2GTHA

Crystal structure of the wildtype mhv coronavirus non-structural protein nsp15
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
370
structure length
348
Chain Sequence
SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYFITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
molecule tags Viral protein
total genus 91
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gthA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gthA02
2H85A 4S1TA 2GTIA 2OZKA 2RHBA 4RS4A 2GTHA
chains in the Genus database with same CATH superfamily
3PEEA 1KYXA 2G82A 2QPOA 5DM1A 3OMLA 3AEQA 2ZI5A 1HQCA 1PT6A 1EG2A 3RC9A 2PZEA 3TLXA 2O2ZA 4MJLA 1N0WA 1SHKA 2ZZNA 1H65A 1JDNA 1GQYA 1IEWA 4KFRA 4O4IA 1Q15A 3AFNA 4JLOA 3HGMA 1BKSB 1DJNA 1ZIXA 4KQWA 1B8OA 3SX4A 3UY4A 5KYYA 4TMFA 2J3MA 1ZDMA 3M4JA 1FLAA 1T9DA 4PYNA 2GZRA 1BDJA 3NQ41 2D4AA 2XBUA 4UAVA 2VRNA 3H2KA 2F3TA 4DXAA 2NVXI 1PT5A 1CJVC 2W6CX 2B63I 2XCUA 2AE2A 3HJHA 4LJLA 4WGFA 3U0VA 4WUVA 2Z4TA 3UOAB 1A5AB 1CJKC 1KH3A 2JRLA 4NL4H 2PD6A 4QTTA 3EIUA 4L08A 1RKXA 3A6ZA 3FOWA 5DSXA 1OPXA 3ILXA 1I80A 2AI1A 4P82A 3ZCSA 2ES4A 1FX0A 1Z8FA 4I4TA 1KAGA 3MJTA 2VDQB 4E5UA 4ZCTA 3W8DA 4CU2A 5BN5A 3SOZA 4DCJA 3JATA 1UFQA 5B1DA 4L7QA 4PPYA 1GPH1 4ZT3A 3K9HA 3VVLA 3QVGB 3VNQA 1FRQA 3WAKA 2EFHB 4BNNA 1D1TA 2CJFA 3UWDA 2FMIA 1QWSA 2IVFA 1XCOA 3KHSA 5JSKA 5IMBA 3T12A 4V3CA 3VOAA 2KPIA 4RTQA 4RVOA 1GGKA 4W5WA 4TVSA 4I4LA 1QC5B 3DFKA 3SYNA 4OL0A 2PUCA 2BJHA 1YQXA 1KHHA 1H6AA 3AETA 4KLCA 4NZPA 1YV9A 3D6TB 5B2ZA 3BJZA 1NVVQ 1B0UA 3T9AA 3IOYA 4BIMA 2Q1WA 1BQ4A 1JLMA 1YDWA 2Q5LA 3CJQA 2C9YA 3TI7A 5LKRA 5LDHA 1C1XB 2IYSA 2ZYHA 4R5MA 1U65A 4ZOAA 1JPUA 2E4ZA 1QYVA 2XLBA 3W5UA 3W8RA 2WU1A 4O02B 4RHXA 4CV1A 1SZCA 4WXMA 1RWKA 2ZAIA 4ZVUA 1F7VA 3ZGYA 3LVRE 4YJFA 3NHMA 3VAAA 3BSYA 4KRFA 1Z4OA 4ESHA 5HBRA 1FXWF 4CEIA 1OGYA 1A2OA 1N77A 2ID9A 2HUPA 2X8BA 3GARA 2YJ3A 4FGJA 2XR1A 3DEFA 2BEUA 2VJNA 1XDSA 4GZMA 3GP8A 3RSQA 4Q1EA 4M0KA 4M9CA 1IY1A 3B1VA 4LS3A 1L5YA 2OZLB 3RQIA 3PXCX 1HT2E 4WERA 4OGWA 3LUFA 2NQ2C 4K2AA 3DZGA 1ZOOA 3AUUA 4JXZA 2YYAA 5JXHA 1VKRA 3OE7A 3ZUPA 1JA1A 3TKAA 4WY2A 5DKFA 4LI0A 4WZAE 4DMFA 4KNWA 4LYAA 4DKXA 3P0JA 5EESA 3T3PB 3ZWCA 3DB1A 2B7BA 5DM0A 2EBHX 5FUWA 4MNTA 4ECEA 1G7SA 5ALUA 5KNCH 3KB6A 4BMNA 1JDPA 3FJOA 1E2EA 2GEDA 2NZXA 3ZWKA 1I2DA 2I7DA 3EVAA 4QYMA 4CHGA 1P6XA 3RUAA 5LQNA 3HKEA 1O5OA 1B76A 3OE4A 2BL4A 5F9FA 3EQZA 4RXMA 3OEYA 4D9BA 1UKEA 4KFUA 2GPYA 3D3JA 4PSVA 1NW7A 5GV7A 1Y8ZA 3L0YA 3FLEA 1XJ0A 4MMXB 1QFMA 2ODBA 3KOXA 1F14A 1FDUA 6LDHA 1FNCA 2FFAA 2J07A 2MYUA 4DUPA 5D5HA 1GNQA 1DT5A 2B4QA 2HUNA 5LYYA 1ODCA 3HYRA 1IWPB 1DG3A 2V4MA 4HL6A 3G79A 2O8EA 2E4XA 2JCSA 3DEHA 3WISA 1FFYA 1E5LA 2X15A 1K4KA 1P5JA 4TZTA 4EFDA 2O2GA 2GA9A 3NM4A 3CCM1 1PO7A 1P72A 2YFQA 1SEPA 1JPNA 3FPFA 1YD7A 4GOLD 2VPXA 2AD1A 2Q6LA 1JP7A 4QPNA 5BSGA 5JY1A 5K0ZA 1JFTA 3AKDA 1JIIA 2CXSA 3E05A 1NRWA 3HM9A 2P1ZA 5CAEB 5KWJA 3L05A 4DQ0A 4CZ2A 2Z09A 4YCAA 5L3SA 4LFBB 2W6OA 3UCEA 1UWVA 4ASUD 3CNNA 5EWLA 2RHMA 3TJZA 3DH0A 3NWOA 1ZXBA 3S1AB 2BN4A 2OFXA 1C3OA 4AZTA 1KEZA 3TI9A 1EXWA 4L0QA 3HB9A 4WFJA 1TUGA 3TSAA 3TLBA 3NFRA 2J32A 4QO8A 2Q4ZA 5FBZA 4RPHA 4ZYTA 2JD0A 4ZRMA 3OD5A 4EG6A 3FDJA 1HTTA 3HSYA 3LYLA 2I33A 4JT4A 1QOQB 3ZV5A 4EB6A 1LJLA 4II7A 1JHYA 4LC0A 4QQ8A 5IAJA 4MICA 1V1MA 4OU5A 3K9LA 2Y2UA 3AZPA 3LBYA 5A1JA 1ZG3A 1R6UA 2NADA 5H4GA 3LX4A 4DMKA 4ER0A 2QN8A 1G3MA 2E48A 1L2TA 1Z7YA 1GU7A 4ZDIA 3IAAA 3SAJA 3F8SA 3GFBA 1MABB 1WS6A 4KQEA 1QKKA 1HQKA 2OTCA 3K1YA 2EZTA 3EASA 3R3YA 1A72A 1WZNA 2QTRA 1ODKA 2H7XA 2QX6A 2YN0A 1NIPA 2E4AA 2EC5A 4G1FA 2HDNB 3CZQA 3SP1A 1RBMA 2FPOA 2PO5A 3KXKA 1AK2A 3O8DA 1ZESA 1SBTA 2H2IA 2UV8A 3OT4A 4IQFA 1OX4A 3FOZA 1F7UA 4J7UA 2HHJA 3QLEA 3N58A 2HRBA 2OHJA 1TJ3A 3TE6A 1OVGA 2FFJA 2QD5A 2O0KA 3I34X 2YWRA 5KAPA 3SBDA 3SZLA 3WOHA 4F3NA 2A30A 5EZQA 2YFKA 3BWYA 3HYCA 4MTCA 2PRZA 4RNDB 5C4MA 4J90A 2NVBA 1TFUA 3MTAA 4ZXFA 5FWXB 1N2FA 3R7WB 4D3SA 3ZD7A 3RSSA 3CMA1 4AKGA 2BP7A 3E3MA 5CDHA 2XWSA 4F56A 1IEXA 3D8TA 4X85A 3GHYA 1QH9A 1EP9A 4XX0A 3UK2A 3CCJ1 2C61A 2OBXA 1UBLS 1Z6QA 2RC5A 2ZYTX 1VQ41 3ZH9B 4GI5A 5BNTA 6REQB 1A8IA 4DT1B 5BSWA 2O5CA 4P8RA 2QEQA 5CM2Z 3FSGD 4PSKA 3I6MA 4ZU3A 4F5DA 4KQKA 3PO3S 3KAJA 3L46A 4EY4A 4ZHQB 1DUIA 1BEEA 1QJCA 4P0QB 1Y1QA 3O2SB 4BVHA 3QYFA 3BREA 1YQWA 3HUTA 3WLRA 3EB9A 4IIBA 3DTVA 4TXNA 4U8GA 1VYUA 3CLUD 3LF2A 1ZWLA 2ZUDA 5KDOA 1M901 1XL1A 2P2ZA 3AF5A 3BFKA 1U81A 1TK2A 5EMKA 1XTSA 4K1XA 2ZS8A 3FXAA 2NVYI 4KKXB 1PDOA 4U3JA 5BV1A 1SBNE 4FCVA 4RTRA 1ICEA 3MIIA 4QOEA 4I2VA 4IF4A 1GXSB 5IU6A 3DMRA 1V9SA 3FZEA 3H83A 3K0FA 1JA0A 3DZIA 1PJLA 3IOEA 3EXEB 3C1AA 1UPFA 1XZJA 1ISPA 1Y5LA 3PQ2A 4EO9A 1O97D 4H0NA 2PX2A 2C2KA 4IXMA 5B2FA 1OYVA 2GH1A 1BCRB 1V6SA 2AT1A 3EQ6A 4G85A 4G8DA 3MJVA 4LRSB 2OCLA 3UA3A 3TSZA 3T7RA 3AI7A 3U7RA 4F86A 5KREA 1TWHI 3MAJA 4ODIA 1JTVA 2GQ0A 4IX9A 1U7OA 4XYLA 4GLLA 2JLCA 4L5BA 1QGUA 2PQ2A 3L1KA 3M6WA 1XRSB 4ISCA 4KV7A 1ZIDA 4YNBA 1L7MA 1NVKA 2HLNA 3EUAA 4IJUA 1QF6A 1XN1A 2QV7A 5IUKC 5KBYA 1UDAA 3FOFC 3R8FA 2J33A 2O2IA 3T3GA 1KP2A 2JLVA 4ETWA 4HQRA 2C4NA 4JQYA 4PYJA 1LEHA 1Z4MA 4Z7JA 2HU9A 1VLLA 2YH2A 2PN1A 3STUA 4O1IA 5T8KA 4JSTA 3RC8A 1NW3A 4FFPA 1MU0A 1TIPA 1M1YB 2UZ0A 1VYVA 1GRQA 1WUYA 5A5GA 2FJUA 3M83A 1EM8B 1TE2A 2IBTA 3O1JC 2RHTA 1EHIA 1KKMA 3AF3A 4JZYA 4ZA2A 1IZ0A 3FFBA 1E18A 1EWTA 2XXBA 5IAGA 1RIFA 2I7CA 3SR3A 3U4CA 4YP6A 5ABPA 4UCFA 4BNHA 3E7DA 4EG5A 4MRAA 1ISSA 3C8MA 4ENSA 3KYBA 4WY8A 5FI1B 3PYXA 4PQEA 4R68A 2BC9A 3WQQA 4D3YA 4FOSA 4NCXA 1NUIA 1DADA 4IDDA 4IH4A 1FF9A 4MGYR 1QE0A 1WF3A 2GBFA 4O2AA 3QITA 2P9BA 1ULTA 4IHKA 4M9RA 3ZE1B 1BMTA 3JYPA 5IJ9B 3C8UA 3DFZA 1WZUA 2X0NA 2R2GA 3AX6A 5FBRB 2V5VA 2OVFA 3JWIA 4HGPA 4HO1X 4IEFB 4M53A 4II3A 1YJ5A 2FK8A 4LXGA 1KC81 1U0HC 1BVHA 5BVGB 2LZ0A 1KRHA 3ETDA 2V0GA 1OASA 2C1EA 4IIXA 3EMVA 3NH4A 2G17A 3N87A 1ORVA 4KYVA 5F78A 1BMFD 4HLNA 4IXWA 2CJWA 3VYWA 4MVXA 2WHXA 1NQXA 3AYXB 5BYAA 3EPHA 1ZMRA 4WK0B 4YROA 4E5VA 1EFPB 2QKYA 3DXFA 2B8EA 1KJNA 1HDXA 4BRUA 3NVKI 3AM5A 3NKLA 2F1KA 1V8DA 2XMRA 1JAIA 3L7OA 1DJPA 1IM2A 1C5KA 2C2MA 2JLRA 5KSPA 3U4AA 1P2FA 2QHXA 3J7A4 2XYPA 3H11A 1KNXA 3KZXA 3VYRB 3JTMA 5EP2A 1WJ2A 3EFEA 4OY3A 3ZGLA 1HDCA 1V8FA 3TXAA 4DDMA 3T0IA 2QLFA 4RD4A 4PF1A 3OJWA 4BKOA 5FL7A 1QIKA 3TRKA 1BAPA 2VXBA 2IZ5A 1Z4LA 3GLHB 1B6RA 3HNOA 1K0FA 1E96A 3LHDA 3H0KA 4IYJA 4F8YA 5E6RA 2P7IA 3F8TA 3HFGA 1YBHA 3KPJA 4M46A 1E1CB 2MT9A 3Q3IA 1BC5A 1W2BY 1KZ7B 3Q9SA 4HCJA 4BC1A 4UBMA 5L3ZA 3BMOA 5JJ5A 4XVUA 3ITEA 4NS4A 1QIGA 2PS9A 3NWJA 4M36A 4LHVA 1BKYA 3HJTA 3OZTA 3A11A 2PIDA 2K7ZA 4C6TA 1OCEA 2BDEA 2W6JA 4W9MC 4QBIA 1E3DA 4MKXA 3PPIA 1E6LA 4AKIA 2J3JA 2SECE 4KDCA 1Z7EA 3Q0IA 3DQPA 1I1OA 4PG7A 3BWBA 3H9QA 4EOGA 5JCPA 1K5PA 4UAUA 3ELYA 5F2EA 4L50A 5H3LA 4LDRA 1G21E 4ARVA 4TTJA 3TVTA 5K0FA 5KCZA 3EIWA 3C87A 5AVVA 4RD3A 3EZYA 2GBIA 2MSWA 4KQ9A 1MHTA 5DASA 3KAQA 4GPBA 3ZU4A 2ATCA 1RXUA 2Q3FA 4PC7A 3I2YX 1XNHA 2PKXA 2ZANA 3GO4A 5JARA 3FMGA 1V5FA 2DY0A 2FPPA 3IAS1 1QAQA 4J4HA 4LCEA 3IEUA 1AQJA 2CLMB 3O8RA 2UVQA 3AI1A 4JY7A 1R9MA 3R75A 3TK1A 1VC2A 2OSBA 4B6OA 4IZIA 1XTRA 3A1DA 3F0TA 3KAKA 3OTGA 1JS1X 3QPAA 1NONA 1ZK3A 4CLDA 5H70A 1XU7A 2BGKA 1A1SA 1FUIA 3QKWA 3AIIA 2V03A 4DPLA 3IR5A 3REQB 8ABPA 4TVOA 3FZGA 4PC2A 3LA6A 1U80A 3BQMB 2YMPA 3L8ZA 1QV7A 1BH2A 2JFFA 4CIAA 4B3MB 1I10A 2O8FA 1ISHA 1FDWA 4G9GA 1QK3A 3RVBA 5PNTA 1TT5B 2FWBA 3OPQA 2TMYA 4QNMA 1JSCA 2L69A 4MWOA 5DSTA 4C0JA 1SA0B 2G4LA 2Z43A 3C3EA 5FQOA 2NU7A 4LV8B 2WD7B 4Z9XA 5CFOA 3WQRA 1KZGB 2WVJA 1K6MA 2XCOA 3F6RA 4I6GA 3EXHB 4TYWA 2BTQB 3JV7A 5B1IA 1AHIA 4BB6A 4C3UA 2VPWA 2HWKA 3TGWA 4GOKA 2ZSKA 1YASA 1X94A 1FYDA 4DLVA 2PM8A 1KO5A 3HFSA 4RULA 2CHGA 1R4MB 3BWVA 3D6WA 4ZCMA 4FNGA 1DEAA 1USVA 2SHKA 2P2LA 2VKQA 3HKCA 3EPRA 3DWEX 1BD4A 3PA6A 3TRIA 3E9RA 3HUFA 3OA2A 3AHEA 4YRTA 3AI3A 4WI1A 1T0JB 1B8PA 2FSGA 5DYGA 1JJ2Z 2WM2A 2BFEA 3U7QA 4RAQA 4NOMA 1QCCA 3H87A 5BRJA 2NSLA 3HDTA 2ZITA 4OOFA 4D3FA 3P9PA 4Q4AB 3RNLA 3RSFA 5CT9A 2X8LA 1HE8B 1WG8A 3FBTA 3R5JA 1T25A 2GCPA 2DCMA 4HYTA 3ROQA 3U3ZA 3SVTA 1L5SA 1YS4A 5EUQB 2VDNB 1IHDA 5AI6A 1WB9A 5HIMA 1SVOA 4Q37A 1T36B 1BX3A 3MRVA 1E32A 3WNBA 3ZLVA 5CB0A 4G5OA 3VR2D 1IUNA 3HJCA 4X7PA 1TLLA 3WE7A 1USUA 4HAYA 2VPPA 3JASA 1CDOA 2AJ8A 3Q3GE 1XZDA 4NBNA 1EPUA 1Q3KA 4BJ6A 1Q7Y2 4L9AA 1WMBA 3ND7A 5HG0A 2QQEA 1L7NA 3HHPA 4P3NA 4P2GA 1H2WA 1RQXA 2HMYB 4P7GA 3CPWY 2KHZA 1O2DA 4BLRA 3I83A 4ENTA 4IGEA 4PAMA 4WACA 3PC6A 3S70A 5BWNA 4X1KB 3DFIA 3Q88A 3GK3A 1SXJE 4ARZB 5IM4F 4GL2A 3LAWA 4MUBA 5MDHA 3ZNOA 4IMPA 4P7BA 1CY7A 3KVYA 3ESYA 5I45A 1MJ5A 3EZ7A 4PLHA 3E82A 4RTNA 2OOSA 5TR9A 3OCCA 3JQQA 1II8B 2HF1A 3EXFB 4B43A 3BG5A 4A8JA 3BJMA 1FJ2A 1NLUA 3OJOA 1Q19A 3KCNA 2X9VA 3QVGA 4WKCA 1VQKZ 2V8BA 4EYQA 2X8JB 2OHOA 1THZA 5CLJA 4D79A 1E9VA 3FWKA 3CUEF 5KSYA 3MZKB 3DYIA 1DRWA 2WYWA 4NU8X 5AXCA 5GM2A 1HEUA 4R2HA 5DWVA 3WYNA 3LPAA 4ZYYA 3KALA 4C2UA 2JK0A 4KEAA 1WNFA 4C05A 2YKGA 3KVRA 3AL3A 5FH9A 3D64A 1NF2A 1QVGZ 2CDBA 3FNRA 3H6HA 3WMXA 4FJ0A 3O21A 1C0KA 1DJOA 4A2WA 3C3JA 2J31A 3DVAB 2UXDB 1I7NA 2H9YA 2X58A 5IDVA 2JGAA 5C37A 5IUNC 1VLAA 1M2GA 2N0SA 4XCXA 5ELMA 1TM5E 3CURA 2EJTA 3KZOA 3PDJA 1JMKC 3GOQA 1NMXA 4HN9A 1ECJA 4DCSA 2X77A 3CC2Z 2W8BA 3EQ8A 4URUR 4DSZA 3QPVA 3VR4H 2HREA 2WIKA 1K7XB 2Z58A 3P0HA 4DJTA 5FTWA 3WV4A 5KVAA 2WP0A 4LXTA 1JDSA 1GUZA 1KVSA 5CYOA 4N0EA 3G2HA 4ZWNA 1RWOA 5JAMA 2AK2A 4MQEB 3GZNA 5ALKA 3DLAA 4WA8A 5FWNA 4FR0A 3J80b 2HT6A 4U7WA 1OVMA 2RH9B 4EUEA 1OOEA 2OZLA 3CWZA 5DBHX 4EY5A 2H8KA 4HUJA 4D99A 4J6EA 4GLBA 3QSGA 1Y34E 5EXDA 2V4ZA 1YB4A 4D0NA 1Q7CA 3NEJA 5ICMA 5LJIA 2FCAA 4AY4A 1VLZA 2Y4NA 2TSYB 4JZKA 4PC1A 4K9PA 5DT9A 5HA5A 4OHKA 2Q7DA 1D2EA 4ZZIA 4FFLA 5EZYF 1GPWB 3EVTA 1UK9A 4PLPA 4BE7B 1VQPZ 5AUOB 4C20A 1TJ4A 1N4DA 2GN4A 2YJ4A 3BXEA 1H5NA 2ZVQX 3GJSA 3T1NA 2VH5R 3PC7A 5CCXA 3ZDBA 2BMDA 4LTDA 5KIAA 1F0PA 1RS0A 1YOVB 1WEKA 4RQBA 1KBOA 3HE3A 4OUDB 3ZOKA 3LSYA 2RARA 1OUMA 3CT4A 4FYIA 3OJCA 5D3MA 2YJ5A 3NRBA 2IPLA 4D0GA 3TUIC 4B3HA 5JAPA 1N25A 4EJ6A 1KQOA 1NNSA 3ZDFA 3QVUA 2I80A 5AI8A 1WZCA 1NY6A 1VIYA 1EEHA 4NZZA 5G4LA 3THSA 4CF6A 2X7JA 4Q1BA 1PWHA 2F64A 4MIOA 2JEOA 2R7MA 1A9TA 1CZLA 1ECLA 1I1QB 1Y4SA 2XVAA 1O8BA 1E9EA 1NJSA 1OILA 3FD8A 3LS2A 3N2IA 3H1TA 1F12A 3QFRA 3BWCA 3C8ZA 3PD1A 4R1TA 2FSPA 3CCCA 2O8CB 2QLTA 1JHVA 3UMJA 4LYFA 3WYAA 5K9ZA 1WDKA 2WK1A 2K6GA 2YFHA 3AKEA 3IESA 1NN3A 1I6HI 5FHQA 3SHVA 5EL0A 4WOCA 3SLRA 4C89A 3I6QA 1JG4A 5DGCA 4FJ2A 5A2GA 1P75A 1MT0A 2JIMA 1F1JA 4FFVA 4ES6A 2MYTA 2F6RA 2ZK7A 4EARA 3ONEA 2NTYC 3DMPA 2XGGA 5KYWB 4CF3A 4CT0A 1DLJA 1T1EA 3RE1A 3S1AA 1Q862 5HFNA 3RYIA 1BOOA 4YMUA 1NJGA 4IWNA 4LFCB 1ZQ1A 4KXUA 4X1YB 2MYNA 3UJDA 4CIYA 3II6X 2I4LA 3QXCA 3L5OA 4FHDA 3HRIA 3LC7O 2HIAA 3I9V6 3FWHA 4CU5A 1KWGA 2H06A 4JODA 5D1OB 5DLYA 5HKAA 4UAGA 1ZONA 5ECGC 3EDQA 3HABA 1GPJA 4HQKA 1CP3A 2GHRA 1XHLA 1Z88A 1UEXC 4IVRA 3GFOA 1LRKA 4AO8A 2OO7A 3EAFA 1VA5A 1ZVQA 1AKEA 2NTJA 2DCUA 3EBPA 3LQQA 4XTCS 1CT9A 1LDYA 1MV8A 1TUBB 2PUTA 3ICCA 1R4AA 1PWYE 3A8TA 2NTVA 3MUEA 4UASA 1I9CA 1APBA 3VVCA 3W5JA 3LBAA 1FYVA 2A4KA 3FHLA 3OX2A 2A5JA 4KIUA 3IKJA 2W2KB 2XX3A 5CPBA 4QUBA 3S2FA 5AI9A 4QUAA 1X7YB 3QEMA 4Y1GA 4ZT6A 3S2GA 3QVVA 3ND5A 1YBVA 3DZJA 4MXDA 4PYLA 2BZSA 1R4NB 1RXVA 1QGZA 3CCLZ 1SCKA 2DE0X 1LDNA 1MCZA 2HF8A 2PUJA 3H42B 3DONA 4H17A 4NMXB 1OYYA 2QM0A 5CMLA 3DLCA 4MVJE 1QM5A 5F51A 5THQA 3D6VA 3B2QA 4RHUA 2AWOA 4DLZA 3OURA 4PAWA 5FTMA 4EGFA 4B3SB 1AIPA 1T8TA 4RFLA 5DOVA 3IE1A 3L3BA 3ZWAA 2ZQYA 4IWYA 2VWQA 1QP7A 4GW3A 3TFWA 5TARA 4L8WB 1RYEA 4PONA 3KZVA 5IDYA 4M86A 3IKMB 4N7BA 3UG6A 4BMXA 3OOEA 1YJQA 1G5FA 3G02A 4H6WA 5FI3A 1FUYB 2QD2A 1BN6A 3D7MA 3I0NA 3QYAA 4UHJA 1X19A 4JI8B 4NDAA 1AF7A 5L7YA 6REQA 2OYSA 4DT1A 5ISMA 4QQKA 4HWKA 4CMIB 3IPYA 3RYFB 2FW0A 1JEEA 3MS2A 2DX7A 1NBMD 3SZUA 3TO5A 1RLOA 1XDUA 3GWZA 4GYYA 3MD9A 4UE3S 4M7OA 2ZIVB 1CX9B 3QKRA 4UEQA 3S68A 4DIKA 4BNDA 1ZKMA 2EXXA 2BW0A 2YHAA 1YNOA 1K732 1XEWY 3FB1A 3KSUA 3PYLA 4IJMA 3U4QA 1SFOI 1T2EA 1T2CA 4EI7A 5KOHA 4P81A 2AF3C 1V37A 2ZRIA 2B83A 4KTVE 1QIEA 3S2EA 1VG9B 2QRVA 4B4DA 1A9XB 2A14A 2C82A 4Q9DA 4EHNA 4CLHA 3MGBA 1NKTA 1W52X 4CUJA 1B74A 5I7RA 1Z0KA 4J1NA 2WD8A 1CS0B 1K7CA 4H16A 5EZYB 1EXMA 4JKYA 4ZAZA 1NTOA 3GH3A 1UL1X 1XAJA 2PPLA 5DJ5A 4CKEA 2NO6A 5FLXf 2RGDA 1A0OA 2HFKA 4A5SA 1UF9A 4O6VA 4YAEA 2I4IA 1D5CA 4GRAA 4FSDA 5AYVA 4DRYA 2BKAA 2I0FA 4RXTA 1PBNA 2RGXA 4WVLA 3RADC 4DSAA 3FGOA 1SXGA 5DTJA 4D3DA 1FSFA 3IUBA 4RL4A 4TRNA 5TB5A 1PE0A 4ALIA 3WJ1A 2P5TB 1CDEA 4COKA 2ZIXB 2AUNA 2BKUA 2F3SA 3CZRA 3UB4A 2HWXA 3VUFA 1EQUA 4QYWA 4Q3OA 3V4FA 1EVEA 2AFRA 4F45A 3BZBA 2CB9A 4J4TA 4INJA 4EJSB 1QIDA 4ZTUB 1GNLA 1M7GA 3O31A 1Y1WI 4MI9A 4IL5A 5K8UA 4F9FA 1DVRA 1TM4E 2V55B 3GRUA 2E82A 2RJNA 3ULKA 3QX7A 3ZD8A 5KQGA 2ZI7A 2V3CC 3PRYA 4F4UA 4HLQB 3RV3A 4QEKA 4JS0A 2QM8A 2R8ZA 2C0QA 1ELOA 2H4HA 4QWWA 1IG0A 3H8SA 3MRTA 4Q3NA 3LC2O 1XQWA 2V7UA 3IQDB 5CXSA 1YRBA 1LLCA 3JX9A 1CR4A 1X8XA 3C1TA 2DRIA 2XI4A 1T10A 3CLTD 3KNZA 4MIYA 4GZ5A 4J0JA 1JYFA 3N70A 3ZGVA 4OM8A 4RJIA 1J0AA 2CNOA 1AKTA 1EM8A 2M1XA 4QLAA 5LA6F 4LQ4A 3GLIB 4QE3A 4RGQA 1YRWA 1LQLA 3IOMA 3OZ7A 1OWOA 2R4UA 2ZKIA 5EJ7A 3AWDA 4XQ9A 2Y27A 1BHO1 2WU0A 2PSDA 3TW8B 2HMVA 5IJXA 1OI3A 3L0IB 4AJ2A 3CG4A 4JT2A 2VJOA 2VK2A 4U1RA 2FPGB 1NMQA 5AMXA 3CYFA 3J81A 1U2DC 1VYTA 4MV7A 1ZR4A 3KL4A 3LYUA 3QLUC 4JVMA 4YJKA 1E3TA 1K6XA 1PL7A 3ZWMA 2C5FA 3SBOA 5P8WA 1PK9A 3EZ9A 5BVGA 3LUBA 2OECA 2Q8PA 4EAQA 1F2DA 2VBFA 1U7UA 3SPXA 1EVYA 1CEQA 3PX3A 1QO0D 3NGXA 3PL1A 4QJIA 2UYYA 1OLSA 3RU3A 1EI9A 5I7AA 1EFPA 1M0SA 4MO9A 3F3FC 3P9KA 1GPMA 3KWJA 4BX0A 3IEKA 4RAOA 5F35A 1PG2A 1EZZA 4P1ZA 3AINA 4XQGA 5FL3A 5A4KA 4ND5A 3RS0A 1Y6JA 4M6WB 5E1DA 3SJZA 3SX2A 3A6LA 2JGDB 3AU9A 2QSJA 3IYLW 2VHEA 3PRHA 4BP3A 1HX7A 5D87A 8GPBA 1RAGA 3QM1A 3VGPA 1E7YA 2WF5A 3GPBA 2JCGA 4HHEA 3M5PA 5K4GA 2FDCA 3SQMA 3H3XA 1VMAA 1LTHR 4CRWB 3C6YA 4HJXA 4FI3C 2B8NA 2QSZA 4X24A 3TTXA 3WQHA 3NBAA 1FP6A 2GTIA 3VC2A 1QTQA 2ATXA 3GV0A 2P90A 3SHFA 1CRQA 2X4GA 1Y5RA 3FDFA 4WX2B 1PWEA 2BUBA 2W7TA 3E53A 3ONFA 4G4GA 3DWFA 3GJYA 3GLHA 3EYAA 2NVOA 3W6PA 4R9SA 1VPEA 4QOFA 3WGJA 5C7OO 2H7VA 2QMEA 4OHMA 2R6MA 4J2HA 5EIXA 4TKUA 4MGZR 2I2FA 4YRJA 5FPYA 4CNBA 5BWMA 1S7GA 1XZNA 3H0CA 5CDFA 2C5AA 4BPBA 2AKEA 4M9UA 1JEAA 1R0YA 3M33A 3QEBZ 3URMA 2Q0HA 4KMRA 3SSNA 2AOXA 4MW5A 1R0SA 1GRCA 2BY4A 2H0QA 3K32A 1ZBDA 3D3NA 4RTOA 3I4LA 1AKNA 3G68A 4HTAA 4I50B 5KJCA 2JH3A 3MS7A 4HSGA 2ZBFA 4X61A 3SQDA 4HJRA 2R97A 3GGGA 3HL4A 2OORC 3C8DA 5CIWA 2HBZA 3OO1A 1SJ9A 1UC8A 3PDIA 3KXDA 3UUWA 1ZKDA 1CWUA 2KSQA 2V7VA 4BNTA 5IK2D 1ZD5A 1ZCJA 4B3RB 2F43B 1MOPA 3CRNA 1SKYB 4GKBA 2Q07A 3O8CA 1GQQA 1XZAA 5BW5A 9GPBA 3HVHA 2QY9A 2AZXA 1RM3A 3KELA 4CM1A 1RI5A 3LU1A 3NT2A 1JQDA 4L76A 5ALYA 5CDSA 4M9SA 3VKFA 1NJ1A 3K6JA 4LXIA 3CIFA 2ZYIA 4OLAA 4ENRA 1NXSA 1ADBA 1U3UA 1XMOB 2RE8A 2Q45A 4EQZA 1O0BA 2HY7A 1VDMA 4OJNA 4ZODA 4BBAA 1M1UA 5BO5A 3JYLA 4DEXA 4Z1MD 1J24A 3HWX1 4XIGS 5LZ4A 4TNUA 1HM5A 4B4WA 3W4IA 4OQLA 3DYVA 1MA0A 1KAQA 4OHXA 1VE7A 4RY8A 1A9PA 1QZUA 3REQA 2WFLB 3X1DA 1SB8A 4ZVOA 5T4HA 2LTAA 1EGHA 2ZVJA 3FAKA 4PCAA 1Z07A 4Z4EA 1I3KA 3MRSA 4G36A 1IIBA 4MRPA 4CBVA 1ZAYA 3RVKA 1WMAA 4Y2JA 1P2VA 1QYXA 1SK9A 2AC2A 2W00A 5FQNA 4NBHA 3D6NB 3WWOA 5GM1A 3UFXA 3PGMA 1W19A 5EIAA 1GDTA 1Z56C 3PC2A 3GZTB 2PUFA 3R24A 1GQ2A 2A57A 2GNAA 4LF7B 2RGAA 5ITZB 2UZIR 4OMDA 1YC5A 2CXPA 4R1OA 3EFOB 1KZ4A 3CPJB 3O91A 3T3NA 3MJEA 5LA6B 4K6MA 4FB5A 3IRUA 5CG2A 3AHFA 5ALGA 3PTAA 3RANA 3TFOA 2PGJA 1JLRA 4ZV4A 3M0EA 2PXCA 4BV8A 1BDBA 3GRYA 5ICEA 1JWLA 3QGMA 4V0RA 4GD3Q 5ICFA 4D82A 1YH3A 1OYOA 3P0FA 4ATNA 1ANKA 4HPXB 4X63A 1VQ51 4WZ6A 1VJ0A 4F91B 2AVNA 1S0UA 5ALQA 5BV2P 5E6UB 3CCFA 1K7FB 5TQVA 1E1LA 2X86A 3RTBA 3WFZA 4GSYA 2BE9A 3I5XA 4LXXA 2PXXA 1WCIA 4R1SA 5TT1A 1NKVA 1TOAA 4EWLA 5HRAA 3AVTA 2A9QA 4BNKA 1G3IA 3ORQA 4Q3KA 1EP1B 1JU3A 1YZFA 5AN9F 3TOZA 4C7JA 3JZAA 1JKFA 1NOIA 3GBPA 4TL9A 3TR5A 2YJZA 4DDHA 1KYTA 4R8KA 1I4EB 2WE7A 3K8OE 5KNBH 1JJ7A 1RZUA 1D8AA 3LKVA 1P1CA 4L8LA 1OD6A 1I14A 1YIAA 3F74A 4ND6A 3UO8B 3NAZA 4F1WA 1R6TA 3GUVA 4DC1A 2PT5A 3QX9A 3NTOA 4G2NA 1KQSZ 1SM4A 1U4OA 1PYDA 1OIWA 5CK5A 4ZPJA 1MTOA 3B6ZA 3IAXA 3DOCA 4LHEA 1DTEA 3IOBA 1A04A 2JS7A 4DAOA 3FMFA 3O1HB 2YVLA 2DEUA 5J2UF 7GPBA 2HQOA 2B8WA 2VDUE 2I66A 3VOSA 1YVEI 4ARZA 1SC1A 2ZWIA 4P9NA 1L4EA 3PTZA 5LMNB 1Q16A 1M34A 2V3WA 4N5HX 4OB6A 5DWDA 2JIBA 1YJNZ 4WKNA 3UANA 4EUHA 5I9LA 1NG9A 2A0YA 2OAP1 1DKQA 2W2PA 4Z6KA 4YY3B 1QQTA 3R9XB 1H1DA 2H1LA 4TTTS 2W4MA 3JRNA 1UK6A 4UVDA 2C9MA 1T2VA 5JVDB 5I51A 2G1JA 1VSUA 4MQFB 4BVEA 1CUUA 1PLKA 1Y4ZA 2GXQA 2IPOA 2X3YA 3LOPA 4I99A 4MPJA 1TPYA 3FTNA 5F73A 4CMEA 8ADHA 2I62A 3LI2A 3KSZO 3N0WA 4AYTA 2A9PA 4KXFB 1V3TA 4DUZB 2XDQB 4CT4B 4DSTA 2FZ5A 1DAGA 1WXXA 3NIGB 1T3ZA 4RM2A 4HFRA 1D9ZA 4YA6A 2EP8A 3UKOA 4PXYA 4AQ7A 1XPOA 4RPIA 1J2EA 5MHTA 4BNJA 1OLUB 1C3EA 4HLUC 3PWTA 5IP9I 2GPTA 2GAIA 4YCBA 4OQDA 2H63A 5BYKA 3HXKA 2EW1A 2Y0BA 3ENQA 3MA0A 3N7AA 1MEEA 3RVNA 4XJVA 1JWBB 3MLBA 3MWYW 1VJGA 3VJKA 4YDQA 4DDVA 2NSDA 3EIXA 2CV1A 3SIWA 3BMCB 2H1CA 4YCJA 1OAOA 2A1UB 2QT0A 1SCQA 4MD8A 1FFDA 3INYA 3IXQA 4H1TA 3OIGA 3T1YB 1ZVMA 3DHWC 3SYLA 4BECA 4D2IA 1JT9A 1B0ZA 1QLJA 5IEBA 2DQKA 4RMIA 1VM6A 2R8XA 4BFYA 4JI2B 2W58A 4GDFA 1I5OA 3HXLA 1NR7A 3A1NA 4H7IA 4NATA 2GCGA 1K5HA 5EJIA 4AMVA 1P2UA 2JANA 2OCKA 2PZLA 3BBPA 3BERA 3JYHA 4MRNA 5D00A 3UMGA 4CL8A 4D41A 4D45A 4WJLA 2KBEA 4TQ9A 2Q7XA 3WBBA 5JTUA 4NPHA 3PE3A 2W2XA 2Z8YA 3AUXA 4FINA 4XR4A 1X7ZB 3PE6A 5ERXA 3V4VB 4EKEA 4TWAA 5I8WA 2H7CA 2NXJA 2B30A 1CVRA 1P9WA 4YRRA 2RHRA 4KODA 4M1EA 4CQNA 3N7TA 2PGLA 3TLGA 1YOVA 4YB8A 1HNXB 4OBBA 1IK6A 1YR2A 3P5SA 1E98A 3L8GA 2B36A 3OFVA 3DBHB 4ZV9A 1BX0A 1WW2A 1P9OA 3H2SA 4MS3B 3X0DA 3SF8A 2GJ8A 3E9MA 1VBFA 1FYFA 3KB8A 4OPMA 1FE8A 1UBOS 1LK5A 2F3QA 4FZ3A 1DV1A 5MGBA 4BCDA 1NDUA 1T9HA 1SGWA 3X1YA 1C4XA 3B2EA 3G9XA 3Q8KA 2GWHA 3ZCPA 4D98A 3P71T 2ZSIA 2XPCA 1RHQA 3EWNA 4YRNA 2YTZA 4ZVKA 3S40A 3VKVA 5HM6A 1IZ9A 4EHHA 2IXBA 2OBLA 3QV2A 5AJVB 2WR8A 5FJIA 2O8CA 3RC3A 3VR5A 421PA 3L1JA 2QX9A 2JR6A 1QFSA 1DWUA 1T0PA 2BFDA 2OV8A 2E3JA 2RMKA 3TTYA 4EDFA 5I7SA 4LYYA 1CF9A 1MAWA 2R0QC 1JQLB 3LWDA 1A5BB 5HPYB 4DKJA 1ORIA 2BMEA 1JYEA 3IUYA 3I9MA 4B8YA 3TPZA 1KAMA 5KYWA 1CUVA 3NCTA 4ZV7A 5EQFA 5CEFA 1BWPA 5BOVA 1OZAA 3BXGA 2YU9I 2P6MA 2QN9A 3F7MA 3PPWA 2CUKA 2RSLA 2P78A 3M4XA 3NVDA 3OTWA 2IWHA 1N6NA 3UV6A 4LGYA 4QL3A 2YNMC 1N2HA 2COEA 3EQ7A 3KFLA 1BDIA 1X80A 2EG5A 1U3WA 3R8XA 4QZVA 1GPYA 2PYDA 5IT9b 4KYTA 1W44A 3LP5A 2B5WA 3ANYB 3ENVA 4F3RA 4CGZA 3OFNA 3R5KA 2VP0A 3AUYA 4MR9B 3MFYA 2VSXA 1LZLA 4PFSA 3L8YA 1EFKA 5HFJA 3OU2A 1IHUA 2XOEA 1EG7A 3M4ZA 1HPLA 5I3ZA 3CC71 1C8KA 4A16A 4DIMA 1IC6A 3JQEA 2IP4A 1ZGCA 1I6MA 1Q14A 2F1JA 2W11A 4L8YA 4WPGA 4BY7I 3FYHA 4GS5A 3V2GA 2QUBA 4EB8A 4XSHA 4OYRA 4CG2A 1ECCA 2FMTA 4WN9B 1M0WA 4HGRA 1U1EA 3KEFA 1RYFA 2QUJA 3A7DA 1JHQA 2XRYA 1QHIA 3BUSA 2N1BA 3E2MA 2FPKA 1FNSA 1DKNA 2OUKA 3IUQA 4HI0E 5INTA 1PTJC 4IMIB 4NMHA 4DGLA 1QH8B 5KI6A 3H16A 1XQVA 1U9IC 2A8YA 2O2XA 3BK1A 1Z6PA 3I6BA 4TYQA 5BR4A 5ADHA 3RUHA 1QANA 4HLCA 1O77A 3W4KA 4HNVA 3KX2A 4CKZA 3IL2A 3EH1A 3R4VA 5DYNA 3FIUA 4IDPA 3TJMA 2CFCA 2H4XA 2P2NA 4JXKA 1XRQA 1YOBA 1JF8A 2FR8A 1CLEA 2NAPA 1ZJYA 4Q66C 3STWA 4CFZA 2X6RA 3KJNA 1RRMA 1Z6XA 5JWRA 1NNEA 3HV2A 3UICA 4DFDA 4YP1A 2G36A 2G28A 3KLNA 5TY0A 3WKCA 3FNEA 5TEWA 1M76A 2VZ0A 1I5RA 2VHCA 3BH0A 3C85A 4YUXA 4DS3A 4RZHA 4KUHA 1MO5A 5EHXA 3LPNA 1DAIA 4MV9A 2OO5A 2E2JI 4OX9Y 1KP3A 2HF9A 2DQZA 3BSSA 4HP8A 2FN7A 5EHZA 3RYFA 3R6TA 3QJGA 3CX8A 3WGHA 3CUKA 5I8ZA 4U9HS 1EUCB 4NCNA 3AVUA 5AJWA 2XAUA 2OKGA 3N8HA 5JLJA 5G3ZA 5E9AA 2P0YA 4D1YA 5ALMA 1AUXA 1B0AA 4QULA 2R60A 3CRMA 1SO8A 4NBEA 2YHIB 2JNYA 1CDZA 4NF2A 3NH5A 4PC3A 4TTQA 2HI0A 4P58A 1HE3A 4GE3A 5TT0A 4CM9A 1A9XA 3I1YA 2OXIA 2XGOA 2XMSA 1ZC4A 3QE0A 4FT4A 1AHNA 4GMHA 1KI2A 5I9NA 2C0PA 1CYDA 5C8YB 5HWSA 3RTAA 3HCWA 3T0FA 3PNYA 1NM5A 1Q5PA 5EZYA 4RZSA 3TMAA 1FQJA 2HQ1A 1VMKA 3FGPA 4NBUA 4D8YA 1GAXA 4QYSA 1Z4IA 3CZ9A 1NXWA 3NX4A 2O8BA 2YZKA 4HGNA 4OO3A 3JARB 4AF6A 3HXOA 2VJDA 4XSGA 1F5NA 4Q7QA 1E5XA 1JDUA 3EDCA 4IOLA 5C44I 5ECWA 3U17A 4ZOLF 1DJQA 4Q9KA 1VL2A 2GJ9A 4TL6A 1UBFA 2DLDA 2Y0PA 1Q7Y1 3SDBA 2QR1B 2PK3A 3EEOA 1LFDB 1KYQA 3I58A 4JLNA 5LWHA 2Q0QA 3CH6A 1PJQA 1X13A 2CWDA 4K3UA 3R0IA 1EP2B 3NHUA 4FZVA 2V7XA 2I6FA 4K9KA 3UF0A 5J4KA 2MMGA 5IZ4A 1K9M2 2A5GA 3USZA 5JS1A 4M8KA 1U0RA 1MORA 2DZDA 1Y80A 1W75A 3P19A 3LY7A 4QVKA 621PA 3K8QA 1NJ5A 3OQ1A 4FGZA 5LQDA 1RNIA 1B4DA 2CLHB 1O4VA 4WJKB 5B55A 3KZCA 3QLVC 3LVQE 1LI7A 4Y6LA 1AO3A 3S5JA 3VX4A 1ZUD1 4EMUA 1YMQA 4ZCSA 3P2IA 4POOA 3GLIA 3ETCA 1EWQA 5DPMA 3ZJUA 2X1LA 2RFLA 5AOVA 3S1MI 4BQRA 2G1KA 4E3WA 2PYIA 4P2BA 2C5HA 2ZIWB 4JMLA 3TDMA 2E6UX 4PNEA 2XADA 1H6CA 2MSDB 1TM7E 1WOMA 3E48A 3M6VA 4NARA 4BVFA 1YFJA 2ERXA 3QELB 2HEIA 1J90A 2IXGA 2VUHB 3LC1O 2OQ2A 2CD9A 2C92A 4RH3A 2JZCA 5ALNA 1PEYA 2DERA 3AT1A 4QT0A 1XZEA 4JP8A 3N1UA 1IXRC 2B4RO 3HU1A 1EK2A 4LA4A 5LLSA 4M1TA 1DIGA 1LSOA 1O94D 1Z28A 4FYXA 1TK3A 4E5DA 2IY9A 1GU1A 3FA2A 1MC8A 2GZ3A 4FVTA 1Y1SA 3IMCA 4PY2A 3U26A 3QX3A 1IATA 2OGUA 1RXIA 2QMUA 3G2OA 4NDZA 3K0CA 1U28A 5A4FS 2B37A 2QD3A 5CFNA 2JFPA 3PUKA 5EMHA 4B3XA 4HS9A 3A1SA 1PR1A 5FX2A 3ENKA 1DHRA 4UNQA 4RHYA 2VNKA 3DFFA 1QZTA 1RYYA 4CQMB 1KRXA 5A2QA 2JGDA 1QHSA 2I2WA 3PCTA 4H7JA 2PT9A 1D0VA 3ETLA 5KTNA 4WNAB 5CVJA 1SXQA 4N5LA 4C5AA 1S3IA 5LP6F 3QG5A 4I36A 3S1QI 3OY2A 2GD6A 1LRLA 3ZVRA 4EBBA 3IUJA 3TAHA 1NMSA 2MSKA 3R5HA 3VB9A 1JU4A 2DPMA 1Q0ZA 5CBPA 4LN1A 4I5DA 3OJEA 2VA9A 5B6JA 3WSWA 2N9UA 5D84A 3SCZA 2WA2A 3B5EA 3W8EA 3KPUA 1SXJC 2FG7C 1JHAA 5F7JA 3HSKA 1UQRA 1XD8A 4I9GA 3PQCA 3SSOA 3IVAA 1JEQB 1ZXXA 1KEWA 1QXSA 1U8EA 2W9XA 2P35A 3SHWA 4JKIA 4B9EA 4EGSA 5BORA 1IBKB 4NPAA 4HATA 4MEAA 2Q4EA 3LECA 1ZPDA 2QE7D 4FFDA 3OIWA 1C7QA 1G19A 3IKVA 4RTKA 3AHDA 4EELA 5ICCA 5KNDH 5EJFA 3G88A 3QEKA 4V0LA 4M76B 3T7CA 1CEXA 2GERA 4XD7A 2O1EA 4Y0VA 5FUXA 3OZRA 2F43A 4Z0TA 5JH7B 2IA5A 3OOHA 4AJPA 4JVLA 2OCIA 2IHKA 3VYTB 4BLTA 1ZH2A 2EZ9A 2FH5B 1GEEA 1P6QA 4FFBA 3NW9A 4DEYA 4RA6B 5ULLA 3V1KA 1SVMA 2G80A 5C9ZA 1LWOA 5JD4A 3EGVA 3GLFB 1J0EA 3G23A 2OB1A 2E55A 2W5UA 4PHGA 5TQJA 1Q861 1OYWA 2JFXA 2EL9A 3QKTA 4P4GA 1SIOA 5E1BA 3RRMA 4ZOQI 5IN5A 2YWCA 2ZRJA 1G6Q1 5GY7A 3CM0A 3RVPA 3BT7A 3GA5A 4MKHA 3V32A 3ADPA 3DEJA 1DSSG 1RMQA 4IV8A 1TVEA 4ZOLB 3T0GA 2Q4RA 4IRXA 3GRVA 3R2JA 1VZ3A 4NH4A 3KQWA 2UXCB 2QLNA 4TS4A 4B4KA 2WFLA 3K0KA 2PDAA 1P5RA 2VBIA 2HDWA 1WUTA 4XGQA 1JHRA 3G0GA 1WXWA 2RG1A 5LMCA 1AT1A 3WWDA 4EYGA 4P84A 3SS9X 3TEJA 3H3VJ 3C6KA 5JUWA 3VR3A 2PU7A 2P67A 3ZJTA 1SG9A 3FYUC 1YE5A 1DO0A 2IRWA 2ZQZA 3LV8A 5EXEA 1E92A 2PU5A 2FN3A 4IDBA 4BNIA 1EDDA 1PFUA 4AM8A 1NVFA 2DJ5A 2JJQA 2XTZA 1WULS 4ONEA 2ZFUA 3EFOA 5F2NA 2OWEA 1ACJA 3AIMA 4HGOA 1KK2A 1VL5A 4NZOA 4Q6WA 1QIIA 3DEIA 5F3RA 4QG3A 2NUPB 2YIDA 4JH0A 2Y6VA 4JEHA 5JG7A 1M5TA 2WWHA 3F6SA 4TKMA 1MXFA 4P36A 3H84A 4F60A 3HZOA 4ZVQA 1M0TA 1G1AA 4KJZA 1BA2A 1RAEA 5AW9A 4FZJA 5D2CA 1KEVA 3V7FA 1XCMA 4Q15A 3VBCA 2XY4A 2CKMA 2BE7A 2R8OA 5KTKA 3HG7A 2C5EA 4R83A 5I9MA 2WG0A 4Q03A 1SUSA 1MPTA 5KQMA 3UJHA 1SUPA 4BRZA 2PQ0A 3U7FB 4WXPA 3HA3A 3HB7A 2Q3HA 2R6DA 4N12A 1GQFA 4U7HA 4O4HB 1VQ81 4BMZA 3MMPA 2M6SA 5HRCA 3QH4A 2CBGA 1QYWA 3U4IA 3ADBA 4PTYA 3FTEA 5KJFA 2O3RA 1KNQA 2XCIA 3A1VA 4GWLA 4HB3A 2NUTA 1A77A 1CDDA 1QF8A 5B1HA 2E37A 3A36A 3I12A 4XLLA 5LZ7A 2LCIA 3NANA 4GWKA 3ZLTA 4JJ4A 2Z1DA 3KXLA 2D2IA 1K731 1K8A2 3HUUA 1PL6A 4Y6GB 2NT3A 2WV9A 3A4NA 3PKIA 4A8TA 2FQWA 4BPRA 4CQLB 5KYUB 1VPVA 2LD4A 5B64A 4KQ6A 3DL2A 4FEGA 1YFKA 3SE7A 1O89A 5LP6B 1KVUA 2FP3A 3CINA 1Y89A 4JP5A 1HZZA 2FQXA 3A6GA 2PJUA 4I1VA 1MD9A 1L7DA 2BFBA 5COBA 1N5KA 1N6LA 2WWWA 5JAQA 2GFIA 4J1TC 1U2ZA 1TWCI 1FVXA 4Y7CA 1Y6RA 2AYZA 1I4LD 2P1RA 2P9HA 2QMHA 5IARA 1U0GA 5I7HA 1PGOA 2ZS7A 4RCZA 5AVUA 1L5VA 4R31A 5C52B 3EN0A 3IO5A 1HRDA 1W6RA 1N5MA 1O58A 1XDBA 2DBVO 2Y1DA 1E2QA 4DK1A 2ODQA 1V8BA 3JVDA 3K53A 4G1CA 4FSHA 1XC7A 2W6ZA 4CWAA 2GNOA 4GI2A 4YLGA 3CQZI 2VNAA 2W37A 3HGTA 2BCEA 2PKQO 3IIJA 2RJOA 4GF5A 3V4LA 4P93A 1QSGA 5DP2A 1AS2A 1G3RA 3BULA 5ICSA 4IJVA 2WW8A 3T3IA 5F2KA 1NQTA 2IYZA 1P31A 2PRYA 4HFMA 4EG1A 5IBPA 4BEVA 2YOHA 4B3FX 2H08A 5LQAA 4KQFA 5A9SA 1TM2A 4C76A 2JLWA 5HTOA 3CMAZ 4PLZA 1EUQA 1D9XA 4M89A 3CO5A 2DKNA 2JLSA 1OLUA 3CCJZ 4UUNA 1HG1A 3SFVA 3WIEA 3L0CA 1LNQA 2ZYWX 5IH3A 3ZNQA 1GTL1 1FVHA 3UC5A 5DCLA 1TJ5A 4BLPA 3X2FA 3IT1A 3GU3A 3NONA 3MUOA 2R96A 5FV4A 3I39X 2QQGA 4AG5A 3FMIA 3MYYA 3DGEC 4CM8A 1GAJA 5AW3A 2ZCUA 5IKMA 4Q1CA 2P30A 3W78A 3A4MA 3ZWNA 3U7HB 4W9RA 2YBDA 3A4TA 4HWGA 1SIBE 4KR7A 3TEMA 3EG9A 3WBFA 1WE2A 3M2PA 4RQUA 4EKDA 5L9AA 3DMTA 3CONA 4BGDA 1DC3A 1REQB 1W581 2ZBVA 4NFYA 1P77A 4WOPA 1P44A 3ZQKA 3WLQA 2AKLA 2OD7A 1DZ3A 1IN7A 1XFAA 2A94A 3NHYA 4PG4A 1D7OA 1F0YA 1R9GA 3L49A 5EP1A 2XB6A 5EINA 1UADA 2GFQA 5KTSA 2A78A 1K68A 2IPNA 4EWCA 2W2VA 3WFJA 1CQPA 3B1XA 3F4BA 3L9XA 4JBYA 4MUXA 3T4PA 2AOVA 2E2HI 5FI5A 4QM7A 2PUBA 4IR7A 2J6CA 1JQKA 1VHWA 4TLEA 5JJLA 1LKZA 4J1SA 3SQLA 4C6RA 1QVFY 4ZQHA 3EVEA 5FIUA 1NBOA 1ZW6A 2Q2QA 4P54A 2YY5A 3K9WA 5IVKA 3ADKA 1WZEA 3FUXA 1W87A 4Y9DA 5T6MA 3QEAZ 2QR5A 3ICEA 1R6XA 5TGDA 4DVGA 1NBAA 5ALWA 4DDTA 4L2IB 4XDGA 1CD5A 3F5DA 1RYMA 5ADUS 1MXHA 3H2ZA 3FW1A 2V8OA 3I5AA 1NAHA 1U2GC 2HHCA 5C1OA 3EGOA 2O5VA 5I5EA 2AFIB 3VHQA 4RA9A 4ARBA 1G42A 5AKKA 1BQEA 3QQ5A 4BUCA 1ODFA 1MG5A 1XCGB 2CFSA 3HP4A 1QVZA 3RJZA 3EC7A 1DDOA 2CL5A 4EPYA 1IXYA 1YKGA 5IJZA 2IOFK 1KOGA 1FP7A 3BMNB 1U5CA 1NI5A 3LCMA 5FRDA 3RHZA 3T99A 3AF4A 2OMEA 1H0SA 2AOTA 4XQCA 5GJCA 5IM5A 1ZU5A 3HU2A 1ZM4A 3NHZA 3KE8A 2H5EA 5JXWA 2C8VA 3CCEZ 2HRQA 3R5TA 3EOZA 2J0QA 1W4BA 4G6ZA 3OCXA 4Y2YA 4A6XA 1R8SA 2H59A 4OGLA 5ARDA 4E4TA 1HFWA 2OILA 2BZGA 2XUFA 4XTRA 2D00A 1MC5A 1DXHA 2E9SA 5ITVA 1R1DA 3NYWA 4HR7A 1HUQA 1Z5WA 2A9FA 4AWBA 4CDNA 2ODTX 5AK0A 3OO0A 3N8NA 3WHIA 3ZVMA 2FPWA 3F9CA 1J21A 3TLEA 3GPCA 5E3HA 2AN4A 2ZJ0A 1P3DA 2XTNA 4LYGA 5C8ZA 3THYB 2F3UA 3PGLA 2RDMA 4X92A 1VBNA 5HCNA 1QGAA 4LOLA 4DHWA 4MR9A 3AXTA 3KYDB 3C41J 2JA7I 5J2UA 2R8RA 4L9RA 3LBIA 1LU9A 1VE9A 2HIMA 5EJ2A 5AM3A 1X7XB 3B3QA 1HH4A 2HHLA 2D54A 1SD2A 3OEEA 3RJTA 2BTOA 3P9SA 3EY9A 3H1GA 3HBFA 4GOOD 2GPWA 3N2NA 3DDWA 2J4DA 3DJYA 1LPOA 2RB4A 3E3OA 1ZUNB 3JYOA 2VSNA 2GPNA 3OAAA 1M67A 1SBCA 3MAAC 3AJDA 3ZCRA 1OHHA 5I7OA 1JFRA 1SBHA 1UT6A 2R5NA 4ARAA 1T9ZA 1TU3A 3DDSA 5LL6P 5IPFA 2PZMA 1Y63A 2HWWA 4OQXA 2A0WA 1FS4A 1CTQA 4UCQA 4M21A 2QD1A 3I2JA 2VHVA 1QX4A 1H0RA 1XLVA 3L7JA 5JAZA 4FIZA 3Q72A 4XDYA 3WY9A 5GWXA 1CZHA 3AZOA 4OTZA 4BP1A 1Y5IA 3GG2A 3L04A 5TS2A 4LTNA 2IYLD 2Y0SA 1ND5A 3EWIA 5EE3A 3RK0A 4HXFB 3J7AC 3UTCA 1RZRA 1R0XA 4L51A 4BBSI 1WCWA 3ISVA 4X45A 2A59A 4R8RA 4ZYWA 2ZXFA 4K87A 1RLTA 2GN9A 1B6TA 2OZKA 2BWJA 4IV5A 3EDRA 1RYDA 1FLDA 1AB6A 3TQRA 5IYZA 3RFFA 3RQSA 1PX0A 1QLWA 2REXB 1WHTB 3F6PA 2NTEA 2O23A 1EJ2A 1LX7A 1YB6A 1CR6A 3V9PA 1UJ2A 3FKSA 2JBHA 4ZIRA 3JWGA 2I2CA 4YAOA 4DBZA 5K1ZA 2QRCB 2BONA 5K0TA 4Y1FA 1S89A 2AR0A 4MVJI 4X20A 1F2UB 4TTSA 3ZI7A 5KNCA 1B3RA 5KYVA 2X0EA 3B52X 4GI3A 5DBOA 3RZOI 2ZIZA 1GA4A 4OFXA 4X9XA 1MLDA 4QXQA 4QJ3A 3ZDEA 4XIFA 5FWAA 1JR2A 3MMSA 4B4OA 5BN4A 2W2LA 1HDZA 1GKKA 1LQ2A 2IYQA 3NBZC 3KQNA 2ZULA 5HDBB 1CKEA 3VR0A 3UGTA 1Z62A 2VTDA 3LKBA 2J7PA 4NDNE 2WILA 1M1YE 5CH5A 4BQPA 5I8PA 4H3HB 5DU2A 4NBTA 1UBUS 3NVMB 5BP7A 3OLVA 5HZGA 2AXEA 2HEGA 3GJQA 2JEZA 3DEYX 1QHHA 4S35A 3SEZA 2NO7A 3HOYI 2F8MA 2FRDC 2PH1A 3PS9A 1OFUX 3FPBA 2E89A 4TOIA 2WWIA 3DCJA 4YMSA 1R6AA 1HI9A 3LMKA 3HA2A 2IYNA 3UYKA 3RO7A 1EJ0A 4BXXI 1N2CA 2SKEA 3OAAD 4XM1A 1PZMA 1UBGA 1U1DA 3OPYB 3QPBA 5DNDA 1GPNA 4WTOA 3H2YA 1N8R2 4RY0A 3DPIA 4NHOA 4BNVA 4KGVA 1ZNYA 3KXPA 3I73A 2Q3JA 4OQNA 3ZHCA 2ZYDA 4HXYA 4DCTA 5A0TA 13PKA 1KBZA 3GLVA 3PRJA 1JE0A 5B58T 5KS2A 4JLUA 4AO7A 5CDYA 5L7WA 1M2EA 3GGDA 1DFIA 2YR0A 4DM4A 1TMYA 3LE8A 4QEZA 5SYAA 1XROA 3UXMA 1C2TA 4Q3EA 4E07A 1U7ZA 1N5LA 1HETA 3HDHA 1A7JA 1Z8NA 4LVOA 2V3VA 3MMNA 2Z83A 5E2BA 1KSJA 1BSVA 1ESCA 1RWVA 2QAGC 2VEOA 4TLAA 3RBZA 3KTAB 1USPA 3KUUA 4KDFA 1JBEA 1QGYA 5TPWB 3PJFA 4GDMA 2P2GA 2PL9A 3OICA 1RQFA 3EVFA 3QUBA 3Q9NA 1RJ9B 4EJMA 1Z5GA 3LUGA 3W5SA 2XV1A 4FHGA 4KGZA 5F1KA 4MLZA 3LQYA 4MGIR 4RMGA 4E08A 4HNUA 4EY6A 2P6RA 4GKKB 4MWBA 4QOHA 5LZ8A 4YLEA 5BWOA 5CA0F 1R8JA 4RVSA 4BX3A 3A2KA 1C1HA 3OPNA 1YJ91 4MPDA 5EZ6B 4IH9A 4BQSA 3QE9Y 2NU6B 1H69A 5DEOA 1XMPA 2PSHA 2CNWD 1OBCA 4ZU6X 2VDLB 3VPAA 1K63A 1E59A 2M6NA 3GT7A 3AR3A 4ZQCB 4P3OA 5CEEA 3C3YA 2R751 4ZAGA 4NFLA 5DM60 1Z02A 1WXFA 3QU4A 2E5LB 4J1QA 4AWAA 1C0PA 1B8VA 1M74A 2RGNA 3KR1A 4LPSA 5BT9A 3E2PA 3FAZA 4G0ZA 4PZZA 1NATA 1Q44A 1K8QA 2V54A 4OJQA 3H99A 1W4ZA 2ZRHA 1L6RA 5FOVA 4E0BA 2IKQA 3UMCA 3VV3A 2VFAA 4LV6A 5ILOA 4OK6A 3O6VA 2GKOA 4Q05A 4CQMA 1YRAA 3CMEZ 1ZH8A 3NI2A 2AC4A 4Z7OB 2CHVA 1VJDA 1EA7A 2EHJA 3LTNC 3QKSA 2X0FA 2B20A 5ALJA 1UKZA 2WTBA 2Y1EA 3G6KA 4TVKA 2Y66A 5IBQA 3OEWA 5LMUB 5EJ8A 5IWAB 1T5TA 1F0KA 4W5QA 4YRBA 1MQSA 1VKJA 2WRZA 4BNLA 2H3EA 2F7SA 3WHPA 3ZV7A 2GEKA 2J5RA 3I4NI 3DL7A 3I9FA 1GNTA 2GTHA 4MHOA 3ZDYB 2FP4A 3IUSA 1DBPA 5D1PA 3NC1C 5CJJA 1MX5A 2X5KO 1H22A 3ZHBA 1ECBA 5BQFA 4KPUB 3EVZA 1WV1A 2QAIA 1DKRA 2Z5LA 3E22A 2OT3B 3GVHA 3L4EA 4LRTB 5DTQA 3TVDA 5JQGF 1SN7A 2FW1A 2WF9A 2ZT7A 4TLBA 4PLFA 4RD0A 3GX1A 1A69A 2C2HA 4GVXA 3DW3X 5IXSA 5AI4A 2X8WA 2IYOA 3EHDA 1BO6A 1I3OA 3BWDD 3UFBA 3H18A 2C7QA 2DT8A 1SKQA 3QWBA 5JSZB 1T4GA 2DPGA 2B9VA 3BMQA 3BA6A 2IZZA 3OQBA 4H7EA 3JAMA 2OOXB 2NYUA 2A1TR 5AKZA 3ASZA 3GGPA 5ALLA 4BWYA 3MVEA 2Z3ZA 3AP1A 4HGZA 4MIEA 4BJ5A 4EG0A 5LYJF 3NM5A 4YCLA 3CF4A 3NHRA 1D2NA 4C87A 2WWGA 1T8UA 2PK7A 1SB9A 1VL0A 5DI3A 5K0SA 1DAKA 1L1EA 1BWSA 4RV9A 3OJ0A 2BFMA 2AN5A 3R3XA 1JR3A 4PVCA 2ZRLA 2GCOA 4ABYA 1KMIY 1DTWB 1OT3A 3QWFA 3CKLA 1RTTA 4L4SA 2F1IA 4YQFA 2E9HA 1D6SA 1NDHA 1TL7C 1VKHA 2OK7A 3MCUA 4Q4LA 4U0KA 1DINA 1Z2PX 5DI9A 4FYPA 4Q4HB 1KOLA 2HD4A 2KS6A 3K5WA 4FYVA 4X6UA 1JXAA 4BX8A 4NJOA 3WGQA 4ZOLA 2X9LA 3NJRA 3ON5A 5CUQA 1B73A 3QRWA 2Z5GA 3DCNA 1IONA 2QENA 4EMSA 4YXFA 4RK1A 3BRSA 3LCJA 3DE4X 3EEYA 1G5IA 1VKNA 1Z0AA 2QZZA 4NSNA 4P92A 4PZEA 4FXPA 4YP0A 4OIFA 2ZSUA 3G2KA 1EGAA 1YRLA 2IQ5A 3B9PA 2QORA 4RLQA 2Z4SA 3F3PC 2H9AA 3IQEA 4FC7A 3H65A 3TW0A 4DLAA 5K20A 2ACKA 4BAGA 2XRFA 1NJ2A 4YCCA 3OQOA 4Q12A 5HQ3A 4ND4A 1GZ6A 2QR2A 1DC4A 1R50A 1VQM1 1JU9A 4N6OA 2W4QA 2YWFA 3BHNA 3I9JA 1A9ZA 5K8VA 2NUPA 1ZJWA 3WGLA 5LD2C 4JVSB 1TI7A 1Z38A 3HKDA 5AVQA 3U61B 4ZREA 5FUBA 2HL6A 5LNK1 3KCQA 4Y0AA 3EIQA 4UDXX 1EVJA 2HW8A 3ZVKA 5FWXA 1IJKA 2HK9A 4MPTA 2VK8A 5CA0B 3ODPA 1WA5A 3HO6A 1NX9A 5F7OA 4AQDA 4WBNF 1W5AA 2Q0SA 3BEOA 4CFSA 1Y9ZA 1ZFNA 1P0IA 3HB1A 1EFVB 3WJ7A 4HYEA 1BE8A 2R11A 3FR7A 3SXUA 1UFKA 1RXCA 1RC0A 3LUKA 1W2GA 3WKAA 1PZFA 3KFXA 4I81A 4LBZA 2Z5FA 4M3NA 4HAOA 4F93B 5CB8A 4AJOA 4I55B 1E8MA 4X5OA 1FFBA 2G70A 1FBTA 3N2YA 1T1RA 4YPOA 3D1JA 4ZMBA 3LA8A 1Z13A 4FYHA 3DT9A 3OQNA 3IX7A 1Y6FA 2IUEA 1R88A 3EAGA 5KYUA 2R6FA 2EFEB 1FDIA 5B1EA 2XQVA 4KK3A 3H3JA 3B7PA 3SEAA 4C7XA 3VH3A 3CVUA 4MW7A 1OA1A 3P5BA 1JQEA 2VNIA 3VX3A 1HRKA 2IUSA 1TW2A 2JGLA 1GCIA 1Z0FA 2NWQA 2XOKA 1TB4A 4IDEA 1X3SA 1Q1GA 1RCFA 1TZJA 3WLMA 3CJRA 1Y3AA 1LQTA 5JJKA 2QVBA 3ZDAA 4GXQA 1VJRA 4B6JA 1VGQA 2WIDA 1EAYA 4X41A 2AJBA 3WMEA 1E4EA 4EVIA 3V55A 2NO9A 4ZZ1A 5FUMA 3LBNA 4UC0A 3GFFA 5B1SA 4V0OA 1E2KA 1SVUA 2IUFA 3DO5A 4AZVA 1UMCB 3NS7A 2A0UA 4CMKA 2JKZA 4ZFNA 4LF8B 1S8FA 2HDOA 1A96A 1YK1A 1ZCFA 2HA2A 5L3QB 4XWWA 1WQ1R 2J30A 1PRYA 3E5HA 1VG8A 2Y0DA 6GPBA 3WTBA 1IG3A 1F60A 2VXCA 1UFVA 1Y5MA 3NETA 1X0TA 2R79A 2XWQA 4ACBA 4UNPA 1K9M1 1KQGA 5DHRA 5DN6A 1EHYA 2ZW9A 3VJRA 4ITUA 4GEKA 2FETA 4XJSA 2DBQA 4JP3A 1G20B 1JG6A 3ZG6A 2V8JA 1ULZA 3CO0S 4EO4A 2GN0A 4YN3A 2P62A 4RJKA 3S28A 4IDGA 2QL6A 3HL0A 4YI5A 1YI21 3U4HA 2VP2A 4D42A 1M0EA 5SZKB 4C0HA 3CHYA 5TRTA 5LYJB 1UOPA 1P81A 5FLEX 5ITSA 4TSKA 1EFLA 1YR9A 2YY7A 5H81A 3SZOA 3O7MA 4B8ZA 2J45A 2WWFA 2BFWA 3F5QA 4BMDA 1XNRB 1H23A 1FP1D 5B58C 3L8FA 3PITA 4ALMA 1XYYA 2AG0A 3CXCY 2EFYA 4U63A 3HNPA 4DCVA 4Q1AA 1I94B 4N40A 5LLTA 2DWCA 3FF4A 3ROZA 4YT4A 3CVYA 5E95A 1DXQA 2VJMB 1AHPA 4U0JA 2OXEA 5IHXA 1KEEB 4FMDF 3LDUA 4F4CA 2IS4A 3FLBA 4L07A 1WXGA 3O83A 2EX0A 3NKFA 4G5FA 1O0CA 1RVDA 5G4KA 2L2QA 1XLTA 5C32A 5KYXA 2OB2A 4I8IA 3FVWA 1E2MA 1E4YA 1UC9A 2VSOA 1Z4QA 1E1NA 2OZVA 4R71A 1A9YA 1GT6A 1VRVA 1JIVA 4S05A 1AKQA 1RW4A 4AZ0B 2YZMA 4IG9A 2NNWB 2DHDA 4E14A 2X4LA 4JVNA 2A4MA 3M3HA 2JI7A 3OT1A 2BGRA 2JCBA 4B4UA 4UUOA 1U5AA 5GTDA 2JS4A 5K7SA 5T8KC 1CZRA 1Z2OX 2WFMA 3Q4GA 1FFXB 5JMTA 5B3JA 2PLNA 1ZINA 2DKFA 2FW9A 2QVYX 1ICIA 4IIDA 5KSOA 4HNQA 3GJ8A 4WLEA 2R1VB 2VYQA 1L5KA 4G5SA 3QTBA 2BUAA 4QUEA 1VG1A 1UR5A 2CUNA 3R44A 2Q6VA 4QD3A 3O7WA 1R37A 2GPBA 1T5LA 4W1QA 4MQLA 1ORDA 3MC1A 3GW8A 5EQDA 4B48A 1XJQA 2LCFA 3GCFA 2QTCA 2Q3EA 4Q9NA 2HR1A 2VYNA 3HI6A 4K9NA 3A6HA 1FFAA 3FI0A 3K73O 3U9TA 2C9BA 1JDBB 4OHRA 4WXYB 5EJ9A 5LPNA 4RESA 2A33A 3PQFA 5EEGA 4Z53A 2PANA 3T5DA 5GQSA 2Q5OA 2J67A 2KPOA 4HVLA 2GFHA 5DO9A 4WBNB 1ZS9A 1NVTA 1N75A 1A7KA 1AGNA 5JS7A 1YQ9A 1EUDA 5K0GA 3Q5DA 3ZS9A 4B2YA 4E2FA 3WP0A 3BKWA 1XMIA 2BOVA 2BGJA 3I61A 2EYQA 2NX2A 5CLHA 3Q1KA 2XQIA 1ZAKA 4KUEA 3BB4A 3WGKA 3WIBA 4DEVA 4UOZA 4X3PA 4ZGWA 4BZXA 4BMPB 2AK3A 4URZR 2EGHA 1GV0A 2ZBQA 2K2WA 4HDNA 1CZUA 1F2TB 4IPTA 3V4RA 4ZI2A 2OSVA 2UUAB 1PR0A 2PRKA 3H0GI 4X91A 1MV5A 3B85A 3ROKA 2WTNA 2O1XA 4M1YA 4OI4A 2QNBA 3G5LA 4N48A 3DBRB 2JGFA 1Y3CE 3MT9A 4XJXA 1Y1KE 2R6GA 3QE3A 4CN9A 5BSUA 2YXNA 3GGOA 2E2WA 3N0XA 5FNVF 2DPHA 2JAHA 4MP3A 1P3JA 3EVDA 3LT0A 1XD9A 1UMBA 1ZD4A 3OUTA 5IAOA 1CEEA 2EQAA 1NP6A 3ISTA 1XEXB 1ZSNA 2VCYA 3U3JA 2WNHA 1CETA 1AMOA 1Q2XA 3U6BA 3LRXA 4FIDA 4JYMA 3OUUA 2QRNA 1K06A 4KQXA 1YHYA 2BHTA 3NHAA 2HSDA 4YONB 4YV1A 4Z4IA 4F5EA 4RSHA 1CRPA 1ZUNA 3J81f 2VLIA 3TX2A 1VJ5A 3I6IA 2VTBA 5BN3B 1BYIA 2EGGA 3LHIA 4LDJA 4MUEA 4JB2A 2BKXA 1ENYA 2RI6A 1W4LA 3ENNA 4TTPA 3S6JA 4CM4B 4BFWA 2WQ7A 3P2MA 5M3BA 2YRWA 1KC3A 4BO4A 2OG2A 4NJEB 5JS2A 1SURA 2ATIA 2QTFA 2RHWA 4P86A 5A6VA 1E58A 2QA5A 5KU7A 4Z4FA 1JHMA 4MWEA 1JJBA 3JVEA 3FVQA 1EP3B 1JPVA 3NC0C 3QVOA 2DKOA 4DJJA 3AIKA 4BGIA 3K2BA 4KQJA 2X2OA 1A7AA 1FTYA 3QMVA 5I9BA 2G5TA 3G0OA 1AUQA 5H1YA 4IFTA 4R2MA 4HF7A 4ETMA 2M1ZA 3RS5A 3H5RA 1JLSA 2O3UA 1JJVA 4LX8A 3L2OB 4LSZA 3MTGA 1PD0A 1UM8A 1WHTA 3R0ZA 4RHEA 3PDWA 2PPVA 4Q4JB 1N6PA 2YQZA 4DA7A 4Z3KA 4Z7NB 5ALDA 3HCOA 1T0IA 4UFPA 1LLQA 3JWHA 5K05A 8MHTA 5JJIA 3K4QA 4JP2A 2HCFA 3OPVA 1SKAA 3N07A 1PVOA 2OCBA 3CU5A 3MGGA 3CT6A 1J0XO 3ZGOA 1KC1A 5KHAA 3TL2A 2FR1A 3CS3A 2IYWA 3EVNA 2AZMA 3JVUA 3FRHA 2OTLZ 4OGFA 2WJJA 2X4DA 4FMDB 5CLIA 5JMPA 2CHQA 1FOEB 2VXYA 4FNAA 4DQLA 2RAVA 3NOOA 1XGKA 3WWYA 3AUAA 4HVTA 4AYWA 3N3BC 2QGZA 1NUAA 1WQ3A 2F3RA 3F5SA 4KO8A 4CL3A 3OEHA 2REBA 1DDIA 3RS3A 4DIFA 5J4HA 3ABZA 2WY2D 2VF7A 2P4UA 2ZLBA 3IR7A 3GLIE 5AESA 1IJFA 1Q1QA 4EITA 2WPDA 4JNKA 3BCUA 4WKGA 3LK7A 3NWEA 2Y1OA 2X3UA 1C2YA 1K8A1 3CX4A 4JLJA 5EMJA 2A7XA 2VL7A 2FFQA 5G1PA 4UBOA 2FA9A 4Y8VA 4N0DA 1DKMA 1JLLB 1JSXA 2C99A 4A3MI 3MWFA 2AHRA 3TPFA 5BQXA 5IANA 2FZCA 1N5OX 1CIJA 1WSBA 2KM1A 3H5WA 1WIWA 4P53A 5CB4F 1XWWA 1V3QE 1Y1VI 3T94A 1YCDA 3FUTA 3AOGA 2D74A 3HN2A 1OR8A 3WL3A 3K6SB 1MIHA 1NVAA 2CHFA 3DBVO 2ANCA 3VR4D 4D8TA 2NZ2A 4E6EA 4FWTA 2ZGVA 3DOFA 2J5QA 3TQSA 2Q1YA 4Q9JA 4FOOA 3L5KA 1BXRA 3ANMA 4PZ9A 2ZSEA 1N7JA 4RV5A 1RXEA 5E6SA 5G2OA 3DE2X 3R3SA 1V47A 4M0UA 3VU8A 3KTOA 5JO0A 4LDPA 5KB3A 1BU8A 2B78A 4IXNA 2H52A 3D8BA 3DKVA 2Q3CA 4E30A 4F6RA 1U31A 4NVRA 3KTAA 4PLYA 4I3HA 5ALTA 3ZWVA 4UVEA 1RR6A 5EQTA 4U6SA 5CD1A 1X38A 1Z0DA 4LNUA 4O1HA 4S24A 3G9ZA 1Z16A 4PWZA 4CCSA 4LJ6A 4LOKA 4CEHB 1O96A 2IOQA 4XRRA 1NP7A 1YIOA 3CPHA 3EEFA 1QU3A 1O9GA 2W04A 4DJDC 5KX5F 1L0BA 4E5PA 4QRIA 3PA8A 1YK0A 1E9SA 3IA7A 4WNYA 5K6TA 2WWYA 1FJXA 1YI8A 2CF5A 2XHEA 4M0DA 5AUNB 2EZUA 2QTVB 4BN4A 1JKJB 4WNCA 1BXKA 1TUEA 3C6MA 3FCOA 3GAAA 2ASEA 3OU7A 3PHLA 4GLOA 1QYPA 4QPDA 5CH3A 1XXLA 4CMGA 3IXLA 2VUTA 3U6KA 2H4ZA 3IDQA 2G0NA 3KPWA 4PHTA 5JW6A 1J2YA 5DCWA 4HRAA 1WXDA 3SF0A 3GCGA 4J2OA 3UHOA 1NN1A 4XW2A 1O9BA 3PJRA 3UW1A 5AVWA 3UWKA 2ZSJA 2IELA 3HJRA 1LI4A 1UPUA 2PGOA 3UZUA 1YDEA 2IQIA 5DNYB 3DUFB 3KEQA 1GCAA 3JSAA 1Y3BE 3U1TA 3WB9A 3GAMA 4BNFA 2XRZA 1EGQA 4I0WB 1O5TA 4GGMX 2GASA 4FS8A 4KRGA 1H2RS 3EGXA 3H9CA 3PZRA 3TIGA 3UMFA 2VN8A 3RFXA 4A8JC 5JASA 4K9OA 2YFYA 4BCBA 4TS9A 1T0BA 1VTKA 4A7PA 5IWCA 3ZDDA 2I1LA 2XB2A 4NBLA 5TPZA 3DLHA 1JDJA 1SD1A 3DFMA 3ZQUA 3I56Z 5JI3E 5JYEA 1N5DA 4BS9A 4LC1A 1V7QA 3FTPA 3KR9A 1ZW1A 3DDHA 2DFKB 3R6GA 4QBTA 3LL4A 4U7DA 4G25A 3OQ6A 1SKYE 5A3JA 3GLGA 4EGCB 1B43A 3TH5A 1L5GB 1HY3A 1IAQA 1MOSA 4B80A 4YCSA 1PJZA 2AEJA 1P33A 3BZUA 1UBRS 3CN9A 3OP1A 3HZHA 4MAAA 2YCBA 3DD1A 4NENB 3A14A 5H9VA 2J9GA 4XB2A 1JH9A 5J2TB 1TYAE 1J1IA 3L0DA 4HPJB 4EP1A 1V6AA 3MZLB 1RSZA 1L5OA 1PFGA 2QTAA 3GH1A 1BNCA 1NULA 2XMCA 3DDOA 3F96A 1BJRE 3AVPA 3HCAA 3LY9A 3CNHA 1MP0A 1ZN2A 2YMQA 1X1TA 4MYCA 1J8MF 3ESRA 3JD1A 1IQPA 4D97A 4IRMA 4WLVA 1QTIA 2AJDA 2FN8A 1P1HA 2VDMB 3KDPA 4PZDA 4WSOA 1UOOA 3E9DA 4YGYA 2BSAA 3RW9A 3WO1A 5B1YA 4AJ1A 1SVSA 5KTRA 1R0ZA 3KPVA 4DCGA 1ML3A 1OA0A 3K05A 2WKQA 1Z6YA 1VE5A 3NFZA 2GM9A 4FOLA 3ZBTA 4AMGA 4D9KA 3WI7A 3N2GA 3EZFA 2E5WA 1IB6A 1XRPA 2PMBA 1FQWA 3A05A 5LQMA 4PTLA 3LXRA 4BNWA 1C14A 1RC8A 1T8RA 3VRHA 4XM0A 1GTRA 2QTWB 2SKCA 4GAEA 3TSWA 1MAUA 5HZMA 1R8QA 3H9BA 3DHNA 5L53A 2FE1A 1KDYA 1GL6A 1TX4B 1UQTA 3SSAA 1TU0A 2BHNA 5H80A 1ARZA 2JA6I 2XECA 2F4VB 3H1AA 1I6WA 4F4IA 1O87A 1B6SA 2IDJA 1EVZA 1GN9A 2AUTA 2WUEA 1P5ZB 2B2XA 3IJPA 3K1AB 1FDRA 5AP9A 3KV1A 4R9RA 1DI0A 2FDXA 3SIPA 3D0QA 4GHWA 3I62A 1C30B 1Y4DE 3PD0A 1TQHA 3G4SZ 3B78A 1CHNA 2WYIA 4TT3D 5CR9A 4G01B 2VZ9A 4RABA 3W8NA 2QRGA 3EF3A 2B3TA 2IHUA 2YDYA 3K0AA 4URYR 4KPYA 4JI0B 4PNZA 1XLUA 4NFSA 5A4MS 5CGZA 3SNKA 1THGA 3I3SR 3LWBA 2QYSA 1LSUA 3IJEB 4LZNA 3IPCA 5KOIA 1QPBA 2EWVA 1K9SA 1F5SA 1FFGA 3D6HA 1TQ8A 3LJKA 1XP5A 4NBVA 2G08A 5G41A 4G24A 1LNSA 5GADl 4BBJA 3D0RA 4RMHA 4PAQA 3VU0A 3KUKA 1XZ8A 4AJ4A 2BIFA 2XMZA 2WHEA 1GTVA 1R16A 1B93A 3UH0A 2JA8I 2OGZA 3TLKA 5C1BA 2VS1A 3OCWA 1MR3F 1WBJB 2NPOA 1PS9A 4RH1A 4B17A 5TSDA 3CV3A 2Q2VA 1DEOA 3OJFA 2FUG1 5CNIA 5LB4A 4XUDA 3CXUA 3T9CA 1H3EA 1VJCA 1EVQA 2E85A 4TWZA 5CB6A 3AP2A 1T5BA 2FX5A 2F55A 2AA3A 2QVXX 2ZB3A 2H8GA 1PNOA 1PR4A 3PGJA 4KN9S 2D5BA 2FY8A 4LRXA 4Z3OA 4O3MA 1M6WA 2ZG6A 4Q01A 1L6IA 3T7EA 3O3OB 2D0OB 2IH4A 4JMPA 4LVCA 5HJ7A 1AQIA 5JVDA 4V0ME 2YS7A 2RGYA 4XFDA 5GVSA 5JBIA 4NONA 1O1YA 2J4CA 4RFSA 3VH4A 3KU4A 1JR4A 2AG6A 4RKFA 1QH0A 1E6WA 1SPXA 3V1YA 1QYIA 1O03A 2AD5A 3UAZA 2IP1A 3C5WP 4RJ2A 2HO5A 4PRKA 4B3BA 1MIOB 1MW9X 4QJ5A 3D0OA 3K72B 4EEZA 5EHGA 5EMNA 3SLGA 4V39A 4RPGA 2O06A 2GI4A 3QOFA 1ISIA 4BUJA 3IDAA 2I2BA 2IODA 4MVJF 3HN7A 3LDFA 3FFTA 5C34B 1K98A 1KMCA 4RXUA 3BFPA 3TTVA 2KI5A 3A1CA 2AZDA 2ABWA 3FVRA 2EEPA 3GDOA 5CYPA 4OFWA 4BFUA 4MUHA 5KPDA 1HEIA 3AJ9A 2FB9A 3NRJA 2W6QA 2PGNA 3B9RA 2M6KA 3JD4A 1EB9A 1R0WA 4PLTA 4RADA 1IU9A 3R3VA 4YAWA 4ZT4A 2FV8A 3Q6NA 3E2IA 4AW9A 1GT91 3BWMA 1WDMA 2ZJ2A 1ZJZA 1DRJA 4HX5A 5BW4A 5E7QA 3FPHA 3LLCA 2EGUA 4KGDA 5EXPA 3OFJA 2AR7A 4DLSA 4TV9F 2PKRA 2LUOA 3DM5A 4QDXA 3MSXA 2D1SA 2OHGA 5AXAA 1GUDA 1QFZA 2VCEA 3BILA 4KWIA 3VPGA 5JQGA 2OXRA 1NQAO 3R0QA 4QA9A 1AMNA 1ISGA 3K09A 1OH7A 3PDHA 1PYOA 1N8R1 3MRXA 4RIIA 1NVBA 1OXUA 3FUVA 3U7GA 1RLUA 2JFNA 1DCMA 1QGOA 4ER6A 3ML1A 2IY7A 1OZGA 2QUIA 4Z1OA 5KNLA 4MUJA 1IPHA 4HEA1 2QX4A 4N5DA 4OF4A 1I0ZA 1QB7A 3S0JA 1WL8A 4WZAA 2P9GA 1TF7A 2EBWA 4REOA 3JQRA 2AL7A 1UMDA 1QFYA 5T4BA 4BXOA 1E3WA 5H8WA 4KPEC 2PEZA 3TZEA 4ZYUA 4G0OA 1RE0A 1W0JA 3I8SA 3ORYA 4R2WA 1WVIA 2F4OA 2RBGA 3REFA 3GEPA 3K2QA 3VAZA 3O4FA 4ER3A 1JX6A 4IIEA 1N2OA 4FMPA 3WSTA 3FYTA 2HA3A 2VDVE 3GLSA 1N4AA 3BCHA 1VI2A 2A5DA 2XXAA 3UENA 3AERB 5AJUA 4I5GA 3B48A 5DNCA 5AK6A 1RWQA 2D2FA 3LP8A 4GSKA 4JUFA 5T5QA 2BPOA 3ORSA 1U63A 1IEVA 1RYNA 1YSCA 4J16A 4YRSA 2H31A 2XUKA 3UJ8A 1OXTA 5ILGA 4GZ3A 1G55A 1SK8A 4BZWA 3DTNA 3AP3A 3NTLA 4U2GA 1O7JA 1W88A 2FOLA 2YZ2A 4TQUS 5FO0A 4JXXA 3DDCA 3L0OA 2C00A 2BDTA 2Q9AA 4UPDA 2XCTB 1Q2UA 1OWLA 1GO2A 3OOYA 4BQEA 3P9ZA 4RS4A 4X97A 1ZD1A 4AS1A 2OC4A 4WADA 4Z4QA 2Q5FA 1NR5A 3VDRA 3O4GA 1UM9A 1H0HA 4QFMA 3Q7PA 2VLBA 4HAVA 1WB6A 4TLCA 4HEQA 4YRCA 1II9A 2R47A 4Q4CA 1NJI1 4C1NA 1G16A 1QIMA 1OFIA 5FXMA 1G2PA 4M87A 1MNQA 3KEMA 2QF7A 1ZM2A 4V3BA 3UBTA 2YDXA 3O8LA 3JQPA 1K2VN 3AUKA 3P4YA 4RMJA 1SXPA 1S72Z 4R0VA 1N8KA 4X6XA 3ED1A 4AY6A 1I0LA 3MQ4A 1EESA 4ZVPA 4TLDA 4DNQA 1K5GA 1T1GA 1VQK1 1SR8A 4MDHA 1C4KA 1J5XA 2IHBA 2GF0A 3DDUA 5EP3A 5AR1A 5F3DA 4V02A 4EQ6B 1ECFA 4WBNA 5AVXA 4OB7A 4W7HA 2JVJA 2XSZA 2W2QA 4HEJA 2G7ZA 3UK1A 2O48X 3HGQA 3ND6A 1COWD 2XUAA 3RKUA 4CF5A 1L1RA 1W94A 2NZVG 1AM4D 1NN5A 2FJPA 1KEKA 2BEVB 1BW9B 1HMYA 1W5BA 1YVRA 4V0SA 2D1FA 2VAMA 4P31A 4P32A 2X13A 3T41A 1KMHA 4Q3DA 2WSMA 1I3NA 2CZCA 2Y1CA 4B09A 4ZZ0A 2UKDA 2JJ1A 4R1UA 4DLTA 5L51A 4UHFA 5I7WA 2RBLA 1FSGA 4I4IA 3VU9B 5HW0A 3SWWA 3CD61 1F2TA 1S96A 4PRYA 2ZREA 3CC21 4A2QA 3I5YA 1PZGA 4JFRA 4XVRA 5JS8A 1TLTA 1I7SB 1VPTA 3N2KA 3ORRA 4TLLB 4ZGBA 3WIVA 1IFXA 1K89A 4AN1A 3DT6A 2PS3A 2V7TA 5TQ0