA 2IL1A 4LZPA 2W2PA 2WJIA 4DYVA 3JVVA 2EERA 4K88A 2VTBA 1JHMA 1SBTA 1FYWA 2V6GA 3R6TA 4TKZA 3STHA 2IHNA 3LXXA 2ZYIA 3NBXX 1AOXA 3A2MA 4V02A 1O8BA 2Q7DA 4ERXA 2GTPA 2Y1GA 3M3PA 5GJBA 5AI4A 1CYEA 3TAXA 1OAKA 3EBOA 2AFRA 4IS2A 2EARA 1ZK3A 4LJ5A 3CVJA 4ESHA 3VC2A 1LPBB 4V0LA 3W4KA 4M9CA 5K6AC 3HKDB 1TZBA 1LA2A 1VYTA 1CUIA 2CDNA 2JJMA 3P4XA 4DA0A 1SC4A 3PEUA 1ZJZA 4D3ZA 5GJCA 4D02A 1JFSA 1H2FA 3GTKI 4RCYA 5FBHA 3EMBA 3FPSA 3RUCA 5KWSA 3V46A 3NUGA 2EHJA 2ZS9A 3ISVA 5CNIA 2VDUE 4H31A 2BM8A 3EA0A 3RS4A 5CDFA 4RTQA 1R9TI 5M29A 4OHBA 1KQ3A 4G4GA 2FWJA 2VDPB 1G8AA 5FPQA 5AK6A 5HP4A 1SHZA 4KZPA 4WL0A 1PTKA 1VKZA 1ZCBA 2L2QA 4HGOA 3KK0A 3SSAA 3TB4A 3VBCA 2G82A 4RV9A 1L9XA 2QRUA 3C6ZA 4OGLA 4ZOBA 4FSDA 1PR3A 4XLLA 1KH1A 2CBXA 3TE5B 4F9GA 4GUDA 3LUDA 3WQQA 1ISGA 2GN0A 3VYVA 3DZGA 3FUUA 3ONEA 2WM3A 3NIBA 4LZOA 1JXAA 5KYXA 5FUXA 3H3JA 1HFJA 3DJFA 4F60A 2JLCA 2TMKA 5L7YA 4MGEA 5ED4A 3WK4A 1Z4JA 4O5AA 2B1IA 5IUKC 3AGQA 1XYVA 3N70A 2NSYA 3HFSA 2FRXA 3K9CA 4INJA 2BBWA 3FPLA 4GLOA 4RDCA 4ZAYA 1CJVC 3PUZA 2A6PA 3RSHA 5L8VA 4GWGA 1Z63A 4TMXA 1V25A 2IXDA 2QMOA 1C29B 3U6KA 1K8A2 3KKOA 5CA1A 3TE7A 3G2OA 1Y48E 3EZYA 4HLNA 5EHXA 4G24A 4GI3A 4LF5B 3BGDA 3E9CA 4PFKA 2H5JA 1AZSC 2IZ5A 3DO8A 4Y6QA 1FNSA 1ZAYA 1I1HA 4EA6A 1PZGA 5FBRB 5HQ3A 1V2GA 4B7AA 4IH9A 3EOAI 4D9IA 2IZ6A 3A11A 5EE5B 5KNCA 1OI4A 2X5XA 1EUZA 5C4XI 1RYNA 2JJYA 2OQRA 2R7LA 4KLNA 4OKIA 3T5BA 3OTGA 1ARZA 3NVKI 1VGVA 4AKGA 4MVYA 1L4EA 1DEHA 2EFCB 1T2CA 2JFPA 2JZCA 1Z5UA 2IV2X 1EQUA 4QUJA 3V4RA 3I5YA 4QELA 1WW9A 3RYFA 5CFOA 1KO1A 4EKYA 3KSUA 2DCUA 4JI2B 1VHWA 2Q1YA 3EUFA 3HJHA 3O26A 3QXJA 1RO2A 4UD2A 2M9MA 1YS7A 3IUYA 4Q00A 5EJAA 1RP1A 2H06A 5EGNA 3GLIA 4N0QA 4LY3A 1JQ3A 2SKCA 2ATCA 2VZEA 4K03A 2V54A 4X63A 5CT9A 4Q7LA 4Y0VA 4Z1MA 2BTEA 2ZWAA 4GZLA 3DP9A 4NESA 4PXYA 4WKPA 4AAYA 3GCFA 4OJKA 1Z2EA 5EESA 2PT6A 2X9NA 3D6NB 4I1IA 5HF5A 4CM8B 2JLUA 3M5PA 1CZLA 3DV2A 2GS9A 4OH7A 1Y37A 4AG3A 4RLQA 4IQ8A 4R2WA 1ZA2A 3LHIA 3QELA 2OWDA 3URMA 1ZKDA 3DV9A 4MWCA 2CBZA 3T7RA 5FAKA 3AVVA 2O5CA 4BV2A 2AFIA 4RHFA 1LI4A 3ASZA 1KI2A 4CCSA 2HDOA 3DQPA 1HI9A 3UXEA 1F38A 5A0FA 3WDMA 2Q9BA 1D6SA 1QP0A 4WLOA 1Q0RA 4GEKA 2QV7A 2P9QA 4E5SA 2FX5A 3RC7A 1HMYA 3DGFC 3O0TA 4UM5A 3JD0A 5CURA 2MWMA 4M1MA 5BUZA 3QUBA 1I50I 5L45A 2XE7A 2WMYA 4HP8A 1PZNA 4V1CI 1A8HA 1LJLA 1NYTA 4N7JA 1WKCA 4BEJA 2ODEA 2XYGA 3PRYA 1K98A 4DJDC 2FPUA 3A1CA 4AN0A 4KQKA 2G71A 1QRRA 2I91A 1WE2A 3Q8KA 1T0JB 3I6YA 2YR0A 3L41A 2FDXA 2W4IA 3JARB 3O93A 4OHUA 3LUFA 3W5VA 4DEVA 3HOYI 1XLTC 5A9RA 1X70A 4G67A 1HH4A 5ELMA 3N07A 4KUGA 5BSFA 2HRZA 2YCBA 1CUWA 1UPXA 1SFRA 2QRKA 2VF8A 4OLJA 4TLDA 4RHUA 1W5FA 4FOLA 3T6KA 2JHAA 1FQJA 3VOBA 3AG6A 3QM1A 3C8UA 1D09A 5IVIA 2DUWA 5LWHA 5PGMA 1ESCA 4UVHA 3MYRA 1U0TA 4N18A 2J31A 4JLVA 4GDFA 2DBVO 1BKDR 2FOIA 2WAOA 3O75A 4RF5A 4MA4A 3G0BA 4H0CA 1W46A 1DINA 2H07A 3G9TA 1RWMA 3HJNA 4MS4B 4NX2A 1NW3A 3IIMA 5KDDA 2DECA 3AIMA 4UDYX 3GJ0A 2C88A 1C4OA 1AUXA 3QKWA 5FA6A 4KOEC 4M8NE 1K89A 1ZI9A 1IDN1 2PG3A 1VCOA 3BL8A 3BJMA 1WB5A 1ODLA 2R48A 1FOEB 1GR0A 4BBPA 1U3TA 2FKAA 4ZA2A 1R12A 3MS2A 2F43A 4YUYA 5JZBA 1SOVA 2CLMB 1DWUA 1G66A 1E2KA 2PX2A 1LKZA 2P6NA 3IE1A 2VBGA 1K8ZB 1N8R2 1QXFA 1E3QA 5TF4A 3W1VA 4G6ZA 5IC4A 3TKYA 1R8SA 3OQHA 4ENRA 5BN3B 3HN7A 1JR3A 4NOLA 3ELWA 2XOXA 3AOGA 3AFHA 3GJ6A 4LRXA 3PT5A 5ALYA 1XDSA 3WBJA 3QTLA 2XZPA 3RCBA 1JJFA 4G5YA 3WGGA 4MQEA 1VC2A 2GT1A 1S4QA 4Z9AA 5TT0A 2J3IA 4B09A 5CCXA 1U9YA 4F9EA 3X1XA 4KQMA 1YDFA 3L7KA 3TMYA 3E1GA 3GGJA 1YIJ1 2R1VB 2IHKA 3W8RA 1FZQA 1LS6A 4MRIA 1AKVA 5EZ5A 4D2IA 1M1YE 4HYQA 1WOYA 3F8TA 5KREA 5JMWA 2ACEA 3DZBA 3GRFA 2WR8A 5EMKA 4QGSA 2BGUA 5BQXA 2WHXA 3PE3A 1DSSG 3PJFA 4CG1A 1C9JA 3EF0A 2ONJA 3EUEA 4EYQA 3UYKA 3O84A 3K0EA 3TH5A 3F6RA 1FUUA 2BAGA 2PZFA 1JB1A 1HTBA 3I1JA 4CL0A 4LDNA 2EQ5A 3CN7A 2E1PA 5KTKA 5ALKA 1I3LA 1GCAA 4YDHB 1J49A 3HBNA 1XMPA 4MRRA 5BN4A 5AVWA 5U1PA 3KALA 2WAYA 2AYYA 3I45A 3QSGA 5HIKA 3VR5D 4FFDA 2I55A 1XRRA 1RRFA 4AMVA 2AG6A 3PXAA 3T9EA 4OHKA 3KTDA 4EA9A 6YASA 2SCUA 2LKCA 1F1JA 3UUEA 4CF4A 3NBYC 4J0CA 1G20A 1KZHA 3TL3A 4DL9A 4HNHA 3JQ7A 3ZR4B 4RADA 3DZ8A 2F3SA 2W6PA 4OB8A 4A3II 3WGVA 4QICA 3CCUZ 2C2GA 2O1SA 3EB9A 4QOIA 4S2EA 2QMQA 3CZRA 2RB5A 1B00A 1GKKA 1Z0JA 1TQ8A 2VRWA 3KKKA 2GTIA 1PDWA 2GEKA 2FUG6 2PGDA 3EZLA 1P1RA 3RV4A 3ZW7A 4BVHA 4JBWA 1IXYA 2PXHA 1E7MA 2IOFA 3OJXA 1W75A 4L75A 4URUR 4XGNA 4YC7A 5TXGA 2UYHA 4LV8B 1S89A 2J4CA 3KOUA 1S1MA 2A84A 3BRSA 3EBLA 3EW9A 1ZISA 1ZGZA 3H4TA 5DBGA 2WJWA 5DNCA 3A6DA 3C6QA 3C3EA 4FQ7A 4MV9A 2C4TA 5F12A 3RF6A 5FPTA 2NPOA 2H29A 2NT3A 4KYVA 3AM1A 2AC7A 1WZEA 3PIDA 1J06A 4PPYA 1OWPA 4M54A 3WWYA 1NMSA 5EWLA 1BXGB 1E92A 3CEAA 3B1ZA 2OCBA 4M98A 4IOKA 3ITKA 1ZOPA 2XT0A 4BFWA 3VHQA 4NE2A 4AECA 2PK3A 3HV0A 1F6BA 1N2BA 4XW2A 5K0LA 1N2CA 2VP6A 5AOVA 1IZYA 5T6BA 1PL8A 1AKUA 3R0VA 5JNTA 3ZW9A 3I9NA 3QVUA 5MFPA 3IT1A 2CV2A 1Q77A 5JH7F 1T3SA 1JILA 4KTVE 4MYRA 1HT2E 1RYHA 2RJ3A 4HSGA 4E15A 1IBCA 4M1TA 3IHWA 3X1DA 1M0WA 5DN9A 3DWFA 2B99A 3QMMA 4LUCA 4EUFA 1W4ZA 2O8BB 3I56Z 2I6GA 3KR2A 4YEDA 4DV7B 3FJYA 3TZEA 3TLKA 4OI0A 5D1OB 4Z9FA 2VHQA 2Z0MA 3RSGA 2ECFA 2I6QA 4U2DA 2EP7A 3VSDA 2J0UB 4OAQA 4PCUA 3QEMB 2BCJQ 4MNTA 5C1BA 1TM5E 4OQNA 1WB4A 2IHYA 5TF0A 5FI5A 1X8KA 2X8WA 4PLPA 2GMWA 2HJGA 3CSUA 4C7KA 3SJ7A 2VSYA 3AUTA 5AYVA 2P1ZA 1E61A 3BUSA 1U8YA 5JATA 3SS9X 3I5UA 3U0BA 3OQMA 1MR3F 5D5HA 4YMLA 3OLWA 3L79A 2EJBA 1LX6A 3VISA 2JGJA 4HDAA 5FLKA 1RSZA 1YVPA 4QX6A 2PANA 4UPEA 1YS9A 2G1AA 3R3UA 3D8SA 3CUUA 1QVFZ 3R7WA 3L07A 5BWNA 2R87A 2NM0A 1UZNA 4HQ0A 1WHSA 3KS9A 1YZGA 2PU7A 2XF2A 4DIOA 2Z5LA 2XZOA 4LBWA 1Q50A 4O4HF 1EWQA 1QIJA 2B0JA 4GMXA 2ODTX 4UBIA 1D2CA 3ZV7A 4MWZA 2NPFA 3WTCA 1E99A 4TXLA 5ULLA 4X20A 3ZQUA 1E9CA 1A71A 3IKLA 3V8VA 3F3PC 1YE5A 2H59A 3TQCA 3KKPA 1XEAA 3LSYA 3UFXB 4DN6A 1JSLA 2XMBA 2AI1A 3BZBA 4G25A 1APBA 1IZZA 4BU0A 3LQ2A 3FR7A 3LTNC 2AKEA 3P9SA 4L6IA 3SHTA 3BHNA 2PWYA 2VDOB 1KAGA 2BEKA 2Q9CA 5EUCA 2HLPA 1MJNA 1JDVA 1PL7A 1UKEA 2CLKB 3CWCA 3DFKA 1T26A 3DLCA 3GHHA 3KVYA 3ZGXA 2PQ6A 1T4BA 2QPTA 5I9IA 1NV9A 1GV0A 3I9FA 3PUJA 1EHCA 3S16I 2X2FA 1YNSA 1UCFA 1C3JA 4K87A 1ENYA 3MCWA 4X1OA 3WAJA 3LCVB 3M81A 2I1LA 2XMPA 4J90A 1AZTA 4BVJA 5IKXA 1ZXXA 1XXHB 1C1DA 1MEEA 2GF2A 3CNBA 4OHRA 1KBZA 2IEDA 2HZ7A 2HJSA 1S3IA 3PA8A 4JUAA 3RYIB 4RVUA 1PQUA 1FYVA 3JTMA 5ED0A 3FYSA 3HN6A 3RLFA 2D5CA 2HKIA 1X3ZA 2M32A 2O2EA 3CINA 4CQMB 3JCZA 1KI9A 4DVGA 2XA9A 1Q7Y1 3I551 3G88A 4QZVA 1WXEA 2BHTA 3SC3A 3EYWA 4Q3LA 2WJYA 3FYUB 3QQPA 4POAA 1NQVA 4P3KA 8OHMA 2QR2A 2X0KA 1SCUB 1PG2A 2BRUC 4UCWA 5LOVA 3VTAA 3C1TA 3SJAA 1BXRA 1P3JA 4LZZA 1IN7A 3AJ8A 2RHWA 3EPHA 1DZIA 1GG8A 3FNQA 4HB3A 2IK8A 1JSZA 1OC2A 1D2GA 1NFFA 2GQ0A 3G79A 5K51A 3DZCA 1CR2A 1BXZA 3KNZA 5A4AA 5DM4A 3WI7A 2R5WA 3GVXA 2GEJA 3CLKA 4EHLA 2WYIA 4DR6B 3WQSB 5JSUA 3GRPA 4MA5A 4DCNA 3G2IA 2HD4A 2YZ2A 4LXHA 4PBSA 4TTQA 4HUQB 3KFLA 3QFRA 2PT9A 4XPIB 5FNVF 2CXOA 1G7CA 2D3WA 3I2FA 4JFAA 1KI6B 2JGFA 4N6OA 1J2TA 1KI4A 2F3QA 5BV0A 2HRRA 5ALSA 3PX3A 5LLTA 2FNAA 4DHWA 3AF0A 3LCUA 3EEBA 3TXYA 4ILKA 2XVAA 3UJDA 5EIAA 1E0KA 1NDUA 3GZ4A 3CPHA 2ECKA 2JHPA 3S2SA 3W77A 4FYMA 3EXEB 2GHQA 2X1HA 3K94A 3SOPA 2QLVB 1JLLB 3DE0X 1RZ3A 5L3RA 2RHDA 2C5AA 4A0FA 1ODIA 3DW3X 4X3PA 4CQLB 1JKFA 4REMA 4GZ5A 1EFTA 1LTHR 1Z34A 2Q2VA 4HRVA 4KN8A 1ZB9A 4PZDA 1YIDA 4CLRA 2ZYUX 4DRXB 2IXEA 4G9GA 1XR3A 5IAGA 1S7MA 1QYCA 2UUAB 3KB6A 1RR6A 2B8EA 4GYKA 3AKCA 1KZ7B 2PRYA 3EFHA 3HB1A 4NG4A 5DTMA 4Z54A 2QN6A 1A9QA 4L5IA 4RMNA 4B3BA 5JJLA 2DUJA 1PG0A 4N82A 3N0WA 1ZJ6A 3K0AA 2Q6OA 4DGSA 1YRYE 2Z58A 1BVHA 3QFCA 3AWIA 2C4UA 1H5QA 2MR5A 4CLDA 1W2GA 4J03A 5HJ7A 1XXLA 3PC4A 3JU3A 2ZDGA 1GT6A 5DYGA 1JP7A 1Z6PA 4LTDA 1OIWA 1FRQA 2XWBF 4UNSA 1L4MA 3F5DA 3ABZA 4QUGA 4XH9B 4MB6A 2GZ2A 1EVZA 3IUNA 4X1IB 5B4VA 5JS7A 4DVJA 3QXCA 5FI1B 3W7BA 3WISA 4WUVA 2CL5A 3HGMA 5AN9F 5KTNA 5BMOA 1WUTA 4OSPA 3H2IA 1L5NA 3AHFA 3MWEB 1KQSZ 3RRMA 3JVUA 3BD9A 1U90A 2FWIA 1UP4A 1NYLA 2GPSA 2W2XA 4YCMA 5ITZA 5KJFA 2E5LB 1ZB8A 2O6HA 3GI1A 4NHOA 2YXDA 3WRYC 5BVGB 1E1MA 1KZYC 2RCYA 1C9EA 1KNQA 3G0OA 4B84A 2CYBA 2AH5A 1HLDA 1T8UA 3CEHA 1UMDA 3HNPA 1P1FA 4OX9B 1OLOA 1VGQA 1WUJS 3KELA 4Y9SA 3A8TA 2Z6VA 4KWTA 1UZMA 5L4LA 1MTOA 1H85A 1FP6A 2EJTA 3MB8A 5CVEA 4D96A 2B83A 4DWVA 2DKFA 1DX4A 4A0QA 2ZWPA 1P8JA 4Q19A 3ZV4A 2QTAA 1A1VA 4LJLA 5IC5A 3UJ8A 4IUDS 3KSDO 2VJAA 1NXQA 2HNKA 1CQJA 2HT1A 3AVWA 4KWCA 1LBTA 1LRKA 3VMGA 2NUBA 4P4SB 4R7TA 1XLWA 4C87A 4EJSC 4MW0A 3R09A 4YT2A 3PX7A 1TZ2A 3MD9A 1NDQA 1YGYA 4DT1A 3DHEA 1AMNA 3D8BA 2W5UA 2EOAA 2O5VA 1A7KA 2CMDA 5ITVA 1NASA 5IZ4A 2XKKA 3B5IA 5DDIP 5K1ZA 2BHSA 4UMEA 4YAOA 4V39A 4RF2A 2CDAA 4BZWA 4D9FA 3C74A 4PZPA 5BQPA 4TT3D 3ZCUA 2WYVA 4Z9XA 2FSUA 3LP5A 1I2DA 1U7XA 3SP1A 4LWQA 1WCYA 2B2CA 2HWXA 1U63A 1LVGA 4E1BA 3RVDA 3MTBA 4UXJA 4MP8A 4G5RA 3V8MA 4M8IA 2AYZA 3MCAA 4DLBA 1FJGB 2AI2A 1CUSA 1E7SA 1RLYA 4LTMA 4EPRA 1US8A 3UWMA 2VTEA 3G2JA 1D0IA 2XCSB 1OH8A 2HEGA 1S96A 1Z7EA 4ARAA 2ID9A 1Y1VI 1OGJA 1IN6A 1ULBA 3MWFA 4QOGA 2I7CA 2GJ9A 1EX6A 2QQEA 2QX6A 5FOSA 1JYEA 3OD1A 3SIPA 2WVHA 3NVMB 4PHTA 3V1TC 1GRRA 5D01A 3W2FA 4ZOQI 5KOIA 4IHJA 4O6VA 2G0AA 4ZYXA 1KO8A 1QE3A 5I9NA 4M0DA 2R1TA 3GZNA 5HQTA 2H00A 3WYAA 4CFSA 4INPA 2XI4A 4EECA 4OIMA 3ZJ4A 2WDZA 3KD2A 1WXIA 4CCYB 3OFJA 2PHZA 4GBED 3K7EA 3QMPA 2GKSA 3CWQA 3FUXA 2ZRLA 2AQHA 2EJWA 3FROA 3GDHA 4WT7A 3NU1A 4C4RA 3L43A 4KVFA 1Z0FA 4Q7EA 2F4MA 4BMYA 2OGUA 5ARCA 3GP8A 2ZIZA 3RM3A 1FFSA 3GNQA 1WCXA 3FDIA 1PT9A 1VE9A 5DHRA 4C7BA 1KS2A 4A82A 2FW9A 1U3UA 3D8UA 1EK6A 3WFZA 3GEPA 1AM4D 4GRDA 3ZXUB 3HI4A 3R3WA 2O57A 4JL8A 5HUHA 5IBPA 1MH1A 3E4DA 2XUHA 2BRUA 3K96A 3T5PA 2QQ5A 4Z0TA 2GAJA 1NSFA 5JV5A 5KYKA 1L9KA 4OM7A 3CH7A 1MHTA 2VDMB 1FSZA 2DHEA 5IS2A 1U11A 4KQ1A 3C3YA 2BTQA 2ZIEA 1A7AA 3HADA 1KJIA 3IBFA 4OBWA 4UUOA 3BN3A 4FFRA 1ZH1A 4JYAB 1G2QA 2I6UA 4QWMA 2O7RA 1M1NA 3NNSA 1RWXA 1XKTA 1PNOA 3R3VA 2AW5A 4OXQA 4UDXX 2WB1A 2C0PA 2UVQA 5H4GA 2JANA 2QJWA 2PMDA 3P9QA 5SZHB 5BW8A 3MONA 4NZZA 4OGGA 1V43A 3WLJA 2W83A 5ADVA 4AB1A 3U7GA 1XB2A 2NZ8A 1ONSA 2Z9BA 4IDHA 4KR2A 2P75A 1SULA 3RPEA 2P6OA 4AO7A 3QXXA 2Q28A 1G7RA 1J42A 2OK7A 1DOAA 1Z33A 2ONYA 1CJTC 1C3VA 1E6MA 3TZLA 1R18A 3GRUA 4BMVA 4B3SB 4FSHA 1ULAA 1Y1LA 4FNMA 4JBIA 3CTMA 5F2NA 5CT6A 3EWNA 5K0CA 1LXCA 1FVHA 4XB2A 3OBBA 4LNHA 3GJXC 4ND7A 3CUSA 1Y8CA 3L6DA 3V55A 2BPOA 2VQDA 3KL4A 3VX4A 4BBJA 3W5CA 3E8SA 5C34B 4CR8A 4LPKA 4HEJA 1GSHA 4BB9A 5CBKA 4TYYA 1E1CA 5KYWB 4GKVA 5E0KB 1A4XA 1VLJA 4B1FA 4EBBA 1CFJA 2YWCA 1BKSB 4A3CI 1XYGA 2FOXA 2J3DA 3ET5A 4JY7A 5DI3B 1A9XA 1UWKA 1IBKB 1M5TA 2ILTA 3FPKA 3LNCA 4GI7A 4GXNA 4TSRA 1Z7YA 4EO4A 5LQRA 2Z8YM 1A2KC 3HY4A 4GNKA 2DTEA 5JQGA 4ZGWA 1TM2A 4BJ1A 3AKEA 2P3OA 2PX4A 3SIWA 1EM6A 1ZX1A 1E0DA 2DWQA 1C0EA 3GQBB 4CR7A 3GMSA 4RD4A 3R9KA 4ZJPA 4KNYA 4W7IA 4DJTA 1GLNA 4PQEA 1Y1SA 3D2AA 5HRAA 1RIFA 3ND8A 4M46A 4XAQA 3M6WA 3UFBA 3ZJVA 2IZ7A 2PX6A 1MEOA 5A2Qf 3FSJX 2GPYA 3ENWA 4E1VA 1T2NA 4Z8YA 3HCRA 4V0ME 4OP2A 3NCHA 4M0PA 3AVPA 1QYPA 1C4KA 1E4OA 3EEIA 3DHYA 1Q57A 3ELBA 5IM4A 1JDTA 1WSAA 3N59A 5THXA 3T0GA 1JWAB 4K6MA 1Q74A 4EB3A 2O8FB 5CXXA 4M7RA 5LBIA 4ZEVA 3PUKA 4EK9A 2YIDA 3EE6A 3WYCA 3ZI0A 1K86A 2MYPA 4KREA 4EVQA 4Z7QB 1VQK1 1V9CA 4IX1A 1USPA 3HXOA 3FTNA 2O8DB 5FOTA 3Q87A 1G1MA 5C4MA 1B74A 4DIDA 3BSYA 3HVUA 3VUEA 2I1WA 3IVRA 3ISJA 4OL0A 4YECA 4PONA 4X62B 2H7CA 2V1XA 3D7KA 3ESBA 2Q3LA 2GSWA 3JATB 3K5WA 2XVXA 1BWSA 1Y6GA 2NO6A 1T2UA 5DEOA 4ZMSA 3KB2A 2OSVA 3HO8A 4LV5B 3S99A 2Q3CA 4A3SA 4CV3A 5CYGA 2QRCB 1E79A 3HBLA 3CG4A 4ZYLA 4PIPA 1SC1A 1M66A 5BWOA 3REQA 2ZTUA 3WDLA 5EJ9A 3NM5A 1VJDA 3KQTA 3L06A 1R9NA 3RAGA 1I4WA 5KSWB 5JAUA 1UPFA 3LHKA 2OCKA 4KLZA 4WDQA 3FCOA 1Y6FA 1O4WA 2ATVA 3EMKA 3PFBA 4LDPA 1TCVA 3FSGA 2GCGA 3FUWA 4TV9A 3DUFA 4XQEA 3BH6A 4EJ0A 5HNKA 1TUBB 3IX0A 1DIRA 3FFAA 3GPCA 4R6WA 4B17A 2VYVA 2G4VA 1ZCAA 1N3YA 3P9YA 2B4KA 1N2ZA 1N6KA 3F6EX 3V9PA 1XTBA 5K05A 4TGLA 4Z4QA 4QSMA 2B3DA 1E94E 2PIDA 3GZJA 3H84A 4RVSA 3QYPA 1NVAA 1CB0A 4B2PA 1TMYA 3O9VA 4V0RA 3PVZA 2BI8A 5KNCD 1XPOA 1KEEB 2K7ZA 1I0LA 3WVNA 4ZTUB 2AJDA 4FMPA 2COEA 5KQSA 2WV9A 2ISSD 4XIYA 4QL3A 3ZHUA 4HN2A 1SQSA 3M4XA 3PJDA 3TTVA 3AY7A 3FGPA 1HURA 1YH3A 5HZMA 3K16A 2AHOA 4GZ6A 1YDWA 1GSAA 3PFIA 5HE8A 4NU0A 3CD61 1DJPA 4D8XA 4EATA 1YJCA 3G8CA 1VCIA 4PYOA 2YFKA 1OIXA 4LECA 4DCSA 4YUXA 6CHYA 2QG6A 3UJNA 5EPOA 4R2HA 3DTYA 1KU0A 4ZDKA 2QSYA 2XODA 4IRMA 4PN7A 1P7ZA 1XEXA 2HDHA 3OSUA 1PWHA 2ETVA 1E2FA 3OZDA 4PX5A 1THMA 3GDGA 2FHSA 3HWRA 3WBFA 1CD5A 1EDBA 3HBMA 3PWKA 1Y7LA 1C0LA 1GCOA 2M1ZA 3I23A 3QEJA 2HEIA 4WECA 4BC0A 4XWOA 4CEIB 1EFRD 2V3CC 3FYTA 4NBHA 3G0GA 2K7FA 4RZ2A 1LBEA 1IM2A 3AHEA 3MJDA 4Y6RA 3WIUA 1IWOA 4LRYA 2JUBA 1NT4A 1PKXA 1M76A 4HDQB 2WIGA 4C30A 3ONDA 3W06A 3B36A 3E1KA 4I19A 4NEGA 1CV2A 2XBLA 4ENPA 2O8EB 3EIOA 3ISTA 3ZVKA 3C4JA 3LUSA 1SU8A 4AMGA 1CQIB 1YUKA 1A9PA 4DMRA 3IO5A 3PFNA 2HFKA 4NOJA 5E1MA 2HL6A 2JFZA 4BQFA 2R7NA 5AVUA 1DAOA 2AOTA 1L3IA 4Y1EA 1V0JA 3BD8A 1C1XA 3KZMA 1ML3A 2IKQA 3PDHA 3A6PC 1MXHA 4NCIA 5F5LA 5ALHA 5FWYA 2GN1A 2HPZA 3LRXA 4A3EI 4Q5IA 1I6KA 1W87A 4FLEA 5AXBA 1SB9A 3IEMA 4X7RA 4E94A 1R3UA 2WD8A 2LNDA 2I03A 1MAWA 1DEAA 3ROZA 5AJXA 4UASA 3OE7A 4JVMA 4UBJA 1KAHA 5AIBA 2AGVA 2D59A 2EZUA 1SZDA 2B6NA 1EB8A 3BMNA 3RE1A 5D1PA 2WHEA 1NUIA 5KYYB 1ES9A 1XVVA 1XVLA 1LWNA 1NMQA 1UC8A 2JFBA 3IT0A 4FDMA 3HCCA 3RK1A 2DQZA 2ZWVA 3KWJA 3R0ZA 4CF3A 2IDJA 5BNIA 2P30A 3KB8A 5CAEB 3BJRA 3EA5A 3MGCA 2JA7I 1P9OA 2P35A 3HU3A 4RHTA 1V3UA 4BLOA 5EWJB 4DPMA 2LIVA 1K83I 5L3VA 3RT7A 3U3DA 4Z3KA 3JVDA 3REOA 4DA6A 1YJAA 1Z3CA 1X19A 1TE2A 1X7YB 3A4IA 2OV6A 1YJ8A 1T9GR 1WBJB 1G3QA 3C87A 3MNFA 1C30A 4LDJA 4OY3A 4XDGA 1J6UA 1QH1B 2HK8A 3ZIUA 1MO2A 4ZEOA 4BO6A 4CM3A 1RPAA 4KN6A 4O4JF 2PBZA 3IIIA 2BSXA 3MJVA 3U4GA 5JHHB 2GO7A 1KZ4A 4NBNA 3KKLA 4X00A 3RKUA 2OMEA 5AK0A 4GZ3A 4Y3UA 1CZOA 1P5JA 1RVV1 4DSZA 3H5OA 5FBWB 2C84A 5JBNA 221PA 4ETNA 3ZH2A 1Z4KA 4ZRDA 2PGOA 3NW9A 5D2CA 3QE9Y 3HVHA 3OZSA 3G8BA 4PNPA 4RENA 4GGPA 3MJTA 1LV7A 1CUJA 1N9GA 2X40A 3BXEA 4U6QA 4R8KA 2QLFA 3ZQ4A 4BMXA 3UMYA 3PB3A 2B2NA 5C3MA 2GPBA 1XDBA 2VWGA 4TQGA 1FMCA 4I5IA 5B57C 4P0PB 3C3DA 2A5FA 2AYXA 3B82A 1JR3D 3OJWA 1Z88A 1YK1A 4EG6A 3G5TA 2J8ZA 4M0KA 2YS7A 1RT9A 2DFLA 3B53X 3HZHA 4M22A 2FMIA 2E2JI 3NWPA 4RLSA 3RO7A 2GK7A 1O94D 4PANA 3PHHA 2HQ1A 2ZSFA 1Q92A 3A31A 4O1IA 1COWA 3M2TA 2NVUB 5FHRA 3GTQI 4C5BA 2PMFA 3K0FA 3TJZA 2DU8A 4EW2A 1DELA 2VPQA 3MTGA 5EJ6A 1ECLA 4QO7A 3CB2A 3NDPA 1TJ4A 4G1EB 5BRNA 4GLFA 4WUTA 4YRFA 1C9YA 1ZMBA 3EDYA 1DO2A 4O29A 2CLDX 1GKLA 1T0BA 5IWAB 3C3XA 1GILA 2VTKA 4IH4A 4KL8S 5B7PA 2GCOA 4E5PA 4EY4A 1BE6A 1G8KA 1I14A 2GPAA 3EGXB 1AKYA 1OLXA 2J30A 3H97A 1FX0A 2VHXA 5FP0A 1QIFA 3EEDA 4JBGA 4KE6A 4WBNA 1QGUA 4BLUA 2BFFB 5E2AA 3O31A 2XGSA 2PXCA 4PPFA 5IJ9A 5CXQA 1G16A 2E5FA 2K2WA 4NI5A 3ROKA 3PFHA 4W5RA 1WX1A 4DM4A 1IH8A 1RM3A 3FWKA 3TZCA 3W6UA 4DA7A 2Q3JA 2ATEA 2X0RA 2WVGA 4DJ5X 4IBOA 3IUBA 1AIPA 2F64A 2GESA 2OO7A 3B7PA 3KB1A 4Y2PA 5TARA 1GPYA 2GGSA 1Q861 1SWWA 1FJHA 1RQPA 3FE2A 3O8QB 4KE7A 3QLUC 4PC6A 4D4KA 4O3MA 3H3FA 5C5DA 4HN4B 2WLTA 3WP0A 3PUHA 1GDDA 2K6GA 4RULA 1V7ZA 1PIWA 1W30A 1E3DA 3B6KA 1I7SB 3RTBA 5A71A 5JC1A 4ZODA 2P2LA 1DJMA 4Y7DA 2IEIA 4HGPA 5FBZA 3DBRA 4A93I 1DAHA 1E6KA 2D0PB 3CH6A 4G63A 4KW7A 3GA5A 2DQSA 1LBIA 3U7EB 3LPDA 2IH4A 1PR2A 2OTL1 4IXTA 1RWOA 2W6JA 4N40A 1P39A 2HFJA 3DQQA 1CFZA 2NO7A 3OETA 4OQYA 3KUCA 1NR7A 2R00A 3G9ZA 3BK1A 4KPGA 2OP0A 5JS2A 2XDAA 3EGEA 4P7BA 3DE5X 1VI6A 4FUQA 4WEOA 3U3XA 1MAHA 2J3EA 4AJ1A 3PI6A 2NYRA 4AY2A 4OFXA 1X1EA 4DRYA 5B55A 1CY4A 2A1TS 5DHTA 5T5QA 4ISBA 3AEUA 1ZMRA 2QE7D 3R3JA 3D1JA 2IVFA 3HKEA 4C2BA 4I5EA 3AUSA 2H63A 4UZSA 1UXKA 4C0LA 3Q5GA 2VHVA 2V03A 4JHXA 4MUHA 4D80A 2AMJA 1DCTA 4Q3OA 2COKA 2RJNA 4NENB 1P2BA 4NJEB 3BFVA 3H3XA 2QN2A 3B5EA 2CXSA 2O2YA 1DFGA 3SBXA 3FX2A 5KNLA 2LE0A 2PGNA 1AMOA 1EIZA 5K6TA 1Q0TA 3UPDA 1GEEA 3Q1LA 5ALNA 3AZPA 3RC1A 4P3OA 1T8SA 4TRNA 1MOSA 4RQUA 2GZRA 1FU7A 4K1XA 4ZO9A 3WS7A 5KU7A 1BEZA 4G8CA 4YDQA 3IOMA 4DDWA 4HDKA 1G3UA 3W5HA 2BJVA 1QR2A 4O3FA 3JWHA 9LDBA 3CE6A 2F9LA 1OLUB 3N7TA 4OYLA 4QIHA 3T1YB 3R1IA 1GHTA 3SXJA 1VSQA 1KQFA 4I9HA 5CLLA 2EWWA 5L7WA 1KHHA 4I4LA 5E1OA 3VZRA 3FTFA 4AMBA 2XNCA 2IXTA 3KDAA 2BGTA 1WRBA 2PUDA 1PK9A 1ZCFA 3NORA 1F2UA 3J80b 4HQOA 4YRRA 2NPIA 1XCGB 2OHJA 3ZD6A 1J7KA 3A28A 1EH5A 1KFBB 5G0SA 3ZE2B 3NATA 2NSDA 3Q6NA 3ACBA 3C85A 3RODA 2XSZA 4JP2A 1C8LA 3OC0A 1ANKA 2XCLA 4OXRA 1U0FA 3HEBA 3VH2A 4D5EA 5EEGA 5LA6B 5HJEA 2MYTA 2Q5OA 4M7OA 5JDCC 3ZY4A 1Y7IA 2IXBA 5DX0A 3U81A 5LU8A 4QTUB 4KRXA 2WLSA 3B7WA 3OJFA 3SYTA 5BSVA 3ZD9A 2Y1FA 3GT7A 1ZH0A 5DNAA 4YRMA 2EX1A 2JKZA 4L4ZA 3BTVA 1VCNA 4U9HS 2IH5A 1AHPA 4YT4A 1NONA 3KQLA 2IHTA 1ZICA 2C2WA 4B3CA 5CJPA 4MA0A 2V8KA 3GARA 4XD2A 5C3UA 3QXGA 2ZZMA 4IIFA 5IF3A 4UMVA 2XXAA 4R2JA 1RS0A 5DHQA 1IG0A 1FFXB 1GZ5A 1UAYA 2MINB 4W5NA 3PYMA 2O06A 3P27A 3HVKA 1VB5A 3T3GA 3VJRA 3MBKA 4BFYA 4JJ8A 5JI3E 4KBFA 5SY6A 3QPDA 2RD2A 2ZSBA 1CIVA 2OV3A 1Z82A 4D5GA 1KMHB 5KPDA 2J46A 4NU5A 4LQLA 1YMQA 1M7HA 3ZXYA 1FFBA 4DMCA 1TPYA 4BFLA 1G5IA 2XYPA 1BJTA 1VXRA 3I8SA 3TW8A 3V1UA 5HHTA 4LDZA 2VSOA 5CT8A 3N28A 4JJ4A 1YUAA 3PBKA 5TMDA 1SXJC 4XRRA 3SSNA 3USES 4COOA 5JNRA 1I1OA 2Z43A 4EQ6A 3H87A 4M1WA 3TL2A 1D1QA 1Z62A 2Q3DA 5JTTA 3GA7A 4F5EA 4UBKA 5DHPA 2DERA 1V16B 5FA5A 2CV1A 1AXEA 2EG5A 2I7DA 2Z4TA 3F2VA 1MLDA 2JMOA 4R01A 2AX4A 5AUOB 2A5YB 2C54A 2O4HA 1YK0A 1JHRA 3OIDA 2ZJ6A 4GE3A 3CX3A 5CA0F 5K0EA 1YCFA 3LC7O 5H68A 3CC7Z 3SU8A 1OXTA 1NYQA 1V7PC 1AKQA 1ZPDA 4N01A 4Y1RB 2C7RA 2IXGA 1FSFA 2X42A 3KO8A 1WMBA 5JWOA 4OQMA 2IHBA 4AS2A 4IHJF 4Y2TA 5KX5B 1OI7A 3ZNQA 1MB3A 2K4MA 1LPMA 1G18A 2LUOA 1CPYA 3WSWA 2PXXA 2WD7A 2H5IA 4HQ6A 3INGA 1BRMA 1PQWA 3O2SB 4LCBA 4RZ3A 3VU9A 5LJIA 1N1GA 1PD0A 3FSEA 2OHGA 5HF8A 2Y1KA 2XD9A 2YW2A 1VQPZ 3DE3X 3CBQA 3G89A 1YJXA 4L3OA 1T3TA 4EEZA 1G5TA 1R8XA 4O2BF 1S2LA 1QU2A 1E0SA 4BVEA 2VJMB 1CDZA 3NBQA 4IIJA 3N87A 2GEDA 3N2IA 4CU5A 1NHGA 4NJMA 3C8HA 3FZYA 4JGGA 2CY0A 4MEAA 1IC6A 2NUAB 2H2HA 3PFFA 1KZ1A 4FONA 4J75A 2IOQA 3T41A 4C6RA 4DSUA 2F8MA 1OFGA 2VDRB 2YXNA 1E59A 4PO8A 3MLAA 4WLEA 1X92A 4KR7A 3OCWA 2I65A 1H6CA 3MA0A 1VQN1 4TTTS 5CPFA 1EFVB 2GN9A 3GTGI 5GV8A 2IYVA 3V4ZA 4H35A 4OD0A 1IU9A 3K9HA 3PQ3A 1P6QA 4WK0B 2JGDB 4MXDA 3A1SA 1DQSA 4X7MA 1M73E 3WQHA 1J39A 1TM1E 4X54A 5B3KA 5HZHA 3GV0A 3CVWA 2CXHA 1FUKA 1RM0A 5E0OA 3C8ZA 3QLUA 1NVDA 5GAJA 3RRXA 3GZTB 3W04A 2YJ3A 3Q7IA 3J81k 3KDPA 1PR4A 4JJAA 3GPLA 2ZT6A 1UEXC 3DVSX 4M9SA 5EEHA 4QXQA 4UE6A 1SOAA 2Z9DA 4H17A 4YP7A 4I4NA 3I6ZA 3IVXA 1DS6A 4R1SA 3EZ6A 3KR1A 2ZGVA 3OTWA 1U0LA 2RE8A 1YQ9A 3FFWA 2ZRGA 3H13A 3TTYA 4BRWA 3L4EA 4KIFA 2ZRAA 2QL7A 4LZJA 4B43A 4GX5A 2E4AA 2XB2A 2V4UA 2WTNA 4DV1B 1G63A 5CJ2A 5IM5A 2VSFA 3OF2A 1G9SA 2WJ4A 1LUAA 4ARUA 1Z16A 4FI3C 5JH7B 2ZYVX 3TW6A 2RG7A 1FF9A 3LJKA 2B6HA 1SCQA 3U44B 1T5SA 4UVEA 2IS1A 1RADA 1MOPA 4BRUA 1THZA 2VYCA 4MS1A 5D3QA 2G2KA 1V8BA 4S05A 1BJRE 1EUDA 4I2VA 4F12A 5A1JA 1UJCA 3K6JA 4QGAA 1IATA 4L15A 4U9UA 5JFOA 2JLZA 2OZLA 3AR8A 4FHDA 2MCFA 4P81A 1IB6A 4BX8A 5TB5A 1G7SA 1FSGA 5KVQA 2NN3C 1WTAA 2QR3A 3PE4A 2OCLA 5F7OA 4CQNA 4TZ0A 4HQFA 3GX1A 1DJNA 1NJSA 2V8OA 4PYLA 3MTIA 3Q0IA 1H05A 4LDRA 3DUWA 3EMDA 1G2IA 1A82A 2F55A 1OI2A 2AD5A 1CUEA 2GOYA 4OCZA 3ULKA 1W44A 4CMIA 1JF8A 4NB9A 3K8QA 1WCMI 2I78A 3EDQA 3OCZA 1HDCA 2FEPA 3U7HB 1NVVQ 2R8BA 2J9FB 3CVXA 4BQOA 3CJTA 1RABA 4B6SA 1KR5A 3GGGA 4MAAA 4NAVA 4LBVA 2RJOA 5CXSA 5DPMA 2W70A 2VS1A 1AXGA 1E2NA 2QAGB 4GXQA 4N1AA 4XZ3A 5EN4A 4I50A 5ESWA 1OTHA 1DGQA 3CLTC 5EL0A 4NTZA 5IM4F 2QUKA 3VNSA 3W5SA 4F3CA 2E4UA 4DC0A 2E0IA 5DTQA 5LQMA 4DJEC 3KLMX 5AH0A 3KQWA 1E5XA 3WA6A 1GZ4A 3NIDB 3WGKA 4MUIA 2ANBA 1QONA 4BBRI 2C7VA 4LVUA 4C6TA 3GLQA 1BRTA 3BWMA 3OOJA 3T7EA 3HYNA 3WLNA 4E5DA 3PXEA 4WOCA 2J5RA 5A6SA 5JHGB 3S1RI 2C9DA 2X4LA 2CDRA 4RFSB 4GOJA 4BOYA 4HTAA 4RTPA 4DG9A 1OZHA 4G0ZA 3KV1A 1YJ9Z 1WJGA 3AEQA 3LLSA 1AY0A 4GIBA 4M8LA 4RSMA 1HLGA 5JDCA 1VOTA 4KTTE 2HCJB 5D3MA 2DAPA 2X77A 3E35A 3NALA 4DXDA 1NVEA 5CH8A 1SUIA 3EG5A 1GNLA 2PWAA 5BWMA 4NV3A 4N8DA 4P5DA 5ELLA 4BGDA 1E8DA 2CUKA 3AP3A 2O3JA 3UJPA 3H5NA 1KFJB 1T5LA 2BCEA 2YBDA 4O2AA 3K8ZA 3RS2A 1A77A 5E2BA 1P7VA 3B5JA 4TV9F 3C7AA 3QRWA 1I3NA 2FE4A 2ZAEB 5KJCA 1AGPA 2ARKA 3GVPA 3PO3S 4P3XA 4Q82A 4PAGA 5DTRA 2V59A 3VO1A 1FP4A 2EWVA 1E4YA 2OV8A 2OCYC 3C5EA 4IQFA 6AT1A 2C4MA 5SYMA 2W6ZA 1V47A 4OJNA 3HN2A 2FLKA 4M8KA 3RTAA 2JH3A 4Q9KA 1WSBA 3NGLA 5C1OA 1ZSYA 4FNAA 2GU2A 1CUGA 4WKGA 1SKMA 3PIIA 1SXJA 4QAQA 1YFLA 5CB4A 3LA6A 3ILHA 1F5SA 2D1RA 4A8JC 3A32A 3DLIA 4ZRNA 1N5LA 3U3JA 4P83A 1RXEA 3VR4H 3F3MA 1ZO8A 5GZ6A 1Y8RB 5HM8A 2DVMA 2VBFA 1FVFA 2X6RA 3QH4A 1CRLA 2V7QD 3FHCB 4GYWA 1S01A 1MHPA 4OU4A 1M10A 4TMZA 3TEJA 1DAMA 3OZBA 2A1UA 1ZR4A 2R6CA 4WLUA 1H93A 3E2MA 1UODA 1FDWA 1R10A 3UBTA 3T52A 4CM5A 3DLBA 1JQAA 2P6UA 3PF9A 3T61A 4M0LA 1EXDA 1IEXA 1MD9A 1QP8A 3AESA 4FBMA 3SDZA 1X0VA 3BCHA 3OKFA 2VL7A 1BCRA 3H9JA 3M1LA 3T94A 4TKVA 3WMRA 4L7QA 4KO3S 3LKBA 5I7SA 4JP8A 3HB0A 1P61B 1O96A 1S2GA 3A70A 4BYMA 3IXMA 4PSCA 4RMIA 1EFAA 4GECA 2ZI5A 1VBFA 1ZR2A 3DCYA 1WV1A 1Q6YA 1M67A 3A2LA 5A1TA 1UANA 2XKBA 3R74A 2WKPA 1E3IA 2P4EA 1JMVA 4CLOB 2H11A 1RAIA 4RDXA 3ETEA 4JI8B 2X8AA 2ZJ8A 3AVOA 3VZDA 1I6LA 1PDOA 3GJSA 3V80A 1E3MA 3L7BA 1DXQA 5PNTA 5C52B 4QFCA 4WI1A 1EUYA 4DFDA 3ANNA 1NV8A 3MJFA 2Y1EA 1OLSB 1DXHA 4QLAA 5IAEA 4NYMQ 2WJJA 3SHWA 2GPJA 3SEFA 1DXYA 2Q0QA 2NVWA 3ZDDA 3GJ3A 4J9VA 5KYNA 2WMNB 2E6KA 2FEOA 2BGIA 3CPSA 2ORVA 3T1HB 4ER5A 4DQLA 2VYFA 3NDRA 4EKGA 2ZR0A 5KBYA 1WQ3A 4AT1A 1D07A 1KH3A 5KNBD 1LJUA 4F3YA 1GLVA 4OAOA 4GSYA 3HOZI 2ZI6A 4MUMA 3THRA 3V4LA 1B3RA 1E0JA 4M0UA 4L4YA 3UTDA 2F8TA 3ZTTA 3M6LA 3HVJA 3IAFA 2AL7A 3F46A 2UVPB 1F60A 1OWLA 4IEIA 1BDHA 3R8CA 1KYXA 4ITVA 2I76A 5G2OA 3U39A 4OI4A 3HWSA 5JSZB 2YMPA 2P2CA 1UPAA 1OPRA 1MNQA 3MT8A 3PGVA 1JA1A 4JJFA 1PGJA 1M75A 3K9WA 3M5CA 3Q9LA 1W4LA 1EBUA 3F6SA 4ASUA 1YCGA 4HOYA 5ALXA 3S1SA 1OA1A 1QIEA 2QS9A 1Y9AA 1YR9A 3B51X 1OILA 4ZQEA 5BR8B 1WUYA 2HJRA 2PA3A 4DIMA 3G8DA 3ILSA 3GDOA 2QL5A 4K9RA 5AKIA 2ZFUA 5DHUA 4MUKA 2VTBB 1T8TA 4KFSA 2H9YA 1IY1A 2GPWA 3QVMA 4ZEXA 4KXVA 3AW9A 3ZNNA 4NCHA 2GAAA 1YZNA 2X86A 1WIIA 1G64A 1LLQA 3B6EA 1VECA 2ERXA 3I37X 2O53A 3I12A 3M4JA 4ND8A 3DKIA 3EQ2A 3NPMA 2A1IA 3S81A 3FWNA 2UXCB 4B6EA 3EAGA 4ARCA 3MRSA 4BLRA 1Q21A 2EC5A 1SRQA 2HHLA 1UDRA 1I4OA 4M9RA 2IP1A 3IE2A 1JSRA 4N39A 4MRAA 5FR2A 2D5AA 2BFEA 1Z02A 3UT0A 4OA5A 8ATCA 1J2JA 2VNJA 1U0GA 4BP1A 1YJW1 1F4LA 1O6ZA 2YICA 3BEDA 4P3YA 3PQ8A 4NDZA 5G02A 1X7WA 3VNQA 4KP7A 4R0MA 1QG0A 3WWPA 5EJ8A 4WLNA 5H59A 5J2UA 1UKYA 2FVXA 4EELA 5K2OA 4DG8A 3WKBA 5ERYA 3DV0A 1NF3A 4QRHA 1IY0A 3PR3A 4RVFA 2FCAA 2D74A 3L92A 4WNIA 3IC5A 3RSFA 4PAMA 3GFTA 4K9KA 4RVHA 1XZNA 4O4IF 5BSEA 4YLEA 2ZBQA 3A9VA 3L4SO 1VGRA 4YJ3F 4QEKA 2NUTA 1RMQA 4V03A 3UQYS 5LWQA 3FSGD 4RA6A 3V9AA 4Z7OB 2SNIE 3F49S 3FZGA 4MOWA 2QLTA 4Q24A 1Z4NA 4CTMA 4W5QA 1FYDA 2VF2A 1M6HA 1ISPA 2VSQA 4WERA 4LOHA 1D3AA 3HM2A 1OHHA 2FKNA 3VBEA 3VAYA 3WKCA 2IU3A 1N7IA 4W6ZA 5KYXB 5CU7A 1X7ZA 5AW9A 4RH0A 4EX6A 1FVXA 1V1RA 1M34E 2H2DA 2J87A 2OC4A 3GFBA 2PZBA 3A1UA 4IRUB 4RD6A 2GZAA 2OO5A 3MUFA 4HGRA 3LY7A 3JQCA 2A78A 1KSGA 3ZHCA 3EIEA 4TS4A 4AJEA 3OQJA 1W2WB 1K97A 1RQXA 1B2LA 1K2VN 4KIGA 2EL9A 1TZKA 2FUCA 4Q9AA 5H16A 2ON6A 3L7OA 4Q1EA 3STXA 1J2YA 4ZCRA 4MVJM 2FQQA 3RVPA 4M36A 4RKYA 5CA1B 2J5KA 3LQ4A 3TS1A 4DLSA 1YJQA 4BO8A 4YWHA 3H6KA 1XXHE 5JO9A 2C94A 2XUFA 5LKAA 4DCOA 1L7PA 2FQXA 4NBFA 4JGIA 4P3PA 3SQLA 3CCE1 3NHMA 1QQ5A 3WSVA 5HQ3B 3EF3A 3LPNA 2GZMA 2W6QA 4FE3A 2H51A 4R71A 5FLXf 1N3IA 3M82A 3ZDEA 1R5OA 4UZFA 3FHOA 4HZGA 1SUWA 4EUKA 3GGCA 4JLKA 3ICQB 4M76B 3EDRA 2VRNA 1GEGA 1O6CA 2ROQA 4ZJYA 2HADA 4QFMA 3EC7A 1PS0A 4ALJA 2C2ZA 3QLTA 1P7CA 1P80A 2CYCA 5AUQA 2CD7A 4E3WA 3RYFB 3AV3A 2VH5R 1H3NA 4IM7A 1AUVA 2BDUA 2P2SA 1ZITA 1IQ0A 4A3LI 1BEEA 4M87A 3HCBA 4D74A 2QN9A 4UFPA 3RJ9A 4YIHA 1ZM9A 5DCYA 3GLIB 4QM6A 1VI2A 2GLUA 4G07A 4ALKA 5A5VA 1Z5OA 1N5MA 2CKDA 2CVQA 2Q4BA 4MRPA 4EJ2A 3Q7PA 3DEKA 4RPIA 2ZRHA 3IMCA 4I4CA 4NBWA 1PEDA 4OQLA 1U2GC 2R96A 2UU9B 3QFTA 1WU7A 5AJVB 4EHBA 1Z0SA 1CC1S 1PR0A 2FJPA 2Q0XA 2BZ0A 1NQOA 2O2IA 3HYSA 3K2QA 1WNTA 1K8QA 3U4IA 1YMVA 4N0MA 3TOZA 3QBVA 1XCMA 2IHVA 3E2IA 4QE3A 3TDMA 1NOIA 3QNMA 4BLTA 1NIPA 5JRDS 1GTG1 3QELB 3PTLA 1B15A 1DL6A 3RSZA 3SYKA 4V0MA 2AFIB 4XCQA 3SQMA 1IIBA 1I3MA 2H4HA 1CETA 1ESNA 2DWPA 3GJRA 2Y05A 3A6GA 2XQGA 4PZZA 4QYMA 3A3KA 1WU8A 1ZJ5A 5T3YA 5ADWA 4JLOA 3R0QA 5HZGA 2MHCA 4H08A 4LHXA 4OP3A 5DNEA 5AW8A 4HWOA 2JF0A 1LDNA 4D9HA 2R25B 4IIDA 1G38A 4V2UA 1Z5ZA 3KVRA 3HU1A 1QIGA 1NF2A 3QJ5A 1PBNA 4MUGA 3LKZA 4BP8A 1ZU5A 4BQEA 3RFFA 1XTZA 2GCNA 1RWBA 3BCUA 3DXXA 2JFUA 4GR9A 4EY8A 5KSZA 5AICA 1YVUA 2GARA 2VP2A 1Q19A 4FIDA 4BS9A 4NEQA 1EJBA 1KPIA 3IV7A 4BO7A 1UBOS 2NTEA 4YXWA 3BIFA 3JAMb 4KIJA 1W2HA 1QO0D 3LDGA 4C3VA 3EEOA 2WIDA 1RHMA 3IH5A 3I5XA 1OX5A 2I3BA 3JYHA 3W5DA 4YP0A 1Y7HA 2FI1A 4I1UA 1QTQA 2A0FA 2IIQA 3CZ5A 4FDAA 3QU9A 4KX3A 1TYBE 3FPHA 1YVRA 4P93A 2LZ0A 4A3FI 4DIUA 4DE5A 2PA0A 3JAKA 4C4TA 5AM2A 5IK2A 5JAIA 3CB4A 4P4LA 2ZTVA 4HEA6 4AJOA 3I4NI 1FU8A 5CBPA 3CX6A 4KUEA 4FX2A 1NGSA 3RVLA 4E2FA 4P7JA 2YCLA 3EQZA 4CUZA 1ACMA 1LPSA 2ZJ5A 4UC0A 1KSHA 2DZDA 5B1DA 5HCUA 1NI4A 3FI9A 4TLBA 1M0TA 3CCQ1 3L7NA 2C2KA 3PHJA 1QPZA 2DYKA 4H2DA 1JYFA 2V7UA 3OJCA 2YC4C 4NB8A 1JKMA 4XJVA 3ZW8A 2PD3A 5BPHA 4US0R 4BCCA 3A1VA 4N5NA 2NU6A 1EIWA 2O59A 3AB3A 2AB0A 3I3SR 2C98A 4OGKA 3BCSA 2I3CA 3C6YA 1KDZA 1M8PA 1XU9A 1ZSNA 2ZUSA 3AEYA 3DS8A 4OQZA 5DI9A 3VGJA 3TF5A 3O4IA 2F43B 3TXAA 1NI3A 4RD3A 4C0SA 4UARA 3TEFA 1LEHA 4G4IA 4YRDA 3QTBA 1Z5VA 3CEMA 1X15A 4UTZA 4EG3A 4HNUA 3M6IA 3RFXA 4AS1A 4KRYA 1J0EA 1ZXBA 3J81A 2QZ4A 4Z51A 1WO8A 1DC6A 1MW9X 1VDMA 1PJSA 2HU5A 1FP1D 1QB7A 4PQGA 1GGEA 5ENZA 3W9YA 4C7JA 2J6HA 4NPAA 4P4UA 2QLBA 4CIWA 4LGMA 3H2ZA 3TJMA 4CV1A 1QIHA 3Q3GE 4MQEB 3WYFA 2G6BA 2X5KO 5UKDA 1F1BA 1BEUB 2PUWA 3U80A 3UJHA 1JE1A 1ECCA 1B3BA 1JHYA 3NS7A 1RNIA 1HZJA 4HQLA 4U8GA 5IEBA 2BSAA 3FGOA 1YIAA 3ZWBA 1UKAA 1BFKA 1I10A 4I36A 1C0KA 3PHBE 4REQB 3FAZA 5EOVA 4E5MA 2I4IA 3THXB 1FSSA 1ZN7A 5JD5A 3GTOI 1WCV1 2JKVA 3P2JA 3TVDA 1XTQA 1YONA 4BVFA 3LCRA 1Q3TA 4EL0A 2C58A 3UMRA 2NV0A 5JSKA 2ZCJA 3HUDA 1CY8A 2Y0SA 1CE8A 4ZAVA 2LW7A 5JAZA 2YRXA 4BNXA 1V5IA 4OREX 1NUAA 1JX6A 1DCKA 2JI8A 3F0TA 3TQTA 4DRZA 1QHIA 3O8CA 1P2DA 5A5GA 5IVPA 3WKDA 1KR2A 3NTVA 3RWBA 5BN4B 1PV1A 3C3KA 3VO9A 3Q88A 1L1FA 2GD1O 1PHRA 1RI1A 3L40A 1H0KA 3T3PB 1IZ8A 3ZCQA 3DYIA 1J21A 1T36A 2SCUB 4OGFA 3WICA 1S3GA 7ADHA 4PWYA 1UOOA 2DQKA 3QX9A 4LYEA 1DHRA 1G20B 5HTKA 1UBUS 3UTCA 4FD3A 3NJ8A 2CKMA 1BWQA 2AKYA 3X1JA 1VE7A 1CBUA 3OU6A 2Y0EA 1QAQA 5C4JI 4DQ0A 4EPXA 4D97A 4TLAA 1P0CA 2G07A 1ZC3A 4KQFA 5LXTF 3RJTA 1W52X 4XIJA 4INOA 1MZVA 3N2NA 4LDAA 3KTAA 1G0NA 2BOVA 3EHDA 3S1QI 3KAKA 4IGFA 2IC5A 4KAJA 1U8EA 3U4CA 3RUFA 4TROA 2PUGA 4Q3CA 2AYDA 1XRQA 3LY5A 3WHPA 3GLHE 2PJUA 3SVTA 1N6LA 3GTMS 4TRRA 2GBGA 2PNFA 4A8PA 1NSYA 2EEZA 3HUEA 4G5HA 2PRSA 3DAPA 1IEVA 2ZRKA 3DE6X 3NV7A 4C7MA 2OC9A 1KXZA 3OE4A 4XEHA 5I9SA 3ASUA 5EWLB 2P8JA 4US2R 2CT8A 2QE6A 4II2A 1CS4C 1U8FO 3IYLW 3LXRA 3ACCA 4Q48A 3FKII 2WWGA 4MVJI 1XAJA 3V8BA 3PSHA 3DNFA 4US1R 3TLZA 1DKQA 1LTKA 4HDMB 1KE2A 1N2CB 5HOQA 1HO3A 2CJPA 5LP6C 4ENVA 5A62A 1KQGA 1RO4A 1Z6XA 4LF7B 3AFNA 1Z15A 1F48A 3GF4A 3PKJA 4MMYB 2X9GA 1QYVA 2FE1A 1M901 4BBAA 1PQ4A 4B80A 1AKMA 3NHKA 3WIEA 4QULA 4OATA 4YREA 1JAIA 1NUHA 3ZVRA 5JU6A 2WA2A 1CUZA 1I3KA 1OE0A 1L5YA 1U2GA 3WB1A 1CUXA 2HF9A 4TSKA 3OQNA 2BW0A 2HW8A 4KQIA 1VPVA 2FSVC 4MI1A 1DC3A 1SKYB 2AQ8A 3CKYA 1FNBA 5EHQA 4EYEA 4H4DA 2Q1TA 4XM1A 5L6LB 2CLOB 2BEJA 1F2DA 2XSZD 4XWYA 4P4NA 1CUYA 5E9QA 3U3KA 3H5VA 1RU3A 3KAJA 4FNGA 4WPGA 4D0LB 4D3YA 5IF9A 4HH4A 1X3WA 1G17A 1GN9A 3LC2O 1C3LA 3GA0A 5AP9A 1G6Q1 5JECA 1GOTA 1FFAA 1Z7BA 1I7QB 4I9GA 1RQGA 1P44A 5CRIA 3VDQA 1MDFA 2HHHB 1ADFA 2ABWA 3GVCA 1ZK0A 3JZDA 4W5HA 4X1KA 2VHWA 5B36A 1ODTC 3DMFA 1GNSA 4ZGGA 1X1CA 2GJKA 3QW4B 2QZZA 1Q822 5HKOA 2RHGB 2PGAA 2BMJA 4WOKA 4B6JA 1JFVA 1RVDA 2VAMA 4W8HA 4YFVA 1WDWB 3DOOA 2Y0CA 4NP6A 3R7WB 4RE6A 1CZKA 1QANA 2ZSAA 1F0KA 4GYYA 1WHSB 5NULA 2X7JA 1RBYA 2EBUA 1ODFA 1S9DA 4XVRA 4Z6KA 1VQLZ 3IP3A 2OEPA 3JXEA 4W9NC 3E3NA 3E8XA 4BO4A 1PWEA 1Z45A 3DOIA 2F90A 3GNSA 2WK1A 1AGRA 1AKWA 3QI7A 4X20B 2VA9A 3STWA 2J3KA 5F9HA 1ITZA 3OLCX 1AX9A 3LGAA 3PTZA 2QY6A 2X14A 3HE3A 1JJ2Z 3J7TA 2QXYA 4LY6A 3MQFA 3RSSA 5A2QA 5ECYA 4Z0PA 3KQSA 1TEZA 4B3FX 3PHCA 1QYRA 3ZN2A 4CI9A 5ALFA 4DCCA 4P8RA 1E8NA 1E62A 3VKGA 3QE0A 4WRRA 4FGZA 1RKXA 4KAAA 3HCOA 4HAOA 4EG4A 3EFBA 2WT8A 4GQAA 1NWCA 3ESXA 1JSCA 2B7BA 1Z4OA 4XCVA 3TCKA 2O0LA 3EVZA 4N9QA 3D1VA 4IS3A 4DW8A 3HB5X 2R1ZA 5IJXA 5F76A 1XF1A 5AI6A 1BHSA 3G7SA 5FORA 3N2YA 2K5RA 2AFVA 1C1DB 4Q9JA 4AP6A 4OEHA 3DFZA 5G4LA 1U5CA 3JQBC 2YH2A 4HS4A 2H7YA 1Q95A 1MW8X 1EDEA 2WWFA 2X0JA 1PRYA 4AYBA 4OP1A 3IAXA 4X64B 1JNYA 4KDEA 4A5SA 3T8YA 3EVAA 1N9ZA 2YDXA 5GVRA 1PGPA 5P21A 1YAHA 5JCOC 3M7IA 5DF1A 3V8QA 3H2JA 1WXWA 3WL6A 1Y5RA 3GJQA 3D7MA 4DNXA 3N0XA 2BC9A 1JPNA 3ITNA 4F1JA 1PJQA 1ZC4A 1TTHA 2IZ0A 1M2VA 4XLTA 3WYNA 2C4WA 3HEMA 3E3OA 3KCNA 3KIPA 3TLGA 4JJGA 4JX8A 4U00A 5J4HA 3U7FB 5DCUA 2ZBRA 3BQ9A 3MTDA 1PYOA 1JALA 1BXRB 3DW1X 3OT5A 1C5KA 4JKIA 4UUNA 3WGLA 3PC2A 1BNCA 1ZS9A 2QRPA 3JWIA 4LE1A 4NBLA 4QQFA 4BQRA 4EFLA 4EF4A 4Z4HA 3QI2A 2HU9A 3OWHA 1W5AA 1YB6A 1TLLA 1QXSA 4FR0A 5JE8A 2TS1A 4B4DA 3MMPA 1JT9A 2FW6A 2RAPA 1I3QI 3R6WA 5A3VA 4Y2QA 1SUDA 3S1MI 3ANSA 2AK3A 2IFTA 3F8WA 4L4RA 2JLXA 1TC2A 1IJEA 4LA4A 2ADFA 3GGOA 5I7RA 2J7PD 2P2GA 3K9QO 2XUDA 4LMPA 5LBTA 1QCZA 4CMEC 4KFCA 1ONOA 3MYYA 3VKHA 3IT3A 4KXWA 4K0KB 4HUJA 1UXJA 1JDBC 2PTGA 4G1MB 2WFLA 4FR2A 2IV7A 1N0VC 2AF4C 3CME1 5TT1A 1W4CA 1I6MA 1ZW6A 2BCGY 1EJ6A 3BTUA 1JAHA 3BE5A 1IN8A 3KXDA 1DRUA 2HF7A 3R0IA 4PINA 4U6NA 2GNOA 1TMGE 3PZRA 2ZSKA 1E5VA 2A33A 4R83A 3OFNA 2CXTA 1SKUA 5FOVA 1LCIA 1Z6GA 2WWIA 3EGDA 3HH8A 1CY1A 3G85A 5JAMA 4UTOA 1IBLB 4RTNA 1D1SA 3DDUA 4KVZA 4PYRA 3VZPA 2DFTA 4P2GA 3T38A 4OHZA 4MW5A 4ACAA 4YPVA 1X7XA 1Z38A 3R7SA 4FKMA 3ROMA 2ZYGA 1X3LA 4AZ3A 1QLJA 3KEMA 1H69A 2FQWA 2P11A 5BSMA 4GPTA 4CLRB 2B61A 3K31A 1XROA 4RAOA 3WRWA 2ZB2A 1EU1A 1XAIA 3A2NA 4KGVA 5DXAA 1FX1A 3N2LA 5B3AA 4LXYA 1VG9B 3G9QA 2I2FA 2X0NA 2GILA 3VHRA 5C7LO 1U7PA 2AKLA 3C5HA 4V1CA 3NT4A 4LX8A 2VNAA 4L6AA 3K0AB 3LQFA 4MYDA 5AKZA 3ZU5A 3NG1A 1HE2A 3KQMA 1G41A 3DHVA 4HAUA 4PCAA 3T3HA 3G5MA 2XVMA 1RM4A 3GG9A 3ZD7A 4P9NA 1IQPA 2FWRA 3OAAD 5HQJA 4F2WA 3DMYA 4JDUA 4FJ1A 2C97A 3T9BA 2XOKA 1REQA 5GIPE 2HV8A 1NUPA 5B5SA 5FT9A 4MWTA 1P9LA 3MWLA 2P6RA 3SYLA 4Q1CA 1NMZA 4AKTA 3FJ1A 1BMDA 2Y9PB 3FYCA 3I92A 3JQ8A 2CXRA 3JQFC 4RJ2A 4AXBA 5LP6A 2FR1A 3I28A 3KOMA 1V37A 2VAVA 1WAMA 1QVGY 1Z17A 3EVBA 1NW4A 1EA5A 1RYBA 3MBIA 4FI3F 3PK0A 5BQOA 5IKEA 3VZCA 4MV4A 3K1AA 1YI1A 1X8XA 4RELA 3PVCA 5ITZB 4FYHA 1KP2A 4D9KA 2QA5A 4RA9A 1UKBA 3I01A 5BO5A 1UT6A 1D6MA 3L01A 1JWBB 1KETA 4HYTA 2FMFA 2H54A 1NHWA 5IAKA 1UMDB 2FSVA 3CGWA 5JYDA 4ABTA 2BT4A 5DJ5A 1AC5A 2I2XB 4XWGA 1L5MA 5A4DA 2BKUA 5J40A 3I55Z 3CC2Z 2MSEB 2WPDA 3LHFA 2A4KA 4OQ4A 1WQ1R 2ECQA 2PUTA 4HDSA 3UJBA 1B93A 1KIMA 4OOFA 3EIQA 4AQDA 1OH5A 1XCBA 3KR9A 5D3ZA 3OZCA 3P9RA 3ZU4A 1WF3A 2X7XA 1W76A 3FMGA 3E0XA 2ZT7A 4DSNA 3VSBA 1CQJB 1Y81A 1TF5A 2QRZA 5D84A 1RIIA 4J1TC 4B73A 1LD3A 3AGPA 2Q3EA 4UZEA 1RE0A 3DAGA 2I34A 4AKIA 4NYJR 2E2WA 1T9AA 2F3RA 4BVKA 2WIJA 2W37A 4DT1B 3ORSA 5BOSA 2RFLA 3PWSA 3ZZ0A 1UBTS 1AH2A 4Y2YA 3H1BA 2JNYA 1TIKA 2YZGA 1KC3A 2X0DA 5BR1A 2VZ0A 3DMRA 1EK1A 3ZHOA 4C14A 4G0OA 5K8JB 4JB3A 3CJQA 4KZKA 4W9NA 5FL7A 1YZ3A 2N3ZA 4URVR 1NU8A 2HH9A 1Q0UA 2Z08A 3MMNA 3QBEA 5WRFA 3VUFA 1EBBA 1TQ6A 1F6DA 1JHUA 3EIXA 2YV2A 2CN1A 2HHCA 4MYCA 1W1IA 2OT3B 1I33A 2ODWA 1C7FA 2QXTA 2XUQA 2ZI3A 5BOVA 2PVSA 3WIDA 4B47A 1OW3B 4DSAA 5A4KA 1YDEA 2Z3VA 3K0CC 5SYAA 3TXXA 3WNDA 6PFKA 5ETJA 1N2HA 1JEJA 3ND5A 4JLUA 3RSCA 3OLVA 3TD9A 1YQGA 3UAXA 4MQMA 1WXXA 1US8B 1SXJD 1ZZEA 3EERA 5DEIA 2NYAA 4TQ9A 4C7XA 4UHBA 1EGHA 4KXLA 4J6EA 5FEMA 4P7GA 2J6CA 4BRZA 3ETJA 4DZTA 1QAMA 4MGKR 2JFFA 2WUWE 4X8LA 2O3UA 3OCVA 2GM9A 3RU2A 4BMDA 2WD9A 4BTEA 1O0CA 4IHJB 1N7HA 2CHEA 1W0CA 1FPMA 1WDMA 4RD0A 1YIOA 2AZDA 2R1TB 1CQWA 3GZNB 3HYTA 3ND7A 2IWHA 3ZE0B 4AZ0A 4QG3A 4XUEA 2R2GA 1PP4A 5B6JA 1MZPA 2QY9A 4J0DA 4WLVA 4RL6A 4N41A 4BQIA 3LT1A 2I0FA 3FKSA 3GAMA 1TF7A 3JQBA 4GU5A 4RDHA 3NMUF 1E1KA 2WM8A 2ZYTX 1H22A 1E3EA 2I4RA 2QVCA 2ZTLA 4KQXA 3LGSA 4MKIA 4O2BB 5JZSA 1IVSA 1NN3A 1EEHA 1YL6A 1F8YA 1KBQA 1D03A 2WAMA 3NIWA 2I6XA 1QJ4A 2M6LA 1FA9A 4A5OA 9ATCA 3SR0A 1JGTA 4XD7D 1LPNA 4A2QA 4BMZA 3R8XA 3EGIA 5JCOA 4RF3A 4EEXA 3EGOA 3N86A 1UJBA 1AKTA 3FUTA 2PUEA 3ZKAA 3A27A 3WLTA 1O5OA 3OT1B 3LT5A 2B9VA 2WM2A 4NNJA 1WKBA 2P90A 1GAWA 1FPQA 4RL4A 1WM1A 4W7SA 2HM7A 2R6JA 1G8FA 3CCU1 3SMVA 4B33A 3HGQA 4Z0NA 3HWWA 5HFAA 4D41A 2BTQB 3IJRA 3Q9SA 3FOEC 3MUOA 5KKNB 5KHOC 2JR6A 1UPUA 1SCJA 4KJZA 3WMGA 5KVSA 5KWJA 2WIAA 1M1NB 2FA9A 1EVKA 3DL7A 2BL4A 3S1NI 2W2OA 3EGWA 3RASA 2I1VB 1H4TA 1CDEA 3A4TA 3NOXA 3MPOA 3TBHA 3VTKA 4DY6A 2PUAA 4K2HA 1O9GA 2Q1SA 3I04M 1G4HA 5DTJA 4AURA 4MIEA 2CNLA 3S2EA 1F3OA 4JI5B 3L8ZA 2DH6A 3PFWO 1LQTA 1QFSA 3CF6R 5D5PA 3R9XA 3LIIA 1QFXA 3FN4A 4M1EA 2QJFA 1XP5A 2WF9A 5LB4A 4ZC1A 1NR5A 1E6UA 2ZT8A 1SFOI 1L5HA 1Y1QA 3PPXA 2NNWB 4HMQA 2PX5A 4NDAA 4C06A 2JZOA 1O6GA 5TDHA 5ENVA 3L5OA 4OK6A 2PGIA 1OFTA 4AP9A 3T7CA 2JRLA 2E4XA 4D9BA 2JD1A 4ASUD 4BE4A 5HF9A 3GEEA 3NCTA 3E7PA 4I7EA 5A3JA 4S04A 4Y52I 4XJXA 1E1CB 2ZAOA 2NO1A 1BX3A 2XNDA 5AHWA 5HSGA 1POWA 2FGKA 3OFVA 2BGLA 1A9XB 3I561 1RRCA 1S72Z 1JS1X 2I8CA 4MRNA 2FG5A 1NXWA 5BRJA 4F1KA 2UZ3A 2PGXA 3TUIC 2IKSA 5JQGB 4FWBA 2I2AA 3OP4A 1Q16A 1T8PA 3WL8A 1U1IA 3N2EA 5AJUA 4XRGA 1TLFA 1JEQB 4BWFB 4M83A 2Q8PA 2YHSA 5HA5A 1EP1B 3OIYA 4A2WA 2CFOA 1CUUA 2Q8QA 3OURA 3STUA 3EZ7A 4BC1A 2GD0A 1WP9A 2AOUA 4KR0A 1FRZA 4DLWA 1JZSA 3WP1B 1EFHA 3P0JA 2EGHA 4WQMA 3A1FA 3L8DA 4IXNA 3KKMA 3INNA 3ZY2A 5DX1A 4X6LA 2NU7A 3R5FA 3ZCRA 3ER8A 4UE2A 1D8TA 1U31A 2DUUA 3Q3IA 4L74A 1KK2A 1EXVA 2R1VA 1NUUA 1T4DA 3ZLVA 1NY5A 3O90A 3L0SA 2PRKA 3PVSA 4B4WA 1RLOA 3ET4A 2ZU6A 3S29A 1HC7A 3FR8A 3PO2I 2W22A 2XBUA 3JQFA 3IUQA 1PK7A 3RANA 4RTOA 3NDBB 3G23A 1TJNA 4P2BA 1BN7A 4B8ZA 1USPB 2VT7A 4X94A 2Z56A 1U2RA 3Q87B 2AR7A 2CBGA 2FSSA 2G36A 2BV3A 2R68A 3ONFA 3P9KA 4HNAA 2VCHA 4I1SA 4UAVA 3NANA 2POQX 1U0JA 2IYTA 3LS2A 3PL5A 4FYWA 3TB6A 3JQAD 3PQFA 4DCUA 4MW6A 1F4PA 3DDOA 4NBEA 1O89A 1OHHD 2PKQO 1KWKA 1CERA 2IYSA 2WJ6A 3LX8A 4FYXA 3UC9A 3THOA 4C9BA 1Z8FA 2R7AA 3C3CA 4ND3A 1I2ZA 2P28A 2Y9MB 2JAUA 1TT7A 4R0NA 4UNRA 4PNEA 2JFQA 3REQB 2QF7A 2C57A 4FILA 3I2KA 1SXPA 1NMXA 4EQZA 5KPJA 4LRTB 4QOSA 2RK3A 1BVYF 4OYRA 4DARA 4HZIA 1QMGA 2PDAA 3B38A 1G21E 4LVCA 2JJ2A 4TV9B 3DBHA 4J1TA 1J0CA 1QR6A 2HHJA 2W58A 3DUFB 3GL9A 1OCEA 4G0XA 1SR8A 1UPBA 3KJIA 4ZVTA 4BKUA 4EJSB 4A3MI 4R2LA 1N2JA 2XZLA 4NZ9A 4CEHA 1DE0A 2H4XA 4X95A 5LIRA 1XD8A 1HKHA 2MSKA 3WTBA 1EVJA 1G291 3HP1A 4ID9A 4IGAA 3R41A 5M34A 2ZM6B 1L4FA 1Z6TA 2DQ4A 3L4BC 3GU3A 4U7PB