2GTHA

Crystal structure of the wildtype mhv coronavirus non-structural protein nsp15
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
370
structure length
348
Chain Sequence
SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYFITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 91
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gthA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gthA02
2GTHA 2OZKA 4RS4A 2GTIA 2RHBA 4S1TA 2H85A
chains in the Genus database with same CATH superfamily
1IRIA 3ROXA 3H9UA 4JQCA 5IT4A 5AICA 2O14A 4ZEWA 5KVQA 4UMDA 4G5YA 5AKXA 2NV0A 1NVXQ 2PCLA 2VQ3A 1D4AA 4MVJD 4PZ0A 5BYJA 4MP6A 3I5XA 1JIIA 3JAKB 3G7SA 4OCZA 3W2TA 2HEGA 3KU1A 3OZRA 4PHCA 4DMGA 5JJCA 1ODFA 4GBMA 4LXQA 1GN8A 4ZT4A 4D9GA 5F7XA 3E9DA 2C1XA 3QV1A 4ISBA 2IYFA 5I9IA 2RI0A 4RK4A 1XMQB 2O19A 2IS1A 1EBUA 1RI3A 1X0VA 2E5WA 2FE1A 4LDZA 4RLHA 3TK1A 3MA0A 1YRBA 4J2OA 3Q1KA 4EITA 4I19A 2R5WA 4M1YA 4NZZA 3GELA 1TQ2A 2WQZA 3E27A 3NUZA 3IX0A 3R3JA 3Q9NA 4LBYA 1RO4A 1OPXA 3HB4X 1Y6QA 2QX8A 4XA8A 3GOHA 3PHCA 4TWRA 3C3BA 4F2HA 4L2IB 2QOEA 5JTTA 2I7DA 2JH3A 3GCFA 4RACA 3FTCA 4ZI7A 2Y1DA 1I94B 1DSSG 2FSFA 3D3NA 3LQFA 3HP7A 3A04A 1P5ZB 4MUJA 3FPAA 3RAFC 5I8ZA 2FGKA 2MYUA 5AKJA 2GHRA 3A11A 3GH1A 3L4BC 1P39A 3R3WA 2E82A 4Y2HA 3H4VA 1WPXA 3EQ8A 4RMIA 3VPFA 2BKAA 3JS5A 1DV2A 2VZ8A 1DRJA 2O06A 2JNWA 4BLWA 2QN6A 3OVMA 4DG8A 2P91A 5LB2A 3WSTA 5F9MA 3GRAA 3TIVA 4NB9A 2I55A 1GRRA 2QRKA 2YFKA 3IDAA 2VPZA 3O9MA 3KQYA 4L9WA 2DYKA 3GYBA 4R9VA 4TMWA 5KYXB 2XUQA 4EG4A 5LQCA 4PZUA 1WJGA 4L51A 3CZ9A 3A4MA 1MHPA 4QTTA 4R31A 1TWHI 1IN7A 1E8NA 2FSIA 1D1PA 2AN1A 3F9IA 2FTKE 5TS2A 1B2RA 1X92A 3OE4A 5EESA 3N87A 1T6XA 5ICCA 2DZDA 3D02A 4KREA 3FE2A 4Y9SA 1NVDA 3AJ9A 2DR3A 2NQTA 3O90A 3RKRA 4BO3A 3PXUA 3DZDA 5HNKA 5A62A 1UFQA 1EM8B 2O2HA 3BBPA 1ZC4A 4MCIA 4TN1A 4UBOA 4ZK6A 5A9RA 5K0JA 4EPXA 1W5EA 1XJ0A 5FOTA 3ZV3A 2R7KA 1U0NA 4IPTA 4LIPD 1PR0A 5E2AA 4M1TA 3WLQA 1SZDA 1QVGZ 2BEVB 3KVVA 3M1IA 3VSEA 4EUEA 4OLAA 1EFVA 1HV8A 5FTMA 4AQDA 4CTJA 2BSXA 3JZDA 1YQUA 3GH3A 3G0DA 2VDRB 2VA9A 2Y0BA 4QOIA 5FWAA 4DDWA 3PEEA 1JKXA 4BDSA 4J7XA 2QZSA 4D25A 1U11A 3EFOA 1DWPA 1PBTA 4QD3A 1SOAA 2F8SA 4PF1A 4N8EA 1U63A 3IBGA 4X1IB 5DKFA 1NJGA 1VKJA 4U2CA 3AC0A 4AY3A 1G21E 3OQVA 5TEVA 4J07A 2HGSA 1V16A 2SCUA 2EBHX 1TJ4A 2PSDA 5K2MA 4Z0HO 3QW2A 2AJ8A 5LC1A 2OCAA 3UO8B 2B34A 2WSSD 2ZTUA 2A4MA 2HEIA 2ZJ7A 1V48A 4J0FA 4JLDA 2WT9A 3G9UA 4FHDA 3TRFA 3VU3A 2QVCA 2QE7D 1SAYA 4CDGA 5JNLA 3AEXA 1XE3A 3IFUA 5A4AA 1LK5A 1V5EA 3MQ2A 2V55B 4PWZA 1E59A 3ZOZA 3NIDB 3R0IA 4JHLA 4QYWA 2JFVA 5IWCA 4KQJA 2VHEA 2ADOA 4M98A 3BAZA 1GCOA 1GWNA 1JE1A 1Q2XA 1SU8A 1W94A 2ZI7A 3TF5A 1EFAA 5AM4A 4LHVA 3K1AB 2CDBA 3PC8C 4MWTA 3Q12A 4KXMA 3ZGZA 2LKDA 2WVHA 4QNRA 1EJ6A 4TMVA 5E6RB 4M7PA 1RPZA 3B6EA 4ZU6X 4I2VA 2LIPA 1IUPA 3BREA 3TRJA 1PTJA 4X3PA 3F6EX 1FTGA 2QE6A 4W99A 3E61A 4XR9A 5JTUA 4EPRA 1A5BB 1I8TA 2QRCB 4UHCA 1LCIA 3UKDA 4I55B 3C5HA 6PFKA 4BXOB 1DPGA 3WQRA 1E1RD 2PRZA 4X8OA 2BBOA 1QQAA 1RM0A 2O3QA 2J4DA 3O75A 4UAJA 3MUOA 1EWKA 1UM8A 2HZ7A 4MV3A 5C35A 1R5OA 2H63A 2JPDA 1T8WA 4NCBA 3T5MA 2X2EA 1XAIA 4KXQA 2QA41 3G2OA 3MERA 2XCOA 1PEDA 4P92A 3T7IA 3I9FA 1QYDA 4Q6BA 3WQBA 4TL9A 4INAA 1QIMA 5J9FA 5FT9A 1UXJA 2BDUA 1Z0AA 1VCOA 1RXVA 3L49A 1EK0A 3C6ZA 5ICMA 2WJAA 5CFZA 3PEWA 2PJRA 2K2WA 3V1YA 3GROA 1RBQA 4LVCA 2Q6KA 3Q87A 1WNTA 3FRHA 4DJTA 2V0CA 3IQFA 3OQJA 4GBGA 1KBQA 1TU4A 4HWGA 4O4HF 1YR8A 3AIMA 4URXR 2ORWA 3O92A 4KK3A 1U7OA 3RZOI 2R2AA 4TWZA 3ZIAD 4EJ6A 1II8A 4BFXA 3JV7A 5A2GA 1YQGA 2LPMA 2OMEA 2YC4C 2HRCA 1M1NA 3L6UA 4LVUA 3VDRA 4ABYA 1KYXA 2C3UA 4BCCA 1JPNA 4CIBA 5JWOA 4NYIQ 4FYHA 2B20A 2OFWA 3IUJA 3GTKI 4CKEA 5CNJA 4L08A 2R8YA 4NNJA 1Z2OX 1Z37A 4PHTA 1QGUB 2OV3A 3MM4A 1FVFA 1ONOA 4WDRA 2W2QA 3RJMA 3ZJTA 4ZI7B 3TX6A 4F2GA 3V6MA 5JCJD 2XJ4A 4LJSA 1A2OA 3GRVA 3TLMA 1TWFI 4KFUA 4MDFA 2Z95A 1F9EA 4GRIA 1U81A 4Q4LA 5JAMA 1QX3A 3Q8XB 3V2HA 4CMEC 4O5OA 3F7NA 5HKKA 1MABB 3E3OA 3Q5EA 2QN8A 3ZBQA 4OQZA 1G18A 4EBFA 1H2ZA 2O48X 1XDWA 2I3AA 4I4TF 1RIFA 1Z06A 2BCEA 2Q4OA 5EMNA 2QW0X 2YWDA 3PWTA 2RB5A 3U9LA 5J4HA 1MVNA 5ER9A 4X0EA 4FKZA 4AG5A 3DE0X 5IVPA 1AN9A 4EJSB 5KQGA 4J94A 3AR8A 4FNGA 3TRHA 5JRDS 3ECSA 3I4NI 3EISA 3HFSA 4KN5A 1E18A 3GEHA 3DH0A 4WK2B 3A2NA 2QUHA 4JBNA 4ZT3A 4D9HA 4EI8A 4I5GA 3OLYA 3G0OA 4C3ZA 1N4AA 1M1UA 2V7UA 3LHSA 4TRNA 2JFGA 1EFHA 5EUBA 4Y9RA 3PL5A 2Q4EA 2Q8QA 2YWBA 2X0DA 3M82A 5FWXB 1FDSA 3BIWA 2XA2A 1NXXA 2I6XA 1EFVB 1CDOA 3C3MA 4OJKA 2GD0A 1GXSA 4QYSA 1RXEA 4RZ3A 3IALA 5DSZA 2VK1A 3U62A 3K2BA 2D4AA 1WUJS 4H77A 1RCUA 2JKVA 3O4RA 1HKUA 3IMEA 2C8KA 1FU7A 1OX6A 2NLOA 4ZKDA 1J2JA 2CL5A 2EL7A 4Y2UA 1HORA 3FUVA 5A5FA 2PR2A 1ZI9A 3VC1A 2Q5FA 2DFPA 3ZXSA 1JIUA 2WKRA 3HGMA 3KTOA 3KYBA 4R1MA 1OTHA 3ZW9A 1OX4A 1JEQB 4HNAB 1UCFA 3UYKA 1LSJA 3I561 4C0SA 3RBAA 4ZAYA 4CQLB 2IF0A 1NR1A 1A0OA 2W98A 4XM1A 4M1SA 3L4JA 3DDCA 5AIAA 1NGSA 1RRFA 2F9FA 2XGGA 2ZBQA 3ZNQA 4GYJA 2WG2A 1N2CB 3L6EA 5MGNA 5P8WA 4Y6PA 1LZLA 2I6FA 3IQIX 5FUYA 3WJ1A 4KWTA 3OESA 3NBYC 2XTNA 3OT4A 1QVAA 2QS9A 3UVEA 4ZPXA 4ZYUA 1HDOA 4BIIA 3MGGA 1QG6A 4BYMA 1Y4DE 5BW8A 1Q1ZA 2VXYA 4OKNA 4DSAA 3URMA 4F72A 4X9XA 1VKRA 3FN4A 3CY6A 3NAQA 2CLHB 2FH5B 5CFRA 3CLKA 1CZOA 1DJLA 4JVLA 1R0BA 2CJXA 3OM8A 4PW0A 4YAJA 5AVSA 1H4TA 3OW2Z 2PWBA 2JBAB 3T3PB 5ELMA 3OE7A 3TFWA 1YONA 2R9VA 3G4S1 1ULZA 4JLMA 4DR2B 4JBIA 1AMUA 2NIPA 5ALWA 4C7BA 4ENVA 3PBKA 1OXBB 2D2VA 3C5EA 3H2KA 3CCVZ 1KC3A 2LW7A 3VPDA 2V6BA 2C20A 3OQOA 1FSGA 2XZOA 4QTZA 2RG1A 5B64A 3G7NA 4UFNA 4TYYA 3D6FA 2BL4A 1ZESA 3G82C 3UGKA 4G5FA 3TNYA 3OTQA 2H1WA 4CQMB 3G59A 2GM5A 1BW9A 4AB1A 1U31A 1WHTA 1DT5A 1AHHA 4Y30A 5K3FB 1AF4A 4UMFA 3ETDA 3AKDA 3KQTA 5EIHA 3RS3A 4FKMA 1P1FA 2QNRA 4NZOA 3ZZUA 1V47A 2DWPA 4ZIRB 1KNXA 4UULA 3DJFA 1Z8FA 1Q20A 2GD2A 3AB8A 4OBXA 1CZLA 4D8YA 1ABBA 2HYDA 5CP8A 3NWJA 3MG9A 4JP2A 2XKKA 2IYOA 3NS7A 4IJVA 1OFTA 4EG1A 4F06A 4F38A 1PFGA 5FL7A 4F60A 2J0UA 2OSVA 3RSLA 1VCIA 2W6ID 3OFJA 5BOSB 1UKZA 2BFOA 3HEAA 3F4KA 3LHDA 3ZGVA 3KDPA 3DEAA 3EVCA 1AB6A 3LI2A 2H65A 3QE3A 4PIVA 5KC8A 1QF8A 2GRUA 4IGEA 5AOCA 5EXDA 2NU7B 3BC1A 3TQQA 1ENZA 4ZWNA 3ZCSA 5CW2A 5A3RA 3KWMA 4NOJA 2DR0A 1GVHA 1ESMA 4IDDA 3D7LA 2FX3A 4B6RA 2G6BA 2J8ZA 4B6EA 4EB3A 5BSGA 1YJ8A 2G2KA 4KH1A 2WIBA 3JPYA 4R2LA 4I08A 2CMGA 1GQSA 2NO6A 4ZJZA 1PIWA 3ZV5A 3ZPXA 5HKAA 2E6UX 4GKBA 4BE9A 1L4UA 2W8ZA 3KFLA 1FQWA 2DKFA 2Y67A 4A3SA 4BPRA 2V03A 4A23A 2WLTA 2WSSA 3R7BA 4S0XA 2IEZA 4G4SP 4JCOA 2V54A 1C9JA 3J7A4 1QGUA 4AZ0A 4TV9A 4UDXX 4YTEA 3KQSA 2Q4BA 3OZGA 3R5JA 1U7DA 1ZU4A 4JN6B 1TMYA 2F67A 1A8UA 3NQ41 5L4LA 2GCOA 4FJ1A 2A4KA 3B85A 1MMFB 4AS2A 3R7DA 2Q45A 2MSLA 1ZMOA 3K1TA 4IOLA 4WXRA 5JLAA 1DIBA 1DWQA 1NYLA 3N8DA 3L2OB 5DN6D 1JVBA 1W5FA 1U5BB 1MB3A 1EVYA 1F2TB 3AGPA 3EEYA 4YP7A 1DJMA 2ONCA 1VIAA 2WJVA 3UBMA 3CH4B 4OXIA 1CJSA 3AM3A 4Z9XA 1IHPA 1KXZA 4IO1A 2BT4A 1JWLA 4IL5A 4CEHA 2SBTA 1TQ4A 2PA3A 3NBXX 3N6RA 3HXLA 2I65A 4W1PA 3G7UA 1RE1A 3DMYA 3IEXA 3ESDA 5J2TB 4OX9Y 4UHKA 4G9BA 3C5CA 5IK2D 4MUEA 4IUYA 1JFRA 4G1FA 4LSWA 2RKOA 1R0CA 2H31A 2Z2IA 3KU4A 1E3LA 3T4PA 4LGCA 4MH0R 4WBNF 3DT8A 3HL0A 3L92A 5A2Qb 2NTYC 1HLGA 2AE2A 4YCBA 3LO8A 1KO7A 3EHDA 3W7VA 1RYHA 4WZBB 2ACVA 2GGSA 2YNMD 3AJRA 4IVNA 3RC1A 3T0GA 1RWPA 2P4SA 1AQLA 2ZB2A 3HBNA 1LJUA 3RFUA 4K3UA 3ZLUA 3ZY5A 5YASA 3EYAA 1K63A 5JNRA 1A3CA 2IKSA 1SOUA 2VP0A 1QPZA 2FQWA 1JTEA 3GLHB 2PMCA 1C7IA 3DBVO 4N41A 4X45A 1TQ8A 2Y2VA 1G3UA 4HNAA 1RQPA 4POAA 4KV9A 4OHOA 4MRIA 2PYZA 1I4EB 2BMEA 4MQ5A 3I9V6 3LF1A 1P6QA 3BRCA 3G9QA 3BWXA 3MTBA 4XKJA 4EX6A 3WG9A 3KKKA 4Y98A 5EXSA 2OMKA 1EKXA 3LX8A 4E70A 4EY5A 2FZCA 3ZQ4A 3EVBA 5ILOA 1OXMA 4BPBA 3GX1A 1OPRA 2FSSA 4YRLA 1Z0UA 2X5XA 2ZULA 1L5YA 4CLRA 4EHLA 3ZV7A 2B21A 2Q2WA 4E08A 3EC7A 2AKAB 4OI1A 1ZEMA 3GVHA 1RAEA 5D7BA 2OCIA 2FW1A 3PA6A 4WI1A 2WHQA 3I64A 1NDUA 2O23A 5KX5B 1X9HA 4QUBA 1MNAA 4DAEA 1BDJA 2KE5A 3TIFA 3GJ7A 4ARZB 4B32A 5D51S 4REOA 4ZGWA 4CM9D 4RF5A 1OTYA 3JTEA 4KBYA 4LOAA 4CKZA 2UUOA 5KWIA 3K7EA 2AOWA 3NWOA 1XD9A 4EZBA 5LDDC 4CCYA 1APBA 3ZD7A 4Q4DA 3FOAA 1G7CA 4OHCA 2BH2A 4MYSA 1OILA 3BTSA 5JDIA 3CRW1 4P4UA 1UBOS 2GT1A 3AYZB 4IFBA 1YJQA 4K2AA 4H6PA 2OCBA 3C39A 3ZWOA 1AHNA 3SR3A 2JS4A 3HJUA 1YAJA 1UEXC 2BLNA 2ID9A 2PSSA 4HLQB 1J8QA 1W0KD 1I5EA 2P9HA 3A0RB 3DGFC 3FGPA 4Q1AA 4ZZ0A 5BWCA 2Q3EA 4J4TA 3AILA 3LBIA 1EVZA 4PTYA 2QX7A 3OI7A 1GPYA 2GBLA 3F5MA 1WS6A 4N9QA 1QKIA 3KUKA 3GGPA 1NW5A 3PPWA 4G26A 2X0EA 4RTMA 3P0JA 4Q7JB 5AW6A 2GTIA 1LWNA 2YH2A 1DRKA 3DMNA 4LK2A 4OREX 2WJHA 3PFGA 1SVOA 5AESA 5KNCA 1EDOA 2CNOA 1EB8A 4FCWA 4LXIA 5ALFA 4HYEA 2F59A 1JAYA 5GJBA 4BVHA 1GCIA 5DM4A 1WPRA 5IXJA 2FXIA 3UA4A 2XNKA 5A6SA 3FOWA 4MCHA 3V46A 3ZS8A 4U7FA 1U7TA 1Y3CE 3JZMA 3L05A 5GGXA 4CF3A 2R5NA 1Q15A 4L76A 4CUZA 3KZMA 1Y6RA 4Q9KA 2PGDA 3EBPA 1Z6QA 1V3TA 2W04A 5IVHA 1YJXA 2BBWA 3G9TA 1OBOA 4Q6WA 2QEQA 2WYVA 1OTXA 3CMA1 4JX8A 2YUIA 3LUHA 5I7HA 3R74A 3DUFA 4L28A 3IAHA 3PFBA 5IM4A 3U2QA 2A7XA 3E81A 2QYHA 2HSZA 4S1NA 4TT8A 1E98A 4CL8A 2K5RA 5M3BA 2O0JA 5AVVA 2WMYA 3T9CA 2W0SA 4GP7A 1TVCA 4MX8A 1T4CA 5H81A 5U9CA 1VKHA 3OP1A 4R8VA 1E9DA 5CDYA 2VXCA 4WNYA 1S3SA 3FDIA 4JLJA 3CPHA 5ES4B 5LLTA 3WBKA 5AJUA 2RGNC 3IESA 5JJKA 3K9HA 1AKMA 2Y6UA 4D80A 4LMRA 4GPZA 4NBTA 3LPAA 2BD0A 2IUUA 3U4CA 5EXEA 3TLGA 4RFSB 4YWJA 1FRNA 4GZMA 2AFRA 1AS2A 1NDQA 3BDAA 4O3FA 4PG7A 2IHTA 1X9GA 1ENYA 5M7EA 1NL3A 1DUVG 2C42A 3OJLA 2IGBA 3JQQA 3GTOI 3IAAA 4J0QA 2K7FA 2NZUG 4Z9BA 4P86A 4U2DA 1VQNZ 5AK5A 1KPIA 2IEGA 1WSDA 4L0QA 3SEAA 3ZG6A 1LBHA 4OIMA 2QTWB 4PFSA 3WLAA 4C7OA 1KEEB 3B3QA 4X8LA 3RG2A 5KI6A 4D5GA 4Z5XA 1GU0A 2AOUB 1E64A 1WV1A 3RVJA 1XF9A 5D00A 1SXGA 2E49A 5KQRA 1RJGA 2XQIA 4RD3A 3UH1A 3RUDA 3UJAA 4NBVA 1XRJA 2RCNA 3CH6A 3M2TA 4G0PA 3GJXC 4B34A 1OX5A 1ZC3A 4RMHA 2K6GA 1GR1A 4MKHA 1V11A 1THZA 4HGNA 3KM0A 3TM4A 4EO7A 3WWOA 4KPUB 3ESZA 1BYIA 1WVGA 4BWYA 3OQIA 1OGJA 4XJXA 4M88A 4CL1A 1DQYA 3K6KA 2HV8A 4TKMA 1KMHA 1J9ZA 5E95A 3C3JA 5LDGA 4A6XA 5HIKA 5CIYA 1DMSA 1H85A 3LA8A 4RA9B 3RJZA 3ZJVA 3T7JA 3ZU5A 1TFRA 1VGQA 3HVUA 5JH7F 2A14A 3D7KA 4OUKX 1SA0B 5KQSA 3Q85A 1B1CA 1ORRA 4AO6A 4PN7A 1XPUA 3VU9B 3SNKA 2EYQA 3K3PA 1KYIA 4HTAA 8OHMA 1JYEA 2JFUA 3IDOA 3D43A 4A8HA 2YVKA 4BV9A 3CC21 3TFOA 5EY5B 1XNHA 3DYIA 3DQPA 4PZPA 5B1EA 5K5EA 1Q17A 1WWKA 3FWKA 3EPJA 4OLFA 3V9PA 1BGWA 2CEAA 3LT0A 2ZR0A 3RG8A 3L9XA 2O1WA 3I12A 4IIEA 1E4EA 5FNVA 3RQIA 2HC9A 2EP7A 4CV1A 4B2IA 3NBKA 5IMSA 5BSTA 3AOEC 5FADA 4PCVA 3AJDA 1RZRA 3LGSA 2CVPA 1N5KA 2QBYA 2QTTA 2AYZA 4MCJA 2FVYA 5F3DA 3LWNA 1FQKA 4A0QA 3AIKA 2BEUA 3V1KA 5D1PA 3M5WA 3PK0A 2VFAA 3O8OB 4JI7B 2GO7A 3UH0A 1PJ4A 1CRWG 3AJ8A 5NLLA 2BBTA 2IUYA 2QXTA 5ARCA 5GV7A 5I7RA 4I6EA 2AVDA 2NYRA 4WEQA 3DEZA 3SGLA 5KB3A 2A0UA 1C1DB 4GI7A 4XYGA 3P52A 5LQDA 2VP3A 2D0PB 2RJOA 3DWGA 4M76B 3RIGA 3VZBA 1QHHB 2PUFA 1CJVC 1G4AE 3H05A 4YQZA 3CBQA 5EKSA 2E4WA 3GJ4A 2GPYA 3L46A 4TSKA 1Z0SA 3QKRB 4IDNA 4YBZA 4ZOBA 1CWUA 5EC8A 1A5TA 5A3VA 3AVYA 3HJHA 3BH6A 4Y6GB 3S16I 4MPRA 1KYWA 5TPWA 1ODLA 3G2HA 3MTDA 3A9VA 5CFNA 1RBZA 2OOXB 2PXHA 3R4CA 3FPEA 4G89A 1QRSA 3A9SA 2G5TA 3NPAA 4RSRA 4Z86A 3HEBA 3NOOA 1M34A 1RFLA 1TC2A 4IJWA 2I4LA 4MWCA 3R23A 1BFKA 2XMGA 2EX4A 1KKLA 2P2ZA 2R00C 2XIQA 3HXPA 3PDIB 4UU8A 3UAGA 5KDOA 3H4IA 4IR7A 1T2VA 2AQHA 3CC8A 5F1OA 3ICVA 4U9UA 3O95A 3UTCA 2GPAA 2W4MA 3DQQA 4EYGA 1ZG3A 2JAPA 4KX3A 2PNJA 3H9BA 2OECA 2KQUA 4JVSB 3TTVA 2FHPA 3T34A 3IPXA 5AKIA 3ORYA 3BRWA 1ML4A 5SZIA 3SHWA 4I5DA 1NG9A 1E2FA 4P38A 1N6RA 3H19A 3SC4A 1M6WA 1JYFA 3TIGA 1FE8A 2VF8A 2PRSA 3OU6A 4YJFA 5DCLA 3KJFA 1ESEA 4LTDA 1SWWA 4HFNA 4PXSA 5BQOA 2Q9BA 3JWJA 2M1XA 4PTLA 4DARA 1RZVA 2I7XA 1JDUA 3AUUA 3KKLA 4GMXA 5DGDA 4AYBA 5KSWB 2HHHB 1I3OA 1UBGA 1ZOLA 4WY5A 4B6QA 2GXUA 3D1LA 5K6TA 1I6KA 4UBLA 2I2WA 1JB9A 2IU3A 4YACA 2GN8A 1UR5A 2UZAA 4PNHA 5DOZA 1P4AA 1FLVA 5A1TA 3WAJA 2DQSA 1R37A 1SCIA 1DO8A 3CO5A 4P80A 1SIBE 1TUIA 2I8AA 3I04A 3O8BA 1CJCA 2V59A 3RROA 1YFLA 4KPGA 2PUDA 3ICQB 3FVWA 4KIJA 2GNAA 4I9UA 4C21A 1KD11 4OG2A 4U7WA 3ZCUA 4NLLA 4MVJI 1AIPA 4URFA 3REOA 2ECFA 3VJKA 5DCYA 5AVQA 1W0JA 3ST7A 3WMXA 3I551 5TF0A 3NRBA 2HSDA 5EJ7A 1IUOA 3ZLVA 1BDIA 3SEQA 1OWOA 3SQDA 1E1NA 3JQ7A 2QDKA 1SKQA 1AS3A 3IQGX 4KE9A 1P29A 4ECEA 4CNQA 1KEWA 4CKBA 3LUFA 4Z4CA 5IAAA 5DWVA 2L18A 4YH1A 2C98A 3K9LA 4QDXA 1LSOA 2YVAA 3ABQB 4ND8B 4I1VA 3AJEA 3SN6A 5EIBC 3I01M 3TCXB 3HBMA 1L5RA 3U60B 2OUKA 2VI5A 3K0KA 4QXMA 4Q19A 4IDHA 3OX3A 4HBZA 4BNJA 3G8BA 4J0IA 2E2JI 5HQJA 3VTFA 1KEZA 3TLKA 1KVSA 4DA7A 2ONKA 3W2GA 4ZVUA 2DH6A 3IKJA 5H3CA 4L4ZA 4B3SB 1RLUA 1K7CA 3BFJA 5ALVA 4M9QA 4NCHA 3EIEA 4EFDA 3R9KA 2BFCB 2IPLA 3NIWA 5T8KA 1SUEA 4B7AA 1ZLYA 1DIRA 1SVSA 2OPBA 4MWEA 1W4AA 3HVJA 1SULA 1V6SA 1NURA 5AXAA 3WLIA 1AK9A 2X8JB 5K6RA 2OBBA 1QE3A 3S8EA 1OFGA 1O54A 4KUGA 3VR4D 2R84A 2ZJYA 4D0LB 2JB9A 3PB3A 3V1MA 4FTWA 5HGXA 1SQ0A 3CXCZ 2WF6A 4LDAA 3V4RA 3TQIA 1ZM2A 3BXZA 3EOZA 4PBRA 5HK8A 3W7AA 3WLMA 4MLZA 4A0HA 1C3JA 3SAJA 1HE8B 1BU5A 1U1GA 3TLYA 2F8MA 4XFJA 3TVYA 2C4TA 3VC2A 5K0TA 5JATA 3EODA 5KYWA 1IYZA 1B23P 1SBNE 5A0FA 2P4QA 2J3QA 2H7VA 1PU2A 4RVGA 1XP8A 2AJDA 1QAMA 5B12A 3IAS6 4CEIA 2QK4A 3B48A 4HX2A 5FA8A 4LXGA 3D5TA 4AURA 1K0FA 4IRXA 1YIJZ 1QKJA 3OQHA 4HRYA 4HXGA 4L3OA 2G08A 3KZNA 4AAYA 3T9DA 2SNIE 3IEIA 4LOJA 3U56A 4FFBA 2BELA 5D8DA 5JAQA 3RNLA 2ZVPX 3GLSA 2ZVQX 3H9JA 4ODIA 5F2KA 4BX2A 1W9MA 1YDWA 4R8SA 1R0SA 3FAKA 1ZSYA 1YGPA 4CTMA 1UT8A 2BFDB 4TMTA 4HMOA 2J59A 5GQSA 2WTMA 2ONZA 3C3YA 1U2SA 1KBZA 3H5TA 4ZXFA 2IOQA 4G0MA 5ES3A 3PE3A 3WHIA 4UFPA 2VWGA 1HT2E 3B7GA 2V5AA 4WA7A 3O74A 3VHXA 4BATA 1W1IA 1P4SA 4FYXA 1GA1A 2NSYA 2X1MA 4P5EA 5FO0A 3MELA 1U4NA 1AO3A 1WBJB 3QLTA 1UZNA 1J90A 5DHUA 2J3DA 3N05A 3LDGA 2A1TR 3PQ5A 5E6UB 4A6EA 4W9NC 1MRNA 1W2BY 1EA7A 1JXAA 1XDDA 3K5PA 3MCVA 1CQIB 2QQ5A 3E58A 2HU9A 1VLHA 2NZWA 2OVBA 2X7JA 3NHZA 2O8DB 2PMKA 5B3KA 1E79D 1GUFA 2ZQ5A 2ZXEA 5CH8A 1UM9B 1QYXA 3JAMf 1KVRA 1M8PA 2B4YA 4HB0A 4RVSA 4XX0A 4B8WA 4IIVA 4QOEA 2Q4DA 1X14A 3RC9A 4K7JA 3ZW7A 2YRFA 1S7MA 1X86B 2J4CA 4L73A 5FAXA 3H2JA 2C2BA 3BH0A 2Q6VA 3HYCA 3KDAA 3VZQA 4AL4A 1KXJA 4EP1A 1USUA 1OZGA 1Q2UA 4J16A 2OGTA 3ZHQA 1ISRA 1ZJJA 2NT4A 3D8BA 1K83I 4R01A 2Y1FA 5LBUA 1XYVA 3NDJA 4Z7NB 1ZH2A 3OD5A 4YGYA 4KWCA 1W6RA 1G7SA 4MKGA 3V00A 4ZI2A 4LXXA 2R2GA 5GOTA 2RBEA 3B5IA 3UAYA 2VDUE 3BL5A 5AUQA 3X3HA 1EWYA 3STWA 3NATA 3K2QA 4HFMA 1G6OA 2X58A 4I8XA 1U3CA 1PR6A 2ZATA 2ISSD 3PG5A 5EXTA 2W2MA 1TO1E 1ZD2P 3T15A 4Q3OA 3C16C 4BMNA 3HRIA 2BKVA 1NG1A 1YIDA 4DIUA 1IXKA 1UWCA 2V6MA 3K73O 2B0CA 4LZOA 2OC4A 2WU3A 2W00A 3QXSA 2P9JA 5I01A 2P6UA 5FPQA 2XXJA 1NTOA 1AKTA 1D2AA 4HDKB 1PT6A 3TGLA 3QEJA 2PGAA 3GJ6A 4C07A 3NFZA 5DYGA 1XN4A 1PD0A 3PHGA 3QVVA 4QBHA 3ESYA 5EOVA 1R4MB 5CBPB 1Q83A 3TTTA 2XUPA 3E70C 4IIGA 4NV1A 3QVKA 1O5IA 3BE5A 5JG7A 2I7CA 4G37A 4OQMA 4WLVA 5D5QA 3FOCA 5ALXA 3SJUA 4ZJYA 1E3EA 4KIUA 1AGYA 2G63A 4XM0A 5BR8B 2HNKA 4BVKA 1O9BA 1VRWA 4JGBA 5E3JA 3W8DA 2CYBA 2Z2XA 1ZGAA 1QNFA 3LPLA 5TVGA 1S8NA 3ZDRA 4P4SA 1QHSA 3D8TA 1NSTA 1EYZA 4OHUA 4M38A 3RYIB 2V3WA 3KXIA 3PQEA 4MI1A 4TGLA 2GFHA 4Z2AA 3N3BC 2PUAA 2J9ZB 2X77A 4CT5A 1QU3A 4NCAA 4GI1A 1R9NA 2VHTA 3EDCA 3U1VA 3P97A 1NU8A 1PNQA 1RYZA 2ZJ5A 4JT8A 4YVFA 2J45A 5IM5A 2IXFA 2JFOA 4QU5A 3HI6A 1X3WA 1U65A 2LBPA 1SBQA 1G6HA 4QELA 4C06A 2WM9B 2ZGVA 3LQRA 3RASA 3WISA 4HLCA 4DJAA 2FQYA 3VC3A 3KVRA 1BA2A 4I8DA 4LHXA 5CLGA 4YRAA 2AOTA 2JAOA 4JI1B 1MRZA 3WAKA 2ZRBA 5JHHB 1G8GA 2GK6A 4QFDA 2JGEA 2QQFA 1X3ZA 4UFOA 2HA4A 1WBBA 4CM7A 3GEPA 1JXQA 1ESZA 4E1BA 3F98A 4EAQA 1W8IA 4KKXB 5KNDH 4MPPA 4PNPA 4US0R 1EQAA 1RRVA 3QXCA 5J5VA 3C2QA 3VPBA 1BRMA 4RV5A 3B52X 3KOYA 4LY0A 4N03A 4YI3A 3TLZA 5AW8A 1LD3A 1WUHS 1C3OA 1RZUA 2GNOA 4QUJA 2G3YA 3WI7A 1A8SA 4QXRA 2I1LA 1ISPA 3IDQA 4RPJA 1C3EA 1NFRA 1FSSA 3IGFA 2YBDA 4QXAA 3AOEA 5EJ5A 4NR0A 1K92A 3OUZA 4KIWA 4OQQA 3UK2A 1E4VA 3WR5A 4P7GA 2G77B 2NX2A 4JR2A 4FHEA 3FSGA 3E8XA 1XKQA 2WD9A 4WOPA 4UZFA 4IILA 3HJNA 4OYYA 3TDNA 3OZIA 4IJ5A 1Z0FA 5B1DA 1T2UA 3MINB 2OM2A 3WQHA 3QE0A 2C3MA 1ULBA 4DV7B 1SCKA 3F6BX 1ZP6A 3CR7A 4IHJA 2PZMA 2V7QA 5L4NA 1TUBB 3BB4A 4EGSA 2GSDA 4WASA 5HXAA 1SXJB 1UBLS 1I6LA 2X22A 3DL4A 1JUDA 2Y9MB 1TM2A 1OVMA 3F6PA 4FD2A 2HF8A 4GP9A 5E2BA 2PZEA 3DBIA 2OCYC 3EZ6A 3ER6A 5EG5A 4QREA 4L5BA 5ENDA 4HL6A 6CHYA 1ISMA 1Q1EA 4BQQA 4HBGA 1NVVQ 3BGIA 3OJWA 1VHTA 3A4NA 4C7MA 5F2NA 2QPLA 3U0BA 3S2IA 1Q7Y1 3H1AA 1MC8A 1C8BA 1PUXA 2BDTA 3SJAA 5LMCA 1MB4A 3ZUPA 5DBIA 3E23A 3K0FB 3FPBA 4F6RA 2Y0SA 2FWNA 3JQBC 3NVDA 4LZLA 4UPDA 3ACCA 1J0AA 3O7WA 5ICFA 4Q4CA 2IIPA 3EZFA 3WGZA 4EA7A 5IS2A 4U0JA 4KHZA 3UXYA 3D3EA 4RA6B 3RSHA 1PSDA 1YGYA 3ZTYA 2DE6A 1D2MA 4RAQA 4RVHA 2K87A 2VPPA 3FMVA 3OUUA 3NW9A 2JIQA 2GRAA 5E8JA 2J3MA 1C3LA 3H6GA 3WBJA 3R9XA 1DT3A 3NBMA 4BE7B 4X6XA 5K8LA 1LBTA 4Y7NI 3QBEA 3DE1X 4GVLA 3L8MA 2A84A 3VMFA 1H8EA 3IEUA 4CBVA 1SBTA 3GPLA 2DUJA 4Q1DA 2W6JD 4GH5A 4DA6A 4DZRA 3I56Z 3GFTA 1SPBS 4Z49A 1U9IA 4QYMA 4AZ3A 1E62A 5HG0A 2FN9A 2BGGA 2MOKA 2PXAA 2BFAA 3UCXA 5M04A 1PD1A 3GMDA 1MO6A 3HYSA 4NESA 3RS7A 3UMSA 5KWSA 2XVMA 1EFPA 4HG2A 4YIHA 1WZ2A 1E3WA 2GPWA 2QTAA 3W9BA 1INLA 4BNYA 1NUHA 3JAMA 1XZBA 3OPYA 4XB1A 2GM3A 4EB6A 3AF4A 3PKIA 4UDYX 1BE0A 3RIHA 3RVOA 2CXNA 1WZEA 2PZLA 8AT1A 1NNSA 5EJEA 2FN7A 1E0AA 1FP4B 2YNMA 5AYVA 3T41A 4COKA 1J8DA 3TLAA 3N28A 1VL2A 3AIOA 1R6DA 4YT2A 5HJ7A 1N3BA 4HDNB 1H2EA 3OG9A 5K05A 2AKEA 1E5DA 3RSFA 3U5ZB 2MSKA 2EIXA 4U1RA 4P81A 4B1FA 6ABPA 2NUTB 1EM6A 1ADBA 2XHZA 1TYAE 5BWOA 4M7OA 5KWVA 3LCCA 3IV9A 1A9YA 3ZS9A 3K8YA 3OU7A 1T8YA 1IEXA 3ASUA 2M6LA 3LM8A 4O4JB 3GNLA 1XXLA 2Y27A 2KI7B 1C8VB 2XWJI 2R85A 2GJ8A 1XPRA 2HPZA 1MAHA 2C4HA 2FN3A 1EG7A 4RIGA 3DLTA 4MQLA 1QORA 4X1YA 3FTEA 3BF8A 3V48A 3PC6A 4JSRA 4JQSA 3UYLA 1L7OA 1Y1PA 2EJUA 2VEDA 2D5IA 2Q4TA 2VOJA 3DZIA 3KLMX 2ETVA 2R1TB 2FPIA 3BIOA 4Y1RB 1T2CA 4DV5B 2O8CB 1CG6A 1CUFA 5BW4A 3IBYA 3L0IB 1IAQA 4RGVA 1JLMA 4RLFA 1TM7E 5E7IA 3ZVNA 3B60A 1A9XB 3KCNA 4N1AA 4V2UA 4ZVQA 5I9BA 5I4IA 1VMDA 4X6UA 2PGJA 2VK2A 5I3CA 3SMVA 4H1WA 3KZVA 3WP0A 1VZ3A 4F3RA 1ULSA 1L8LA 1TYDE 1WVIA 1PJBA 3FCAA 4Q15A 1NBHA 1VECA 2BFPA 3Q3GE 1L4GA 4AC9A 2O2IA 4G9GA 1XV5A 2BJVA 3DR5A 3F47A 3F78A 3FUWA 2HK7A 4ROSA 3SDZA 4BAUA 1MXHA 4XVQA 2BTEA 1K4MA 3QEAZ 3QPBA 2OCPA 1YZUA 2RH5A 3A2MA 3ETHA 4Z7JA 2AR0A 3PC2A 5CMLA 1BXGA 2JZCA 4XLZA 5C3UA 3WGGA 4QXQA 1YRHA 2WJWA 4LMPA 1CR0A 4RV9A 3LQKA 2BGKA 3AG5A 3H1GA 4EPVA 1R8YA 1W88B 1E1QD 4C3OB 2PMFA 3N53A 1KJYA 2MHCA 4UM8B 2C9ZA 3AWDA 3JY6A 4UUMA 1X80A 2PS3A 2WIGA 1QH8A 1XRMA 1YOBA 3LECA 2UYOA 3P0IA 4LE0A 4ZT2A 4M2LA 1L5ZA 3GARA 3GFQA 4U2BA 4MGZR 1L5KA 3NGLA 3KQKA 2C5EA 5DCUA 4JI6B 1QK3A 4KLZA 2DFNA 4GMGA 4TV8B 4URYR 1FUEA 4Y6LA 3D6WA 5IYZB 4Q1FA 5AM1A 3VDXA 2QA4Z 3RVRA 1JEEA 1TFUA 4FGZA 5H3LA 2O0KA 4C5AA 3RARA 4I1IA 3TG2A 3CVUA 4HNVA 3K4QA 4W6QA 5C0OE 1T3LA 3QI7A 4R2JA 4E12A 4PFJA 8LDHA 2HR1A 1JBEA 4A9AA 2Y4OA 2RI1A 1YXMA 1Q7BA 1WVMA 3RUEA 3U7JA 3ES9A 4XFDA 1RVV1 2BM9A 1T25A 3G0IA 1TTTA 3BG1B 3BD9A 2FDXA 4E2XA 4OXNA 4TVSA 2Y8EA 2EHDA 3FHLA 3GAAA 3HKCB 1U0LA 5IDYA 2I8CA 4TQAA 3WS7A 1C50A 1UC8A 3GRFA 3OY7A 4MTCA 1E1YA 2XOKD 1N8R1 4EI2A 3WL6A 1DELA 4W1SA 4BEJA 4EHKA 5IHXA 3G5TA 3NAGA 1VQKZ 4Z3DA 5HQTA 5LZ8A 5EJ8A 1PWZA 3QOWA 1EWQA 3EDOA 2F64A 4MB0A 3CUVA 3MPOA 3V4LA 3BE8A 4IF6A 2H48A 2QA5A 1Z39A 1L5NA 3KOMA 1HX7A 1G8KA 2IYNA 4GYWA 4JJ7A 3NBFA 2A5DA 2LIVA 2GRJA 2M2IA 1V8ZA 2OQRA 1FB5A 2VN8A 2WJJA 4CMHA 2ZUEA 4MLPA 3DS8A 2YZ2A 2C57A 2E2HI 3L06A 2IGTA 2ICAA 1QCZA 1YUNA 5CJPA 5I7OA 2NTEA 2IXTA 3TTUA 1NPYA 3KT3A 4QOSA 2YHSA 1J5EB 4JKOA 2WSYB 1GPNA 3DWIA 2ODPA 2Z1DA 1AH2A 1SC3A 4P53A 3TB6A 1PWXA 1Y8AA 4FQ8A 5C44I 3CZAA 1EEXB 1NIPA 2IYUA 1UUFA 3KOXA 5ECYA 3TW0A 3GWZA 4ND6A 2F48A 3STYA 2B8TA 1QHYA 3BWVA 1Z5GA 3N7UA 5I5EA 1KJQA 1SJ9A 4B46A 4X1KA 4MDEA 1EFCA 3Q5GA 5KSYA 2EARA 1GLNA 5I4KA 2XYPA 2QTGA 2BFWA 5A4KA 1WZNA 2QYTA 1C2TA 1GZ7A 3CXUA 3OJCA 3IUBA 4TKVB 3HVRA 5AKKA 3GUZA 4HYQA 3PRHA 5BPHA 3CXRA 4BO4A 1XNJA 2NU6A 2D0DA 5K1ZA 5IN5A 2JHGA 3ZWQA 3ILYA 4IHJF 2KPIA 4R16A 5CXSA 3S2YA 3W06A 1GILA 3VSCA 2ID4A 3WLJA 1GXSB 2AHOA 2FW8A 5DXAA 1Z6ZA 4BV3A 4BZQA 1FP4A 2COEA 2DRIA 4D3DA 1CV2A 1UJMA 2P2DA 2P78A 5E1OA 1J09A 1JP7A 2HNBA 2V0NA 1JZQA 3NASA 1NBME 1KMHB 3WA7A 2FQQA 2MR5A 1JQDA 1LPMA 1X94A 1L4YA 1P74A 2UYQA 2P67A 1SUFA 2EHJA 3F5QA 1SOVA 1YA8A 4BFSA 5KS2A 2RT9A 1R3UA 2ZRCA 1JF8A 4AX4A 4L4YA 4MUMA 3KC2A 4R7GA 1Y6FA 4DXAA 1WB4A 1I32A 3PIRA 2OZVA 3H9GA 2AKYA 2WWYA 3TCKA 3ZOKA 5CK5A 2JIOA 3EXG1 3TBKA 4P7JA 4AJ4A 3I5UA 1AZLA 4JFAA 4NHOA 4XWWA 1B8VA 5D1OB 1R0LA 1Q6ZA 5DBHX 5G0WA 4WCDA 1HM5A 4RTOA 3IJRA 3KKZA 3JU3A 2BTQB 4BMDA 4A10A 3LHKA 3ODPA 3LKDA 1VPWA 4L6IA 1HMYA 1UOQA 3UKOA 5IKPA 3VZDA 1JBKA 4G36A 3DE5X 8MHTA 1C41A 2C77A 3GLGA 1E4OA 4D9BA 4K0RA 4L7QA 1X7HA 4QLOA 1ZRHA 1YC5A 1XVTA 3KJIA 1XD2A 1G20E 3E35A 3AY7A 4LDPA 5FUVA 2R96A 5C46F 1WSBA 1JJVA 5ICSA 5GINE 1NN1A 2IBMA 3SY8A 4MDHA 1PGNA 3OQNA 2JDIA 5H16A 4MW2A 5C8YF 1KY3A 1SG6A 1YUMA 4IHKA 4AICA 2OCDA 4M0KA 2A5FA 4J9UE 1BXGB 4I5FA 4NMLA 1N7IA 1CQJA 2IYSA 1WKCA 1BW9B 4RH0A 1TYEB 1TZKA 3LP8A 3QJ5A 4KQ1A 1VOTA 4HLDA 4NJEA 4UE2A 3AI2A 3DR3A 4D96A 5LR6A 3R44A 3ZY4A 4GBJA 3ELBA 3F8TA 2VNIA 4MD8A 2X4LA 3B8EA 3OZDA 2NXJA 4EB8A 2O7RA 3V4FA 4LMBA 4EVIA 4CCSA 3VVBA 3I76A 1EZZA 3R2JA 4IJ6A 5LQUA 1RI4A 3HB9A 3OBIA 4LGVA 4XUGB 4IXNA 4RESA 2C54A 3HO6A 1ZA2A 1E66A 1RWWA 2RB4A 3PV0A 1B00A 2AFHE 3L7CA 4LJ4A 4XI9A 5AJVB 1PV2A 2ALJA 5FOWA 3R9IA 4XUEA 1AUXA 4KOAA 2Z2JA 4XDHA 4A2WA 3JQ8B 1KRWA 3V2IA 3DDZX 2BCGY 3JQ9A 2ZM5A 4C08A 5JQGA 4YQFA 1N3YA 1M10A 3HOYI 5HKLA 1LK0A 3P45A 4J3FA 2PZKA 2Z9BA 3H3FA 4MGIR 2R6HA 4O2AF 2AC7A 2JLCA 2VZEA 3GJ8A 4NAUA 1ZM4A 5KCMA 1J25A 1OBHA 3FNBA 4FGJA 4KBFA 1F14A 5D87A 3CF0A 5E4YA 5B2ZA 5FCDA 1UZUA 3C5VA 4EGJA 3S1QI 2OHXA 5KTSA 1U5CA 4QFCA 4EFMA 3NRCA 4BMSA 5PNTA 2JI6A 3FX2A 2JBHA 2UYGA 3W5IA 4D3YA 3WMRA 1J99A 2GBPA 5C7LO 1DZ3A 4C4SA 5A06A 1YQDA 4OK3A 1Z5WA 3ROMA 4HEHA 4IUBS 4OUDB 2OTJZ 2X86A 5FR2A 3SOZA 2X0JA 2KMLA 4MWZA 3T5GA 3QBVA 4HV4A 2JLUA 4BLUA 3K92A 1GDTA 1A9RA 3CCJ1 1XLVA 2H3HA 3G2KA 1OB2A 2XD4A 3K09A 3ZJUA 2MYNA 3RS0A 1UDCA 4J3NA 3MCAA 2VJKA 2J07A 5JT1A 2W37A 4ZGGA 4O63O 1JTVA 1DXQA 2WK1A 3LF2A 2PWZA 5H82A 4BFYA 1LU9A 2CCJA 2HU2A 4HAOA 2ZAIA 4JJGA 3CB2A 4Z1OA 4RTKA 4YK7A 1I4TD 1EP2B 1MH9A 1UEIA 3CZ4A 3A6DA 3PEYA 1DG9A 2GETA 4MV5A 5TMBA 5EMMA 3W6ZA 3I9LA 2A92A 4JYCA 1V1MB 5BNTA 4RJ2A 5KOHB 2GQ0A 4M1KA 3SG0A 4X66B 2DPMA 2O8VA 5BN3A 1KYYA 4H4EA 1BXZA 5EP3A 5LBTA 1BX1A 1XGKA 3D6HA 4D3FA 2XXAB 4CIDA 1TCUA 4PAGA 2DG2A 4MV1A 5IN4A 3QVOA 1CQWA 3C3AA 2QAGB 1FMLA 4KIFA 4AJOA 1A7UA 3MWKA 1JA0A 4G63A 4MW0A 2QEX1 3G0CA 1FDOA 5FLMI 2H1LA 1QB7A 1AMNA 4JYBA 2PLAA 1Q14A 1CF9A 2BOVA 1I3QI 2PNFA 3GAFA 1IZ7A 2ZCVA 3HPRA 4LBZA 1AD2A 3DZJA 3RNOA 3ZE6A 4KHPB 2HSGA 1E2DA 1I3KA 1N2BA 1NVBA 4LK3A 3OIUA 3TSZA 4BJ5A 5K8TA 1DXYA 1GGVA 4MHSA 5A5DA 3GJ3A 1HBJA 4HQ0A 1LQ2A 1JEJA 1T1IA 1YIOA 2ZKLA 3H16A 4MQ4A 4GWGA 3NALA 2F43A 4PSCA 4WOBA 1E1LA 2HKIA 2X9NA 4MI3A 4YMSA 1DKPA 4I36A 5FUXA 1ES9A 1N8SA 3LJKA 3PGVA 4B7CA 1T8RA 4LWQA 4CLDA 2QG4A 3O2NA 4FMDB 4HNHA 4P98A 2SCUB 2UXCB 2WZBA 2B83A 4MRVA 2IYXA 1H0KA 3MGKA 4IQ8A 3JVEA 4OLBA 3IVAA 4MEAA 1NRXA 3CC71 1M6VB 4IRMA 2R97A 2AFHB 2QLLA 4FVTA 5B1YA 2JA6I 2WHPA 1ONNA 3Q8LA 1DKRA 2FOXA 3BK1A 4AVYA 1CVLA 3NHRA 3KL2A 3J80A 4FFOA 1WXXA 2E0IA 4TLAA 1MIOB 3EMBA 1KDVA 3OT5A 2O2YA 1NW7A 3HCOA 3NTUA 4DDUA 4J4HA 1QPBA 3PRYA 1MU0A 2FWIA 2R1ZA 2BW0A 5L7TA 3UGJA 4ZCQA 2RPRA 4U8GA 4LQCA 1QK4A 4TL6A 1GNTA 2HT1A 4JLWA 3B1VA 3WLRA 4FCTA 2IXDA 3NG1A 2JI7A 2MYPA 2FMIA 3IE2A 1Y1LA 3A32A 3SE0A 3LBNA 1ZD4A 2CLKB 2Y99A 3PF8A 3OIWA 4ZHQB 2XVAA 4H7KA 3AEUB 5K2OA 1H2FA 5JJIA 5DTIA 2XWSA 4PONA 4UARA 4A92A 2OENG 3K31A 1QDEA 2LRHA 1VYUA 3DTVB 3TQFA 2YWFA 4MS4B 5DW3A 2PPVA 1WXEA 3VQTA 1J8FA 3AL2A 3HVHA 3G0HA 1RWKA 3ODGA 1QVZA 1L5SA 2AFVA 2QENA 2GKSA 3FMGA 4FXOA 4M8IA 2BGLA 4N0DA 4B79A 1LB1B 1YI0A 5EHZA 1M0WA 4Q1CA 3D8SA 2ZUCA 1T9AA 1Y4ZA 1KZHA 3TRDA 4RTQA 4ZRNA 5HGJA 2OFFA 3RVBA 4HNRA 2IZ6A 4DQDA 4MQ6A 3DDWA 5JJBA 5L8VA 4J1NA 1GGNA 1E2QA 2GK4A 4K28A 4D98A 1R74A 4QAJA 4MV0A 1T9DA 4PE5B 4TZKA 2SKCA 3EVDA 3DZKA 1U0BB 4L9RA 4QPDA 2CD7A 2OYRA 4QM7A 2BM0A 3DZFA 3H4TA 1XTVA 2WUVA 2ANBA 4C7VA 5ERXA 1OH6A 1QO7A 3AB7A 4A3GI 2HJGA 5K0FA 3SWWA 2F62A 1V9CA 3ABSB 3W2EA 1O94D 4BRUA 3N9IA 4JR0A 4JU8A 1SA0A 2G7MC 4JLSA 4EFNA 4DJFC 3FPSA 1J39A 4LOLA 3BXPA 1JLKA 2Q0SA 2Z83A 2C1ZA 4QQFA 3N0WA 3LQYA 4E5DA 1ISJA 1V37A 5BV7A 2FP3A 4D9NA 3GDFA 1CFJA 1E60A 5BMOA 1IN8A 2NXEA 3QU2A 4Y0NA 1DIOB 3BD7A 4J90A 5BYAA 2HNAA 1E1DA 2CLCX 1N34B 2HWXA 4O1MA 2A35A 4DV6B 2PZGA 3EGWA 4FFNA 4ZVRA 3RFCA 4L74A 4Q48A 1FQOA 1F48A 3L8DA 1E3IA 4FLFA 1D2CA 3SHFA 2Q3DA 2ZS8A 5F77A 1JE0A 3HUUA 4CDNA 3A6PC 1UOPA 2XUFA 4UE6A 2XGMA 4A0SA 4CR8A 2R86A 1M1XB 2Q0XA 2XUZA 3UC9A 5FUMA 5KOIA 3VU8A 3DVSX 2WIFA 1PKEA 1BQ4A 3SIPA 1KEUA 3MOIA 4DA9A 3TVDA 2ACKA 5DHAA 1EDZA 1ZPDA 1L7RA 5FTLA 1Z68A 4EQZA 1TADA 2IK8A 1ZONA 3INTA 3LMKA 1VG8A 3M1LA 4DBVO 1DTWA 4EHDA 1B7GO 3ADCA 1JAZA 4OGLA 2G7ZA 4F11A 1P33A 1ZOIA 1T3ZA 1XMVA 1XZLA 5CA0A 1Y89A 1EGHA 1UMDA 1TQHA 1Q7EA 3EZNA 1V16B 5AXDA 2ZCJA 4Q3LA 3M9LA 2E37A 3GNQA 3L7IA 3HGQA 5MGBA 3K70B 4J0DA 3PQ8A 3H3VJ 2FCRA 4PPFA 2YXEA 2VSYA 2Q51A 3UMRA 1CYEA 4YWHA 4KR3A 3KOOA 3L7AA 1AUVA 4R9NA 1Y3FE 2FPWA 3CME1 2RHMA 1II8B 2DLDA 5DLEA 2ERCA 3O2QB 3JQ6A 2OLJA 5DEIA 5AVXA 4RGQA 2ZWMA 3BJEA 3X1XA 2G5PA 4PO8A 4NMXB 3VJMA 3UJNA 1ZK0A 3GI1A 1MAVA 2GARA 1QUFA 3CURA 5D6NA 5E7QA 4BKRA 2MIIA 4JZYA 2ORVA 2LP4Y 5DZSA 3MK31 3FCXA 1RPNA 2Z8YM 1G8FA 3HU5A 1GZHB 1XHEA 4OHKA 1HOXA 1YZYA 2J5KA 4L6AA 2ZDGA 3P5SA 3G6E1 2JJ1D 1QOQB 2AWOA 1W0JD 1Z8HA 1SKYB 1U3VA 3DP9A 5J5CA 4PGAA 1OIVA 4JEUA 3KX2A 4GRAA 3SIXA 1H42A 2N47A 4WGGA 2J5BA 4HQKA 3FWNA 1S8OA 3ESRA 3OX4A 2V7QD 4KO1S 3RH0A 1OU0A 4G85A 3EZ7A 5SICE 1ANKA 4YALA 5HIMA 3HXMA 5IJ9A 3RK1A 1X7XB 1E94E 3VA7A 4B4WA 1YQTA 2N42A 2QRLA 3LAWA 4HNGA 3K9BA 4MLDA 3RAPR 4B7UA 3O2JA 3MJVA 4YJGA 2CMDA 2QN7A 1U2QA 1NXSA 2DFDA 4RF3A 4FMDF 3UV3A 4D4MA 3EOAI 1CY2A 4MDYA 4LVNA 3WNQA 4NCKA 1USVA 2OHFA 3AKCA 1H2YA 3EZYA 4M53A 4QSHA 1NBAA 2AK3A 4EMTA 1NW8A 5DXFA 3QW4B 4KXXA 4BQNA 3ELWA 5AOBA 4DC9A 2VDPB 1QRUA 2JFBA 3D2BA 1RFGE 4IH1A 3ZHTA 4DA0A 2XUGA 6NULA 4OU4A 1PZXA 1XMIA 1EFUA 2UZIR 3N75A 5D86A 3GTGI 5DT9A 3EJ6A 2VUMI 4NVRA 1N5OX 2BHLA 2HJWA 4KN9S 3AHGA 2V8JA 5CK4A 4C0KA 4MQEB 1FW6A 4FW8A 3A4VA 4I99A 4KU4A 3GQVA 2VXOA 5KTTA 2FUKA 3OKAA 5BSUA 1M33A 5KHAA 1F2UA 3CG4A 5BOVA 1W87A 1AUOA 1VMKA 3IT1A 1JG1A 1QX4A 1YBMA 4Q3BA 2G88A 4DJJA 5JCOA 4ILKA 2ZJ1A 1O95D 1RXCA 2CHUA 2QSJA 1ATZA 5L6LB 3RSSA 1KQSZ 2BI7A 1F7VA 3AP3A 1NI4B 3P2IA 1YIAA 4TV8A 3FFBA 1HDIA 4AJKA 4PLPA 2CDNA 4JI0B 5LBIA 2WYWA 4NU5A 4RXMA 3OOWA 1LA2A 3WZMA 1IFXA 4JDPA 4P3KA 5MN5A 3GJSA 2GH1A 2HDNB 3OURA 2PZFA 3WFJA 4DM4A 2QX4A 4JJ6A 3I2KA 3PITA 3G02A 3JD2A 1QP7A 2RAPA 1WUKS 2Q3LA 1TNDA 4PZEA 1ZSNA 4HDCA 2JLSA 3GGDA 1UP6A 2JLBA 3QOYA 4GOOD 5DHTA 2DFTA 5EE5B 1G21A 2Q6TA 1H1DA 2C9CA 1BTOA 2ZSKA 1KZ9A 2IVZA 3BULA 3PXEA 1C9YA 4FDLA 4J1TC 2J9FA 4GGOA 1KRHA 2A8YA 2X3YA 2B8NA 3LDFA 5HWSA 3R5XA 3UWMA 3PPYA 4YJDA 1L5WA 4LISA 5KYWB 3TPCA 2KPOA 1PVOA 1XQVA 4PRLA 4RK1A 4F8JA 2R44A 4WJZA 2WR8A 3DT9A 4L95C 5CFPA 5C1OA 1VHQA 2BGJA 1HG0A 2V6JA 3S1NI 3PVZA 5FTWA 3E2IA 3C7CB 1H05A 4GWKA 3MZ0A 1EFRD 2NUTA 3ZWYA 5AUPB 1FL9A 3LVFO 4JBXA 4WX2B 3GLFE 1C1XB 3AEQB 1M2NA 3B2NA 3EGXB 3ZQUA 4D6XA 2XZDA 1TEHA 3JQ9C 3WV4A 4HPJB 4PFQA 1X8LA 2GX6A 4G4IA 1Q95A 3DBRB 2PE5A 4EPWA 1MNQA 1WAMA 2ATXA 5KNBA 1P17A 4FBGA 2ZUFA 1RC8A 2AI2A 2XCUA 1AK2A 4HH3C 4JS0A 5A4JA 1LX7A 2QM0A 1J4AA 4R40A 5CXXA 5FOUA 4DUGA 1NUUA 1OYWA 1N57A 2MSWA 4EJSA 2BTOA 1YZLA 2M9MA 3IQEA 3FJYA 3RVSA 2P30A 1I01A 4HDSA 4TVKA 3WXMA 4DHWA 2VZ0A 4LJ8A 1GV1A 2V65A 3DW1X 1NDHA 1ADYA 1Q5PA 1Q19A 2YQ4A 4ZHSA 5JZSA 2IUEA 2CNDA 3NTOA 3U4IA 1MT3A 2Q2QA 4I4TA 3UKJA 3VO1A 3OF5A 1ZGZA 1D9XA 4D8TA 3OFNA 4O4IB 3HCCA 3VZCA 5JYBA 3L40A 4KVGA 4J2TA 3H8SA 3QFCA 1PG2A 5EEHA 3RVKA 2ZJFA 1KQOA 2V1UA 1QTQA 1QVWA 4NJMA 1VCNA 2GCIA 2Q5JA 4BNDA 3ZDZB 2AMYA 1POWA 4K05A 1DEOA 5EFZA 2X1VA 5FL7D 5A4IS 5AD1A 3THYA 4ER5A 1QYCA 4M0UA 5CVEA 5IP5A 3UWOA 3AI1A 3CFYA 4HRAA 2GHQA 1BQEA 2IELA 2ZRJA 3OCXA 2CSUA 3AMVA 4HNTA 4W5JA 2ZQYA 7REQB 5LLDA 1J2RA 2HA3A 3QH4A 4CTKA 3M4XA 4IIYA 1JSCA 3SD7A 3O94A 1VQL1 1FDUA 1S1MA 3E22A 1T3HA 3KP1A 4W5OA 1PDWA 5JPCA 5AJWA 1K08A 3U19A 5IU6A 1VKNA 1G5IA 4RY8A 3P9XA 2XEDA 5ESRA 5KNLA 5JR3A 3IJPA 3E3NA 2QI9C 4GPAA 4JB2A 1PQUA 4R9RA 5CVDA 3FUUA 3WNZA 2Q5CA 4DLLA 4XIJA 4ZCLA 5HBGA 2YVQA 1ORWA 4DLSA 1XCJA 1CDZA 1A71A 3I6ZA 1JFVA 4CPDA 3IIMA 1P2BA 1SEVA 1C80A 3HHEA 3DFKA 2GLUA 5IUNC 3OZWA 1CDEA 5FHQA 4X20B 1KU6A 3CX3A 3STVA 2HF7A 3WYEA 1ND6A 5JXHA 1FFBA 2IY9A 3Q7QA 2NN3C 5BO5A 4WK4B 4D41A 2AJCA 1ECGA 5F5NA 2JIRA 8ATCA 3L7KA 3UB4A 3E3MA 1V3QE 1JJAA 1A5AB 2HZBA 1FP7A 5K6AC 2H1FA 5A9SA 5JFTA 1ZEJA 2BFFB 4HDQB 5ETJA 1CUAA 2GEKA 3H5AA 2CHQA 1YRQA 2UXDB 1VBKA 5A02A 3GTPI 2VAWA 4DMHA 4GX5A 4TTTS 1ZIDA 2WWWA 3MWGA 5HTOA 2XWPA 1JALA 2H18A 4JLUA 2IE8A 5K3FA 4DMLA 2WC1A 2B4TO 5J43A 1DBWA 1S721 4QHSA 5IX8A 5LNK1 1LJLA 1W52X 2XVZA 2Z43A 4DWJA 2HDWA 5DBEX 1Y33E 1T9BA 4NU0A 4P3PA 5EIWA 3KUUA 5IJ0B 5DNYB 1ZD9A 3U0VA 2P6NA 3O91A 3VSBA 4BLPA 1UK6A 1F2UB 2FGJA 3VKVA 2HW8A 3AF5A 3CUSA 2EP5A 4NFYA 4RL6A 1C0IA 3QKWA 4FNMA 2O7NA 1O89A 4AZTA 1VL5A 2OZKA 2XMDA 5EJ6A 4GVPA 2V7GA 3CLSD 4PRZA 4EKIA 4ND3A 2O7QA 4B5KA 3RVLA 1NVMB 1RIIA 3N6VA 2VYVD 3FKSD 2GVNA 4FSXA 2NU9B 3VSDA 3GRCA 4F96A 3U16A 4U7HA 4L2IA 3QMVA 4AUMA 1RXUA 3COJA 7MHTA 1NSYA 1O9HA 2QZJA 4HNSA 4Y2TA 4HVLA 4KAJA 4RZSA 1YFKA 1Q0UA 1XLTC 2IIVA 4WKGA 4F3KA 5DM1A 1SCJA 3I9JA 1TRKA 4JEHA 3RIYA 5L3ZA 2Q9UA 3CCU1 3OQ1A 1SG9A 3WSWA 1KFBB 1G59A 2IV7A 5JH7A 1AUQA 1OWPA 2A59A 3IDZA 1LF5A 3I42A 3ZCPA 1M1NB 2XB2A 4AUKA 2VKTA 1T10A 1YCHA 2O9JA 5K8JB 1V1RA 4UBNA 1MVOA 4BECA 2F6RA 4ZOEA 3EAGA 2R6JA 3QY9A 4Z4QA 1AGXA 3LFHA 2ODEA 4N4AA 4YRCA 4BO1A 1SR8A 3L6CA 3OETA 5E0OA 4F6CA 4P83A 2EVWX 3KOWA 4CFSA 1IATA 3D0OA 2A78A 2F17A 2GVZC 1GA4A 4M0PA 2QMYA 4A73A 4Z4FA 2P69A 1T2EA 2XW6A 3GUHA 1E20A 4IZ6A 2ZIZA 2VJDA 2D1SA 3UMJA 2W58A 3PS9A 2VDJA 5HQ3A 2QT1A 4CEHB 1CUCA 3HC7A 2F8TA 1Q1NA 4HMPA 2HJVA 5IULC 2P9YA 1V8DA 1NJI2 4NJEB 5BW5A 1YJCA 2AMFA 2J0EA 2RI6A 3LUBA 3IAUA 3K5WA 2RGNA 2UZ3A 2ZUSA 2H7YA 721PA 1P1CA 1G6Q1 2Q99A 3P27A 2E2II 3R7WB 2QW8A 2BM1A 4GR9A 4F84A 3G88A 1S8FA 2IYWA 2FW9A 4TWIA 3H1PA 1Z82A 3ZYCA 1CUSA 1ZK3A 5KWJA 1Z4PX 1ODSA 2XQKA 4FZRA 1KO1A 2ZZMA 4R8RA 1ZVMA 1Y5NA 1XD2B 1G66A 4YGXB 3C6BA 2JCXA 4X7PA 1H3EA 2V7VA 4BQIA 2YW9A 4DV2B 4C6SA 2KI5A 2FZGA 1QZZA 1K75A 3AZQA 1Z7GA 2P35A 2H07A 3Q2IA 1A9TA 1XKXA 3FIJA 3DWFA 3NT4A 1NBWB 1E8MA 4RD0A 1M83A 3O38A 4GEGA 3U4AA 5IW8A 1DJQA 2A58A 2VPQA 4ASUA 2C7QA 2PS0A 1PR1A 1C7JA 2JLRA 2EBUA 2NVOA 2VDWB 2Y0PA 3E05A 3OIVA 2FSPA 4GVXA 4OHVA 2B6NA 1CBUA 3U50C 3C8DA 3M6IA 2WJIA 4RVUA 1QQ7A 1G8HA 2FPGA 5FPPA 3ICOA 3ZHXA 2MSNA 4GNRA 4PCLA 2BJOA 3IUQA 1XRRA 4LHYA 3JCZA 1M5TA 1TZ2A 1WL8A 4NL4H 4REQA 3VU9A 3V80A 1YQXA 3H1EA 1X3SA 3MD9A 2ZYAA 4GKVA 5TT1A 4JXXA 3DCJA 2GHTA 5I51A 2DBRA 2IW1A 2OAEA 2CDCA 5HIJA 5HF5A 3ZWNA 4B81A 1I33A 2PJZA 4DL9A 3SJBA 4KRGA 5AVJA 1CEEA 2XYVA 2HWUA 1F8GA 4C3UA 1NPTO 3OAAA 4JBWA 1UQTA 1B93A 4ZDJA 4LY9A 3MWEA 1MLDA 2YHIB 3H5WA 1M73E 5IF3A 3QY0A 1BHQ1 1DC3A 2JEZA 2KYRA 3PVCA 4Y67A 5ADVA 4NP6A 5AOVA 1Q7RA 2E3JA 4M37A 4H1TA 4NYJQ 1XTIA 4U39A 2FSUA 3KZKA 4DMKA 2OG1A 4MXDA 2VCHA 4F3NA 3EOBI 1XL0A 4MQEA 2Z56A 3SQWA 2F3SA 3W04A 1VL6A 3GJ0A 5DIZA 2EP8A 3IBTA 2POQX 5FBZA 4DCNA 5COBA 1TAHA 5CD9A 3HXKA 5H70A 1EA5A 4GO1A 4H7HA 3GZJA 2ZT5A 4NX2A 4DLRA 3L04A 4X7BA 1HSOA 4MLCA 4YO8A 3AH8A 5JRZA 4B3FX 5I9SA 3CKKA 3Q5DA 4DV4B 1L9KA 3I61A 3RAGA 5B7GA 4EW6A 3UPTA 3GRRA 2P90A 1E61A 1W1WA 1OUMA 4MQUA 4L5AA 1K1EA 3C3WA 4YRKA 5FWYA 3X44A 3FXAA 4YI5A 3ADOA 2PFGA 1ZM7A 3Q8WA 4EO9A 2EX0A 4KO8A 4ML3A 1GYPA 4BJHB 1ZOOA 4V1CA 5F33A 2ZSFA 4IIDA 3SC3A 1FTSA 3GOQA 4ZALA 5F7JA 3OU2A 1NQOA 2Q1UA 2D2IA 4NBRA 1GCGA 4EK9A 3D7NA 3DV0B 4ZZ3A 1X7ZB 2XUDA 1DFHA 3QIAA 2FEWB 4I55F 4BEBA 5ISMA 2C00A 1O1YA 3A3YA 5DNAA 3RRBA 1TJ5A 1SXJC 1I4LD 1O5OA 3BMOB 2CK3A 1UXGA 2IZ5A 4QLAA 1M3SA 1GKYA 4MVJE 3ZN2A 3C4JA 3G13A 3GTQI 5FTJA 1SVNA 3HKDB 3DBHB 1LDNA 4AG6A 3AVQA 4J16C 5BWNA 5JO0A 3T1HB 4FUQA 2PX2A 4OF4A 4N7RA 1U28C 1EXNA 3O5AA 1PS8A 1U7ZA 3QKSA 3MNFA 3L77A 4UNQA 5DLPA 1BCRA 1CJTC 4CFZA 4LJRA 2AA3A 1KEKA 2B0JA 5E6SB 2PUHA 3A25A 2VHUA 2IOFK 2D8MA 2QM7A 1TWAI 3W1VA 1XIVA 4JSYA 2WKPA 5AK3A 3U4HA 3TZBA 5BN4A 4ZDKA 1IB6A 5FUWA 2QD5A 2FZEA 2JH8A 4BGUA 5DP1A 5F76A 1P4GA 4C7KA 1WD5A 1MIOA 2JIPA 2BBSA 3AP2A 3MT0A 1SVWA 3VTAA 3BRSA 1WCMI 2EYUA 1SZPA 4H35A 4Y0AA 3BCUA 3O7MA 2HF1A 2NMVA 1NRWA 3PZRA 4QNNA 1A72A 2D8AA 3G9XA 4JENA 3FKQA 4TV8F 4W9RA 4C0LA 5GONB 1IUKA 1RJ9A 2PS9A 1O95C 2AEMA 2RBKA 3RANA 1JQ3A 2V7BA 4HWTA 1RQNA 2FXVA 3JSAA 4K8RB 3WX0A 2GJ4A 4H7IA 1SBZA 5IDVA 2PO7A 1UKBA 4HDRA 1X19A 3BBLA 2H2AA 3DLAA 5I7WA 1HXHA 4FN4A 4Z0NA 1JX6A 4O4JA 1L8QA 2AQ8A 2AX3A 4Q1BA 4QYTA 4XEUA 1NLYA 4UAUA 1KY5A 3GBVA 1P18A 1TAQA 3PO2I 1I1NA 3OECA 4HOYA 3ZDCA 5EYPB 5AW9A 3PUXA 1EX7A 4B3JA 1DJPA 1NVTA 2H1OA 4NBDA 1KMQA 2A1UA 2QRHA 1B41A 3GPDG 5AVWA 1KDRA 2R4TA 1T26A 4HNQA 4X7MA 2XNDA 3LWDA 4BO6A 4QPCA 4RQTA 1ZHFA 3I37X 3QPUA 3Q40A 4KJXA 2O20A 3NBZC 5IVIA 4U0KA 3WY9A 3U6BA 3IXMA 1SIOA 3BKWA 4KB5A 4BNVA 1JA1A 2H29A 1JHXA 2GBIA 3DL7A 3OJFA 3ZNNA 3HZRA 2ST1A 4ZI3A 1K2VN 1Q822 1CR6A 2ONJA 4RMNA 1NW9B 2G36A 3LL4A 4Q34A 1ESNA 1RLYA 1X7GA 4ATNA 5AKGA 1QVFZ 2M48A 2TSYB 4EF5A 4MW1A 4WIAA 4B6FA 3HADA 1IN5A 1BIFA 1VE7A 1UXKA 3UJHA 3U4MA 1U2PA 2WTBA 2C2HA 3KKQA 3O4VA 3PNBA 4JB3A 4UU1A 3U3ZA 3WGOA 7ABPA 4UNPA 3R6WA 5TGTA 3VX4A 2IY7A 1ODCA 2HFJA 3FLMA 2QAGC 4H27A 1XTZA 4JOSA 4KLAA 1GG8A 4GOKA 1XZKA 4JODA 3M3PA 4FZ3A 1RRGA 1W34A 1WHSA 4GQBA 1JQEA 1CQPA 2B36A 3MSXA 3PFIA 4OGKA 4Z4HA 3QITA 821PA 4A6PA 4LI0A 4Q9NA 5LD2C 3W3AH 2HRBA 3H2ZA 3BGSA 3TQSA 3GVCA 2YVLA 1WMSA 3VZPA 4EJ0A 4FYJA 2XADA 3F3MA 2QN1A 4LGMA 1PT7A 2V5UA 2ZRMA 3CEPB 2ZVJA 3TL6A 1ONPA 1KI6B 3PUZA 1XBTA 1T5IA 3JR3A 3QRWA 4GOND 2NU8A 4BNDB 1HTBA 1O6FA 1NNI1 1YWGO 2XSZA 4YRIA 1TYZA 4KXLA 1U2TA 1K5GA 1IN4A 2J41A 4K9SA 1ZM9A 1C0EA 4Q7MB 1SIWA 3VGPA 3F3SA 1H69A 3JWGA 1U7WA 5H83A 5K7SA 5M2QA 2C2YA 4AKHA 1MDFA 1FDWA 1V2GA 1ADJA 2NNLD 2REXB 3CMCO 3TOZA 2RHOA 3L8CA 3R5SA 5CX1B 5BT9A 4BLQA 1IPHA 1REQB 1SU4A 2YS6A 4RTLA 3I9V1 3IAS1 3WLTA 3WA6A 3C0KA 1F5NA 4UATA 3VH4A 1DAGA 4ZT6A 4RENA 4NMHA 5C4MA 3UY4A 3DMDA 4FR5A 4ZIRA 2WP0A 4GW3A 4L4XA 4GI2A 4ND7A 5L7YA 3VPCA 2AI3A 1MTZA 3FHCB 4NAHA 3FYUB 3A9UA 3IQXA 2Q1TA 1NI3A 1VJ1A 3EF1A 1CULC 2D4HA 2JIZA 3EYWA 2YOFA 3EDQA 1DB3A 1L5HB 4YAEA 1RRPA 2Z8YA 4G1CA 5TQVA 4TXJA 3AL0C 1CUXA 3ITNA 2Z6UA 1EIWA 4QASA 1IZZA 3GEGA 3P2EA 4MS3B 4LV6A 1E9AA 1JTFA 1AN0A 1B2LA 4OI2A 3MW8A 3P4UA 4N3AA 1XCLA 3LK6A 2KJQA 4LOKA 3OOEA 2GTPA 5CVUA 5BSFA 2J09A 2D7CA 1IPFA 1LZKA 2O2JA 1E1MA 2PGOA 3AU8A 3Q88A 4YJKA 2VF7A 4IQFA 4BZPA 4NABA 3IT3A 3EARA 3EC1A 3V1NA 3LRXA 1QTIA 2I2XB 4NICA 1FJXA 3RYCB 4EHBA 3TMYA 4LF8B 3WGVA 1SHUX 3D0KA 5BN1A 3OZBA 3HOUI 4EUNA 2IWRA 1G0NA 2VRWA 5JISA 5B6JA 3PICA 4WY2A 5LA6A 2WRZA 1M6YA 1R5BA 5HR5A 2XT9A 2BR3A 3AINA 3SX2A 2A0YA 5A03A 1KD12 2ENUA 2W4IA 2Y05A 2XMSA 3FR8A 1FFWA 5BWLA 1AKRA 4PSAA 3TFQA 1HNXB 5EJGA 4YAUA 4JY7A 3NAZA 3TRKA 3HCWA 5KNBH 2PKRA 1GL9B 1FSFA 4FEYA 4PHGA 4B5LA 4LNUA 1XHLA 4D3SA 2BUBA 3DUFB 4CCWA 5KVVA 5LYJA 1K4YA 2PKWA 3L5KA 4PEVA 3AHCA 1L7NA 1FNDA 1QYIA 1W73A 3ETGA 3G0BA 3KTAA 4H0FA 2QGNA 1J33A 1XVAA 1BDMA 1N2FA 3D0QA 16PKA 3KVOA 4U00A 3SSAA 1K732 1NV9A 1FFGA 1GGJA 1GDHA 3M1YA 1FFXA 3PDIA 1IG0A 4LJ9A 2ILTA 4GPBA 4H2DA 1YRLA 1XVVA 2ZJAA 2OXRA 2J67A 2ACWA 2B4QA 3NLLA 1ZI8A 5U1PA 5KNCH 2VP6A 3LGXA 1PHRA 4UUPA 1HSZA 1P1KA 3ZE9A 4NCXA 2BM8A 3HXQA 4EYSA 1XFAA 4AYWA 3VRHA 5AI0A 4D92A 2GB4A 1G42A 5CR9A 4BN0A 4BTLA 1Z35A 4UZSA 3N0TA 1Y9DA 1Y1RA 4CM4B 5I5GA 1M2JA 4OIFA 1Z5NA 2DAPA 3L9WA 4PZLA 3RWBA 1QK5A 4KW7A 4CL2A 2OBFA 2V6IA 2FHSA 1GSIA 5LNK6 4HUQB 2YMPA 3WKCA 1KERA 3IPCA 2R60A 1VQ9Z 1WPGA 2F90A 3CRRA 2PJDA 3E8MA 1P9WA 3P9RA 4UREA 1D03A 1I10A 4QWWA 4AZSA 3E7FA 3W5SA 3BQMB 4O4IA 4FFPA 3EFBA 4PX2A 2J7KA 4CUJA 3IF8A 1UBRS 1Y1TA 4US1R 3RFVA 4GICA 4JDUA 2QD4A 3WB9A 2Y1OA 4AM8A 3EVEA 2GDZA 2WHXA 3A9CA 4U4AA 3D4LA 5DYNA 3I5YA 5B53A 4RJLA 5HZHA 3G1UA 1RD4A 3HFGA 1IWPB 1XTBA 2JK0A 2VYCA 3PD1A 1IJFA 3HR8A 3QKTA 4DSUA 3S70A 5LXTF 5HCUA 3WWZA 2D54A 1RHQA 4DJDC 5ANRB 2HBYA 1U2DA 1CUJA 4F21A 4JOCA 4E33A 3PSHA 4BAGA 3VKWA 4BVBA 1QFMA 1U4OA 4YCCA 2ADMA 1RW4A 2HMUA 4J0CA 4HQNA 4KXYA 2CV2A 2FG6C 1H0RA 2AFIB 2XYHA 1VQ61 2COUA 2X7XA 5FNVF 4YRBA 1LY1A 1M8KA 1ZH4A 5I7FA 4Q12A 1ID1A 4Z4EA 1RWQA 1IOVA 2OD7A 3I01A 1PLJA 2KSQA 3RIEA 1YS6A 1T4CB 2A5GA 1D2EA 4QVIA 5EE1A 4EJSC 2C61A 2H1CA 2Q27A 2GCPA 3NANA 2YN0A 3BEDA 3QHAA 1GAQA 1M74A 1FP2A 3HHPA 4QJ4A 4RZXA 1GZ5A 2QQGA 3K20A 1H22A 4H17A 2DUMA 5KTOA 1RHUA 4D57A 5DJ5A 2IYPA 3JPWA 4FIZA 1EVJA 4AMVA 3KT8A 4RFSA 5LZ4A 2HREA 3LGAA 3SMQA 4CDRA 4F92B 4HUJA 3A58B 3ZBPA 4N47A 4YROA 1EFTA 2G80A 3F4LA 4EKYA 2IH2A 2FMKA 1U8AA 2G9UA 1YDHA 1J8VA 2PYDA 2MINA 2YASA 3IP6A 4LAFA 4RQUA 4YS6A 3RTAA 3SSMA 2CWWA 3Q8MA 2PV0A 2WDPA 4NZPA 3T1VA 5G40A 1T1RA 2ARKA 1H9CA 4QECA 3H9QA 3MVEA 1FYDA 1XQ1A 4QGGA 4IS2A 2XMZA 4XX2A 4HEA6 2O05A 1QAOA 1TO2E 4AKTA 1VL0A 4CKEB 2J4FA 4A2CA 3TJMA 1GZ6A 2FFJA 1SZJG 2W2TA 1CR1A 2WWXA 2ZE8A 1DAFA 3K6JA 2YHAA 4P34A 1WQ4A 1E6WA 1T5TA 2ZT6A 3B9QA 1VDZA 3V1TC 3GPIA 4AJ9A 2CGEA 1ZGBA 4CMEA 2IPAB 2ORIA 2R79A 3AUAA 4PHHA 4D2IA 1AXGA 2ZW9A 2JVKA 1WCXA 2XZLA 3EH1A 1WD7A 4DM3A 4KFSA 1PLKA 1Z0DA 2JFNA 4K6KA 4TSRA 3PVSA 3PZBA 4Q3AA 2BN4A 3Q7TA 4RPIA 4TS9A 4BN4A 5BPFA 3OQIB 2WE7A 3KDSE 1QDLB 3O4JA 3KJGA 4RHXA 4RE6A 4YRMA 3GP8A 5C8ZA 4CFYA 4O4IF 2CCKA 2RGAA 2QKDA 3E53A 4MYHA 4DCTA 1MPTA 1NBMA 3VYVA 3LCUA 4DQUA 2AF3C 3IOYA 3G79A 3RGWS 1K88A 5BOSA 5BNIA 4M55A 5H0IA 2J46A 1JG2A 3PWZA 3SHQA 4OXXA 3ZDXB 4ARIA 2GI4A 3T3OA 2WZCA 3UANA 1X1EA 3HCPA 1Z5OA 3S29A 4COOA 1Z0IA 2NAPA 4LRWA 4LRQA 3FCOA 1Z34A 4LYFA 4NPHA 1F1BA 3RDPA 4YJ2B 1IXYA 4GMDA 3GG2A 2BGWA 1C30B 4QNMA 1D9ZA 3V7FA 1RABA 5C2JB 4CQMA 3W5CA 2XMCA 3WIEA 4DB4A 3I09A 2OZEA 3LU1A 2LTAA 3QVGB 4LMAA 4L78A 3L82B 5H9WA 1P3Y1 2XXAA 2CNLA 1N8R2 3GT3A 1UBTS 1GPUA 3NP9A 3NYQA 4GYKA 3THSA 4DTIA 4B4VA 3T7DA 5FLXf 1B0ZA 1ZK2A 3I5MA 4OMDA 3WL3A 3PYMA 3LIPA 5L40A 3QPDA 2IYLD 1UOOA 1NWCA 1NZDA 2HQBA 2NG1A 3ETCA 3VKHA 5AHOA 3ZVRA 4W5RA 2BHTA 3DLCA 3AETA 4HAUA 1XJCA 1NOKA 3KLBA 3NJ8A 4M46A 4A3KI 1JS1X 1N6OA 1ZWLA 4ER7A 2Z2YA 1EK5A 4JITA 3WK8A 4BUZA 2AYYA 1PWEA 3HB5X 4LE1A 3PEVA 1KZ6A 3GCXA 2MCFA 3IFSA 1JEQA 1OWNA 4JGIA 3FYUA 4NZNA 5BT8A 4H6WA 1GITA 4R8LA 2ODTX 4TTPA 3PUKA 3K71B 2XYGA 3NHYA 2IV3A 3F5SA 1Z56C 3GP3A 4BYGA 3OE7D 1A77A 1ELOA 4DCVA 4XRGA 2C5HA 3CKYA 3PT9A 1Z0KA 2BFBB 4JYPA 1J1ZA 3TAXA 2AB0A 2IPXA 1YZGA 1XEFA 2AIRA 3CISA 4HB3A 5LP1A 4FOLA 5HFJA 3FTNA 3ISVA 3EQ9A 1DX6A 5F4BA 2J33A 3CCFA 4KVFA 1CJBA 4O02B 4C7XA 3SEZA 1TD1A 2PT9A 3CPSA 3CR8A 2Q4ZA 3LCJA 3NOQA 4RA9A 4ZYWA 2PUWA 1QCCA 2GAFA 2HD4A 1IK4A 1ZUNA 1LRJA 3MYYA 4F9FA 4D4JA 3WVNA 2EKPA 2ZXFA 1RAGA 3NDRA 2XZPA 2GPSA 3DYBA 4AJIA 1F6BA 4RK6A 5E9QA 4DMUB 3F1LA 4PS0A 2WWRA 1JFLA 1VBFA 1NBIA 4L5IA 1DOAA 4RTNA 2Q3FA 2UUAB 4TRRA 6AT1A 5IT9f 1WZUA 1ZUD1 1IQPA 1GHTA 1V3UA 4IKPA 5JZ9A 4Y6SA 1ZICA 3LZ6A 5BR1A 1PG5A 3LUGA 4JUCA 3U44B 2QV0A 1GV0A 1X13A 3H9EO 3ZXIA 1H3FA 3R77A 4YMUA 4MMYB 1U7UA 1XDUA 4PQEA 3TH5A 3VNRA 4EFKA 4W5NA 1PJ2A 5E8RA 3VDMA 2DCUA 4KRYA 2Q5HA 4F4JA 2CFRA 4NWIA 5SY6A 4LXHA 4BFWA 1C29B 3R6LA 5NULA 1KWKA 2VJCA 3E3AA 3S99A 3COWA 4A2PA 2ZE7A 4JX9A 4QPJC 4DOMA 1LWOA 3V33A 1XYYA 3QPVA 4C6RA 1P0MA 2TMKA 1L6RA 2PD3A 5CURA 2WU0A 4KQ6A 2PUJA 3T9BA 3JQGA 1UC9A 2W93A 4Q4HA 3RC3A 4JC0A 1NFQA 5KNDD 3IQWA 1CUYA 1EU1A 1NXQA 3BJMA 1L5MA 5JO9A 1E2LA 3I4CA 4AZVA 2ATCA 4HR7A 2MINB 3PJGA 1VPLA 5I9TA 3KOZA 5T3UA 4NF2A 1OW3B 4YRFA 2TYSB 3RS4A 1TJYA 5I3ZA 4TYNA 2UVPB 3A4TA 4KYIB 4EDFA 4EHHA 2DBQA 4GR4A 3CCS1 5IZCA 3D1JA 3JQCA 4KQEA 2HYIC 1ODKA 4DIMA 4XSVA 4RSHA 5A7FA 1XELA 1R4AA 3NOXA 3V4SA 3VPSA 3X1MA 3ZJ4A 2OM6A 3FWZA 1M1YB 1ZXXA 2DE5A 3FHOA 2UYCA 2O2GA 3WP1B 1R15A 2A33A 4ZK2A 1SVUA 4JI8B 1YZHA 1IIBA 2D3TA 1YTUA 1U3WA 3GLUA 3CC7Z 4IOJA 5SY4A 5IZCC 1B3RA 1EHCA 4X6YA 4D3XA 2X8JA 3M83A 2XNHA 2G4CA 2XV1A 3L0OA 2Q49A 2X41A 3NZEA 4FOOA 5DP2A 5KAPA 5TC4A 2I91A 2GA8A 1T2NA 5IDWA 3TW6A 4JIGA 2B7CA 3O21A 4HSEA 4KI0A 4NARA 5G4KA 2HHAA 5SYMA 1U9IC 3COSA 2FVXA 4X1KB 4B3RB 2AG5A 3QNMA 4FFSA 3ZHOA 2R4QA 4EI9A 2OV4A 4E5SA 2W8BB 1E3SA 2ZPUA 3KPJA 2PT5A 1VLQA 4WINA 2AG6A 5L45A 1R4ZA 3TOXA 4OI0A 4O2BF 1WABA 2H9IA 4MARA 2G83A 3E1SA 2QXYA 3O83A 4ZREA 3RRFA 3KYCA 1FMJA 2WILA 4RCVA 3LUCA 5AN9F 5ALDA 4WVLA 1YB4A 4AF6A 5F98A 2LXNA 2XKAA 3GCDA 3NHJA 2AXNA 2JIBA 2QXUA 4D4LA 1HE5A 1NAHA 3THXA 4TLEA 4IFTA 4DSOA 1J0EA 3DWEX 1GTSA 1HYEA 4TM7A 1RM5A 3BFXA 3ONDA 4JKYA 1NI4A 4JA0A 2F55A 5FBKA 1AXRA 4Q02A 4XXHA 4P93A 1J1IA 4N8SA 5BSMA 1E2PA 1WEHA 2P9ZA 1H2WA 4ZOAA 4P4NA 1C7RA 3SC2B 4XLTA 4BGEA 2RGXA 5FOSA 5CYOA 2CLSA 4NOKA </