2GTHA

Crystal structure of the wildtype mhv coronavirus non-structural protein nsp15
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
370
structure length
348
Chain Sequence
SSLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKRSIRPHPELKLFRNLNIDVCWSHVLWDYAKDSVFCSSTYKVCKYTDLQCIESLNVLFDGRDNGALEAFKKCRNGVYINTTKIKSLSMIKGPQRADLNGVVVEKVGDSDVEFWFAVRKDGDDVIFSRTGSLEPSHARGTIFTQSRLLSSFTPRSEMEKDFMDLDDDVFIAKYSLQDYAFEHVVYGSFNQKIIGGLHLLIGLARRQQKSNLVIQEFVTYDSSIHSYFITDENSGSSKSVCTVIDLLLDDFVDIVKSLNLKCVSKVVNVNVDFKDFQFMLWCNEEKVMTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
publication title New Antiviral Target Revealed by the Hexameric Structure of Mouse Hepatitis Virus Nonstructural Protein nsp15
pubmed doi rcsb
source organism Murine hepatitis virus
total genus 91
structure length 348
sequence length 370
ec nomenclature
pdb deposition date 2006-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2gthA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gthA02
2OZKA 2H85A 4S1TA 4RS4A 2GTHA 2GTIA 2RHBA
chains in the Genus database with same CATH superfamily
5JALA 1UJMA 4IRMA 3UV6A 1LLDA 4L5JA 4Z3KA 3D1JA 1KD11 3NH4A 4RPHA 1Y5IA 4OXKA 4BC0A 5A4JA 4G8BA 1A98A 4BUJA 1D9ZA 2HJSA 4C7BA 1FRNA 2WHEA 4CL2A 5C7YA 1YJNZ 1CEEA 2PS1A 3BMCA 4JSTA 1NOJA 4BNUA 4EJSA 1KY5A 3L3BA 2FCAA 3FMPB 4JAVC 4YWJA 4QPDA 3IMCA 2ZAYA 4TROA 3TOZA 1X80A 2JGJA 4LZOA 3BGWA 3EB9A 1M6NA 4HDSA 3UMBA 4B5KA 4J2HA 1VJDA 2AOXA 1RJEA 2ZAIA 1U4OA 3F98A 1SCUB 4S3MA 3ZHYA 1QRUA 4IGAA 2G7ZA 2QLVB 1PWHA 3L7YA 1VYHA 2JLBA 2O2CA 4UPVA 3ZZ0A 4U7JA 5JH7F 3GHYA 3PUWA 4G8DA 5IANA 4WZZA 4EPYA 3HP1A 2OTLZ 4RF5A 1UBOS 2OHFA 2RHOA 2K3RA 3NCTA 4FR2A 4OUKX 1EVIA 3ZWOA 4EVSA 5F7ZA 5K0LA 1UZUA 3CCLZ 3HJCA 1WUJS 1USVA 3FZEA 3UK6A 1C29B 2Y1DA 1CR6A 3QSYA 1K2WA 1UDXA 3DQPA 1ECJA 2F3UA 4M7OA 1IQUA 3LK6A 4WZBB 3D2BA 3S17I 2HC9A 3D8TA 1NSTA 3TX2A 5MFZA 2QOEA 1BWRA 3A6FA 3S1AA 3IAS1 3UJCA 1BHSA 3UMCA 3DM9B 2BI4A 1CRZA 2H2HA 4QUHA 4BPRA 1C30A 4MCAA 2BZGA 3SQOA 4KXFB 1HOXA 2HBYA 3ETHA 4DCJA 4JP2A 4TV8F 5DMHA 2XIQA 3EW9A 1H9CA 3DTYA 1E2FA 4S1NA 5AKKA 1Z88A 3DUFA 1IHUA 3GGPA 4O25A 1DO0A 2B99A 1G41A 1MAAA 3JQFC 4X60A 3BL8A 3DBHA 4HLQB 3W9BA 3ZXXA 3IBTA 1U3VA 4GQBA 2P4UA 4PNEA 3SIRA 2ZR8A 3CUWA 1V3TA 1G19A 2QMOA 3B3AA 1HLDA 2XTZA 3KPJA 3KQQA 3QLEA 4HDQB 4QUGA 4URWR 3QIAA 2E4ZA 3P4XA 1EIZA 1G8PA 1QGUB 2QTHA 1CUGA 3FTDA 3SQWA 3FPHA 1YCFA 2YC4C 3R44A 4MW0A 1A4IA 3CSSA 4KE8A 4ZA2A 3K6RA 3T3EA 13PKA 4MEJA 4RXMA 1L8QA 3IF8A 3NV9A 1JF8A 4L8GA 2AVDA 4UTRA 3D7LA 2OSVA 4QXPA 1JB9A 2DPXA 2GCOA 2XMSA 2C98A 1HYQA 2QTMA 4RV4A 3PDIA 3UFBA 2QENA 1VRWA 3VPDA 4KUHA 4EBFA 5A3JA 4EFKA 2WJJA 5JU6A 3ZX4A 1JPUA 1TJYA 2HU9A 2HCJB 4H6PA 4D9NA 1QOZA 3IX7A 3L0DA 3VZSA 4TWZA 1N0WA 1Q5PA 4H15A 4W1PA 4DLYA 2Q3EA 5MN6A 1OIWA 2WAOA 4RH1A 1FNMA 2YN2A 1G98A 1SCNE 2CCGA 3WIUA 3LBIA 4X7RA 4INOA 1XL1A 3JZIA 1NVFA 4KYVA 3M3DA 4PAQA 2HRZA 3HM9A 1RJGA 4IHQA 1PGQA 3AUXA 3BXHA 3WNCA 3ZVLA 1KQFA 1M2KA 1VIDA 4HB0A 4EO4A 4K9PA 4F6RB 5JYEA 2BFEB 3GJXC 1Z62A 2VJBA 4FDTA 3HJNA 2OFXA 2OR3A 4I1YA 1N7IA 3HJGA 5JXJA 1I6KA 3RVRA 2H4FA 6AT1A 3AEYA 4RQTA 4WOCA 4Y67A 4D97A 3EZGA 4CMCA 4P0TA 1WIWA 1GZ7A 3GVXA 5IJZA 4GBED 1ORWA 1F2DA 2VQ6A 1J0XO 3L8GA 2P0AA 1QQ6A 4J0IA 4ZOBA 3E9MA 3LZ6A 1N8TA 3U44B 2Z3ZA 1B0ZA 1TPZA 5BUQA 1SU8A 4COKA 3WDKA 1SUFA 3KD3A 1IB6A 3C5VA 4PLYA 4Q1DA 1OH5A 3VC2A 2IXDA 4KE9A 5I7FA 1N2CE 3LOPA 4MVJE 3ASYA 4L78A 4TV8B 4YJHA 2R8ZA 4EHLA 5TY0A 1VQ71 2QJTA 1CP3A 2WD8A 4IS3A 4BQSA 1HNWB 5T5QA 4AVYA 4O3FA 1V5EA 4IZHA 2VDJA 1TIPA 2Q2VA 1SHZA 3ZHRA 2V9PA 1NURA 1Y6ZA 1BWSA 3DDCA 2QVCA 3AB3A 4M1YA 2W2LD 4AMGA 2FCRA 4F9EA 1CZRA 4WECA 2O48X 4LJ9A 5EVCA 1KS2A 1USPA 1IXSB 1OLSB 2O07A 4LJAA 3ZK8A 1E3EA 3AFOA 4EARA 2G1PA 2E2HI 2X1HA 2I62A 4HLCA 1OBFO 2WMDA 3CXRA 3KO8A 1DXYA 1EK2A 2CLKB 5FPQA 3WKAA 5K0ZA 2YRFA 1YRHA 3BWYA 2EJTA 5EMNA 5FQOA 4ZVTA 1JDBC 2H1VA 3LVQE 3HDGA 3I45A 4TTRA 3ZX5A 1LPBB 1OU4A 3GN1A 4XWTA 1U0EA 5K8IA 1UPAA 2DWCA 3KSUA 2F1OA 2EQBA 1THTA 2M32A 4EGAA 4MYRA 4FFOA 1LLFA 5HBRA 1KZ4A 1M2GA 3LFUA 4K9NA 4WN9A 5ECWA 1NAHA 1D6JA 2V97A 5DNUA 3N86A 3PQDA 3G23A 4H4CA 3W1WA 3T54A 3M1YA 4OHXA 5JFOA 1QF6A 3M33A 1ZISA 4P08A 3EFBA 2ALJA 2JW5A 1GG2A 3UOWA 1R6TA 3O4GA 3HY4A 1FOEB 2RB5A 4KWIA 2ZE6A 4L0DA 3SJZA 1GGHA 1PN3A 2I3ZA 1WZNA 2YHUA 4FLEA 5BOVA 2I65A 3FD8A 5JZMA 3QPAA 1IWOA 1RQRA 1G16A 3WL5A 1WB6A 4Y1RB 3HBNA 3NFZA 1QRSA 4FZRA 4MLZA 1JHMA 3B1JA 1MH1A 3WYAA 2ZJOA 1O87A 1T4DA 3LWDA 2VDPB 3OTHA 1X3WA 1EBFA 3DOFA 4PR0A 4CM6A 4CN8A 4RETA 4DUGD 2UYOA 5U1PA 2HBQA 4Q9AA 3EIXA 4MD9A 2HRRA 4PTYA 4XYBA 2JS7A 1WCIA 2OGSA 5CVCA 2RHLA 1QHNA 3WTCA 1PL6A 2NO4A 3EEOA 1L4LA 4L9WA 3NJRA 4B4DA 1WQ4A 1FDWA 3WIVA 5BN4A 4OYRA 4R2IA 4XUEA 4DMCA 5JMOA 1P4GA 1E5DA 3PGA1 3VR6A 4EYEA 2PZFA 3C74A 2N1MA 3JVVA 3OX4A 3UY4A 1WMBA 3K8YA 4ZVMA 1CULC 5E7JA 4AS3A 3G02A 4Q00A 5FFNA 1KTVA 4RH3A 4IM7A 5IHXA 1V26A 3F3KA 4IICA 2BMFA 4IUDS 1CUDA 4P92A 3RS9A 4LDZA 4UBKA 3G9ZA 5ITSA 4NYJQ 1QYRA 2G6TA 5AVXA 2PT9A 1KI8A 3EQ8A 4N0MA 3JSAA 1SU6A 1T2UA 3WHLA 4KXWA 3FFAA 5KWVA 3TM4A 3WK5A 1OU0A 2W03A 1GYPA 1HMYA 3AINA 4P7FA 3A06A 4G0VA 1OI3A 1X1RA 4D9BA 4QA9A 4BLQA 1RZUA 3GRVA 3FTFA 2VJLA 5BWBA 1LFAA 2GCOB 4GECA 4QU5A 1Q21A 3WZLA 5F35A 3CLRD 2LCFA 1KEUA 1M2OA 3C3DA 3HM2A 3PDWA 3PPVA 4PSCA 5GJBA 2PGIA 3P2IA 5CEEA 3DG9A 3MS2A 3M5WA 2AC7A 1YB4A 2AJ8A 2I6TA 4DMMA 1NGSA 4B6GA 5HJ7A 3PFCA 4JSYA 5BN5B 3VMFA 3CZCA 4CRWB 4A5OA 3TLMA 4DA9A 1ZFNA 4QIHA 1CNEA 1RAHA 5LFAA 1VE9A 1TU3A 1SUWA 2VJPA 2WIKA 3PNKA 4Y2VA 1KZ9A 3JZAA 1BGWA 2D1FA 5EIEA 3KS9A 1II0A 1E2UA 2CWDA 2WJGA 3Q10A 2JVKA 1JVSA 3GKQA 4YI3A 3WRVA 1E0JA 4D3XA 5C18A 1QIJA 4B6QA 1QKIA 2QJOA 5EHIA 1EFCA 5T6MA 4FR0A 5AVRA 2BHTA 5LMUB 2HAEA 3Q11A 4XIJA 4X1KB 1GKIA 2ECKA 3H1PA 4L95C 3MFYA 1ZB8A 1U5BA 2NAPA 1I1HA 2Q3MA 3C4JA 3JTEA 3O21A 3BCRA 1OBOA 4J1QA 4TTPA 1BVHA 5L9AA 2JGDA 4QFBA 1RXSA 2OG1A 3RBVA 4AURA 4JDPA 1XU9A 3C6MA 4P54A 2BMAA 1U3DA 3UKJA 3WR5A 4PZZA 2VZ9A 3OKPA 1EDDA 3IIIA 3AVUA 4YQYA 4UVIA 2MSEB 2COKA 2PBLA 1D1TA 1XO1A 4GZ3A 3BX1A 4ICIA 5I7OA 4NECA 5LQJA 3HK2A 5ILQA 3H5IA 1M6VB 5DRTA 1TYAE 3L0ZA 1GTVA 1NXQA 5ELXA 1LF5A 4DSNA 4TTSA 4JB0A 3LQ1A 4P32A 3RS2A 3QVTA 4EPXA 1GNVA 3O75A 4D6YA 4ZV9A 5C5CA 3DAPA 1J9ZA 4CKWA 1Y33E 1HKUA 2N0SA 4TYPA 2XNDA 5IBCA 4Y98A 1EFVB 4FTWA 5JANA 2GN4A 1YDWA 2B92A 2FLWA 4JEUA 3VVMA 4JNCA 2IDJA 2Q6TA 4LNHA 5CXQA 1Y1PA 3PFWO 4YGXB 3DOCA 4BQFA 3BN3A 4PS1A 4ZO7A 1X7HA 1GAEO 2RH5A 3C7AA 3HCOA 3I12A 3LTEA 3D8UA 4M60A 4KO2S 3SC4A 1B00A 1TM4E 2WTEA 1M72A 4V0OA 4CKEB 1CR1A 2WIAA 4YAJA 3T06B 4FFNA 1ADFA 2Y76A 1CUIA 2ZXEA 3EASA 2YMLA 1XWFA 4P35A 4KR9A 2OV1A 3B6IA 5EUBA 1XVAA 5A06A 3BILA 1MJ5A 3AESA 1VLZA 3L41A 2C5AA 4N82A 1U65A 4NAHA 2LDXA 1E79A 3S8YA 2H3EA 1UXKA 4N54A 1N2EA 1HYEA 4J7AA 4BY1I 1W30A 4RV5A 3GBPA 1V7ZA 3DHYA 3K05A 3DCIA 1T9ZA 1BA2A 2DC1A 3GT3A 2GN1A 3E7XA 3G82C 4Z5XA 4LPKA 4FUTA 1QO0D 1H3EA 1RHJA 3DXZA 4G09A 1ZAYA 1FYWA 1WNFA 2P8JA 3K20A 3R8FA 4UVEA 2V6BA 4C5CA 4B7ZA 1QIHA 4GX5A 4H6XA 1JJBA 4QVGA 1DEKA 1Y1WI 2DQKA 2VIIA 2QVZX 3H16A 3JYHA 2B6NA 1Y4ZA 3ORSA 1YIAA 4MKGA 4WJKB 3WISA 2PZMA 5JY6A 2NSYA 5DJ5A 3RSSA 1XEWX 2V7EA 1E5TA 3HP7A 1A8QA 2I6SA 3FLBA 3R3SA 5DHAA 5A04A 5AVJA 4ND1A 3FPEA 5A4FS 3NV7A 1OV6A 1L4EA 4FZ5A 3QXCA 4NMLA 3O74A 3QFHA 5HMLA 5F64A 4XI9A 2PM8A 1SZJG 3A4LA 3BE8A 2BGIA 1QB7A 3OFJA 3ZWVA 1DNPA 1DAGA 1NJGA 1O96A 4E3WA 5GM1A 3TJRA 3NTUA 1NVGA 3D5EA 4B45A 2OB2A 5IAAA 2YOGA 1WXQA 3NOOA 1BXGA 3DCYA 1JA1A 3L1UA 1YK0A 3G4SZ 4R16A 3HOUI 5LA6F 5K3CA 5GOTA 5JJBA 5A4DA 4OM8A 2YBEA 2R1TB 2QRQA 3EGXB 2G9VA 4J75A 4P3YA 4TRJA 3OUZA 3IBFA 4AJLA 4IOJA 1RFLA 2NYVA 3SBXA 1QVAA 1RWPA 2CNOA 1AZSC 2OK8A 3E1KA 4YAWA 1RC1A 1J9EA 1NYQA 3ADDA 3AFNA 1ZM4A 1SXJD 3PXXA 1LB1B 1EFPA 1M2OB 2AHRA 4ZGWA 5DM70 2FK7A 3NKFA 3OPVA 1X8JA 4G5HA 1WZCA 3KT6A 1I7PA 4HQNA 5F3DA 1R6UA 2IUUA 1ZBDA 1GPJA 2WUEA 2CHEA 4KX3A 2JATA 3IOBA 3NAGA 3HL4A 3WQHA 5JI3E 2O53A 2EFEB 1RHRA 2VXYA 3U31A 2BT4A 3GCWA 4IH1A 4B2LA 3BYZA 1SNYA 1GNTA 1XLTA 4X64B 1DJOA 1FDTA 1QHEA 3CH5A 4IGFA 4KB5A 5D6OA 3X1WA 1ZRHA 4FSHA 3KIHA 4Z0TA 3B3FA 1E1LA 1MQ8B 2DFDA 1EX6A 3EQ6A 5AXAA 4BY7I 1SEPA 2ZJ7A 1SUPA 1C9JA 4C87A 1SELA 5LWHA 1A8IA 4CEIA 5DFAA 1CRWG 3A1DA 5K7SA 4OL9A 1FMTA 1BEEA 2FZ5A 2ZJ6A 3ZE7A 1P2UA 4C88A 4PCLA 4ZVKA 4Y6RA 3QE3A 5CCXA 5B1IA 1DPGA 1PG5A 5J2UA 1U3UA 1XCBA 3OT5A 4KFRA 4ZYXA 1FUEA 1YF3A 4EOGA 1IVSA 3FNFA 4LPSA 4HNRA 1Q1NA 3K8QA 1U81A 1PDVA 4MWEA 5TR9A 1YQWA 2DRIA 3UJHA 4CHTA 4BKUA 1Z2OX 5CIYA 1POWA 2DFTA 1COWD 3BBPA 4YP5A 4FHGA 5DBIA 5IASA 1E9SA 1VRCA 3MTJA 4I5FA 2XBLA 4NIMA 4HRYA 1C50A 3P0EA 2IRWA 2V0CA 1FSFA 1E7QA 1OLUA 3IDFA 3KFXA 1F3LA 2VF5X 3ZS9A 2ZLBA 3JTMA 5AO9A 3ZDFA 5HCNA 4RTRA 1IBKB 1SUSA 1Q1BA 2C94A 5JIBA 1ZD9A 1ISSA 4HTFB 3VZQA 1RSZA 3CCMZ 5LA6B 1SBZA 5EP1A 3WVNA 5JISA 4QLOA 4DSZA 3THWB 1FW8A 1S2OA 2HO4A 2HPHA 2P9YA 1FNCA 2CFRA 2WWWA 4CIVA 2VG8A 2V8IA 4DLWA 3CF4A 2ZIXB 4ZVSA 1RQNA 3HI6A 2W6ID 2VNKA 5J4HA 3CUKA 4LNUA 4XCVA 2D74A 5JCZA 1DJPA 3KFVA 1PT9A 3FJ1A 3TW8A 3DLAA 4MR9A 1NBOA 2BRUA 3F46A 1RJDA 3HS3A 5F2OA 3R7FA 1Z18A 2GFIA 2G9UA 2IYXA 1RZ3A 1B42A 1K9M1 1JT9A 2OVBA 3Q2KA 4QJ5A 2CNKA 3C3BA 3NM6B 1MX5A 3AVPA 3QLJA 2PRIA 1YA4A 2M6RA 2WD7B 1YR9A 5E2IA 3P9ZA 3QBVA 2RGRA 1H8HD 4FD3A 4EF4A 2H57A 1HORA 2XTNA 3PC2A 5UKDA 3BL5A 2GERA 2YV1A 1ENYA 2TSYB 3E7FA 4NFYA 4QFMA 4UMEA 2E5LB 2D3TA 4GS5A 2BKUA 3LKBA 2WM2A 4AKHA 1V16A 2QD3A 4Q9IA 4XDYA 1VJTA 5BV7A 1G5FA 1U5CA 3LQ4A 5AFSA 3ZWBA 1L5NA 4MD7A 1ZD4A 1DXQA 2YN4A 4OUDB 4S05A 1CJVC 5IT0A 4R68A 1RRKA 3GEBA 4ON9A 5FL3A 5IAEA 4BV9A 7MDHA 5JVDA 1KQGA 2E21A 1X7WB 4EB8A 1DAPA 1GXSA 2XB9A 4MQUA 1GFIA 3OOJA 3VSBA 3PUIA 1QRRA 1K3UB 3PXEA 4TWIA 2V0GA 3UT0A 5FUVA 2FB9A 1EQAA 2R8BA 2JFUA 5TXGA 1EEXB 2RHJA 1FLNA 3HQ4O 2ZPTX 1JQ5A 3AVWA 4LWZA 3UBTA 3K9HA 1IPHA 2JF0A 1NQAO 3W4JA 1EM8A 1T4GA 3PDJA 1YS7A 1SUEA 3EW7A 4R83A 3TQIA 2A5GA 4JCOA 5ESDA 3UT5A 3L8FA 1Z6YA 4D96A 3KSRA 1C8LA 1ZOIA 3SHQA 3ZEIA 1M1XB 1G55A 1JJAA 4XZ3A 1OYOA 3WB0A 1MW8X 1QP8A 1XRPA 1XGKA 2X7HA 4HAUA 4L7QA 3RKSA 3GFGA 1L4KA 5J2TA 4G89A 1L1QA 3MW8A 2XT9A 3WK9A 2QTBA 5LU8A 3MRSA 2QUIA 2VH5R 1VMEA 1ABFA 1WW8A 2I0FA 4UDXX 2Q9AA 4XIIA 4UXHA 2R6GA 5H68A 3U4CA 3L6OO 2H59A 2CKMA 3MOSA 3WQBA 4MRAA 3FPGA 1KWKA 1FQJA 3O1LA 4DV3B 3O8OB 3I9V6 3MRTA 1ZCFA 4V3CA 4XVUA 3CE6A 3UTCA 4HWRA 1ESEA 2YQ5A 2WT9A 2ZR9A 1W9MA 3G2LA 2C9ZA 4LKRA 1UEIA 2H9AA 5FXMA 5HS4A 4ITRC 1F9EA 1WXFA 2JFGA 3CEJA 4MV5A 5DWQA 2JA7I 3S8MA 1EWTA 1ESNA 2NZUG 5A62A 1ZH8A 4IBOA 4H16A 4QBKA 5HKBA 1VQ51 1M66A 5IZ4A 3J81A 2XUZA 3PF9A 4RDXA 1ECBA 4XRGA 1QR2A 3O83A 3H75A 4EJSC 3PTLA 4UCXA 2DU8A 5CJPA 1TAUA 3U3DA 5FPSA 4CKCA 3KJIA 2B61A 1Y8ZA 4H0FA 4RLHA 1GCOA 5I7SA 1D0SA 2C0QA 1RXIA 2GFHA 4YV1A 1S8FA 4OY3A 2QTFA 4IJ6A 2QT9A 2W6CX 3EISA 4KE7A 3PZRA 1J7KA 3ZYCA 1K6IA 1SVKA 3U3JA 3KAPA 1TPYA 2VF8A 3DFKA 4MWOA 3UAWA 4DJAA 1VP9A 2A0XA 3DZGA 1C9YA 2AEFA 2FJUA 4I1SA 2CXOA 4OKIA 1JWBB 2HJWA 2VAVA 2QHXA 1ZLXA 3S1MI 4QREA 1TZBA 4XD7A 3RH0A 3VR2D 5C37A 1KO8A 1XKXA 2ZBQA 2D3WA 3RAPR 3KWLA 4C07A 3SF0A 3FVQA 4ME6A 2DETA 2BEWA 3ZVNA 4MUFA 2X0FA 3BMNA 1J39A 3R3WA 2NZYA 5DM4A 1JTEA 1N0UA 1OLUB 4TWRA 3E81A 2D13A 3JAKA 1ZJ4A 4WUTA 1IRIA 2IEGA 2VATA 3PCXA 2F59A 2J31A 3NZEA 5H16A 1AA9A 4Q7JB 4R1MA 3SFVA 2ECFA 1GARA 1YDHA 2FPOA 2FRXA 1QIEA 3ZK9A 1X3ZA 1BRTA 3A10A 4YQEA 2IE0A 1VLJA 2QLTA 2ONZA 3P0RA 1ADYA 1DTWA 4TV9F 4PINA 5CDSA 4MD8A 5IH7A 2EEPA 3TQRA 3KHUA 1PWYE 1NF8A 3O3OB 3L43A 3IOEA 5AKGA 1QBKC 4BBPA 2HEIA 3TW8B 5TLSA 1X1QA 3ELWA 2JHPA 2EWMA 4DA0A 1OFHA 4D4JA 1QGED 2ID8A 2WTBA 4EG3A 1HQDA 3QMMA 4ZJYA 3JWGA 2PLRA 4EMSA 3FMIA 1KI9A 4OI2A 5AM2A 4QGSA 2M1XA 1V9SA 2W9XA 1E99A 1XMIA 1N1EA 5DX0A 2OHVA 2AHOA 4FHFA 5KQMA 5MFPA 4M9QA 4HS9A 2NG1A 5CW1A 1KQNA 2X0EA 5K0GA 5KTKA 3G0CA 4RCVA 4J7CA 1JB1A 4GZMA 4Y2UA 3L4JA 2E0IA 3E9RA 3JQAB 4WLUA 3TLBA 3L7BA 3CSUA 1KFCB 1VHWA 4IIBA 1A5ZA 1HDRA 3T1VA 5J4KA 4CQNA 1Q822 3EZXA 1YR1A 1SD1A 2P90A 5DHUA 4HV4A 1P1FA 1CIVA 1QHIA 4US1R 5CK4A 2L18A 2JI7A 4D4IA 3WLTA 3F5FA 4BQEA 5C7OO 1KE2A 4JP3A 1V16B 2DBRA 5EIOA 4JDUA 2GXAA 4DDUA 1TU4A 4LXGA 2HTFA 4Z54A 4H7PA 4EFLA 1BS2A 4EKNB 2HNAA 3N59A 3DDZX 4NPCA 1II9A 2PS9A 5DXAA 2UUCB 3IT3A 3LT0A 3GRCA 2GTIA 3QX9A 4RWEA 1UAAA 1Z34A 1ZM2A 4YRDA 4RQBA 3OECA 4JL6A 4F91B 3VXKA 2X3FA 2HLDD 1KAOA 2PWAA 3VPSA 3V3TA 2YXDA 1X86B 5E6UA 5DLPA 5DBEX 3QVWA 1QIDA 3HO6A 4DYVA 1A8UA 1B8NA 3I551 2HQSA 3QELB 4HGPA 4RF3A 4YECA 3RIEA 1WMDA 1YJWZ 3GJ0A 4QJ4A 4XQ9A 1EM8B 1P91A 3UYLA 3QLVA 3SR3A 5CB6A 2R7NA 1RDFA 2PYDA 1C8KA 3ROEA 1F7VA 3CLHA 3EIWA 3NOXA 1L8XA 1MHPA 4OD0A 3UT5B 4HUQA 2ZIVB 4B4OA 1BMFD 3U1VA 2Z2XA 4KDFA 5L6LB 2D5BA 3REQB 1ML3A 3TG8A 4LXQA 3W2HA 4AECA 3ZTTA 3LC7O 2NV0A 1N9ZA 2FOLA 1R6AA 2G40A 3NQ41 3GLKA 4JXKA 2B3DA 2HLPA 4P34A 1UZNA 1X19A 4JKYA 3QFFA 3BGSA 4XVHA 4JT9A 2PUCA 1VQLZ 1WVIA 1S3IA 4LG1A 5FAKA 3EQ9A 1GO2A 1BX0A 2V9CA 4B44A 3DDHA 5CPFA 2ZIGA 1Z2NX 2YU9I 2IV2X 1O5TA 2PXXA 1E6MA 1M76A 3RRNA 1ONPA 4DUZB 2B82A 2B2NA 1XHLA 3I58A 3EY9A 3FNGA 4LJKA 4RCYA 3IAFA 3STYA 5H70A 3FPAA 5CYPA 3EGWA 5BYBA 1C3OA 3GW8A 4WHMA 4AKEA 4HF7A 2WMYA 1DARA 5AJVB 1EGAA 1U7UA 2AJLI 5KVVA 1QGOA 3B2EA 3G6WA 5HZHA 3F4KA 5TRTA 2OD2A 3LXRA 5TGTA 4L16A 1D04A 3TE5B 3LSYA 4FSDA 5FLKA 4CKCB 2O8EB 2BUBA 4JJFA 3TUJC 3UG6A 3ZCQA 3RAEC 1XEFA 4U7TB 2D1YA 4AYBA 1GSAA 4OQLA 1PTKA 2NO7A 4UPDA 1VZ2A 4YV7A 2WE8A 1R8YA 1QV7A 4REQA 4BP9A 5JAMA 2VJMA 3OEEA 1NXXA 2PD6A 3QEBZ 3EVTA 3NBKA 3SI7A 4EHFA 5FNVA 3TFQA 3I9OA 4ZQGA 3IBGA 1V96A 4QDUA 5DGXA 2F4VB 2KW5A 1PJQA 3BAZA 3ZU3A 2XD9A 1QVGY 1Y6JA 3TQCA 2ONKA 3SX2A 5IWAB 5LYYA 4IQFA 3GLQA 3U3KA 5B3KA 2PZKA 2FSHA 3CMEZ 5F1OA 2P65A 4KQCA 4C04A 4DPLA 4RD2A 2X9VA 3HUEA 3ZY6A 3W06A 4KPUA 3FCYA 1XTQA 3V1TC 3BMNB 4RKRA 5JQWA 2BUCA 3EXAA 5AXBA 4JJ8A 4WY8A 2GBIA 5BW5A 3JAKB 4KFUA 4P4NA 3BD7A 3ND6A 4JMLA 4A0SA 4QLBA 3LE8A 3I42A 4MHSA 3CH6A 1QVGZ 3A4TA 4ID9A 2R5NA 1OI2A 3OOEA 4NZMA 2WWYA 2V7VA 2HO5A 1KJWA 4L08A 2UZ3A 4URUR 5H4GA 1OLXB 3I5YA 1P9RA 3HVUA 3H84A 3RQSA 4ARSA 1Y3FE 2W0MA 3MTGA 4YRSA 3KJQA 3EAFA 5FP0A 3W8FA 1KMIY 4KR3A 5REQA 2JEYA 1N33B 3CCRZ 2VTDA 3FDZB 1XZDA 4C0QC 2CHGA 3DB1A 5K01A 4Q4JA 5L3SB 1UPBA 2QLFA 1T6BY 4I66A 5KYXA 1SN7A 3E3AA 3ETGA 5CT4A 2V7BA 1AQNA 2H2AA 2P3OA 1GADO 4HPWA 3CVUA 2A9JA 4G0ZA 3U81A 4UQOA 1RRMA 1EVQA 2DHRA 2D5IA 5KOJA 1CR0A 1P3JA 3UOGA 4DANA 2V5AA 1F6BA 2WWHA 4QHSA 3GJYA 1KEKA 5EJ6A 3FVTA 3JAWA 2LPMA 1IM8A 4AKTA 1AKRA 2GEKA 1QCDA 2C5FA 1V41E 4LVUA 3BPSA 3LDAA 5P21A 1FFAA 3URMA 4BVKA 4EEXA 5JXWA 4QE3A 4X8LA 1TCVA 4U39A 1IN4A 3EQ2A 4BLWA 2J08A 3E7WA 5ALDA 4EHHA 4HNAA 4D2IA 5KQRA 1IRXA 2Y0DA 1JWLA 1R5NA 1T9AA 1Z82A 4FZJA 4UXJA 4EY8A 3HABA 3W3AA 4LWQA 1B8VA 5IP5A 5I9NA 2WPNA 1KKMA 2YZNA 1I3LA 4Z9AA 3FTCA 4CODB 1H3FA 4DUPA 1ZGAA 3OZXA 1ISRA 3RS8A 1ZD5A 3N0WA 1Y6FA 2QR5A 1LV7A 1ZBQA 5CIWA 3BH7A 4ZALA 5GAJA 1UJBA 5LKAA 5DXJA 2QLBA 4Q1VA 1XZHA 1YBFA 5FPPA 5K3FA 2WVAA 2ZAEB 2VSOA 4G2NA 4IOMA 1U2DA 5KOHA 2Q2NA 3PT5A 3U7QA 3D54D 2P6PA 1LDBA 3KPVA 4KPFC 4E46A 5KAMA 2FWNA 2I2WA 4RD3A 2P2LA 1HSZA 4CV0A 3WIOA 1YS2X 3ZQJA 2GO1A 2EL7A 3DEFA 3IULA 3GD5A 3PNBA 3EXHB 3S68A 1UAYA 5KINB 5KWJA 4F7WA 2QIOA 5EXTA 3OJEA 2F9MA 1KKLA 5B5SA 1X7YA 2I6GA 4B6JA 4QDKA 4BL5A 4KQ9A 5JO0A 1L6RA 4EY7A 2I91A 1E3IA 3CC21 1HRDA 1Z5VA 4UBJA 3TZQA 4CVNA 3CVOA 2AMJA 2RGWA 2GJSA 4NBWA 2BJHA 5TQJA 4C0XA 3IP9A 4M49A 3H5OA 5GONA 5F1KA 1CRLA 4ARZB 1YZTA 3CLTC 5LQUA 4IDHA 4KXVA 3P45A 1JPVA 4JI6B 4EUFA 3DTVA 3HI4A 4FONA 4MKHA 3ZZUA 4S04A 2WAQA 4YRMA 1BHJA 3ZGXA 1JDSA 2JAOA 4D8XA 2RGCA 1FSGA 4BVLA 1ZWKA 2DXIA 2QMYA 2NVWA 1Q1QA 2O0LA 2PMKA 5LZ8A 1SVUA 1VI6A 2LGJA 3ES9A 3OG9A 5MN5A 3AZOA 4DIKA 4AJ1A 1PD1A 4B09A 2NM0A 3IQXA 5KYUB 1M8JA 2QB5A 1RQ7A 4E5DA 3EZFA 1W85B 4XWGA 5IP9I 1NSFA 4CCAA 5BWMA 5C51B 3MUNA 3QK7A 5K05A 2HQRA 4B7AA 1FSZA 3K70C 1P7VA 4AZ0B 4WXRA 5I4CA 3HCWA 1DWOA 1MEJA 2YJTD 3GRFA 3PHHA 1O7JA 4FE7A 4IIVA 1JR3D 3JD2A 3QV2A 4GP7A 3PZBA 4NS4A 4REQB 4U8HA 1GPNA 4D02A 1E6LA 1Y3BE 1F6DA 2B8WA 5FNVB 4U5QA 4Z0NA 4L3VA 4HYEA 5F2EA 3OQBA 2Y1LA 2JLQA 3GVPA 3RKRA 5FLMI 1D2HA 4RM2A 1XQ9A 2WQ6A 1SVOA 1WU8A 2Y1EA 4D6PA 1Q3KA 1QZUA 2H2IA 1ULBA 4GBMA 5TQ2B 3GLHB 3R7AA 4FQ5A 2ZRLA 4EZIA 3BAFA 1FNNA 1KYQA 2HWKA 3W7BA 5HR5A 1N0IA 3PEFA 2XYQA 4N4AA 4N7JA 1RO2A 1LUAA 1GLNA 1DS6A 3S1QI 3CR7A 5IVPA 4M99A 1SC9A 3FOCA 3TK1A 2BAGA 1QE5A 1H8EA 4D4HA 1RW4A 1Z17A 2HIHA 2XLBA 3DE6X 1L7XA 1GPYA 1TDJA 3GARA 4AUEA 1YL5A 3VQTA 1FXSA 4C6TB 1E4EA 1Q50A 4CL8A 3G2HA 4D9JA 4R1TA 4URVR 3A4VA 5JDIA 1DSSG 2WJ4A 2WB1A 4GR5A 5BWLA 1Q19A 3SG0A 3UK2A 1ZNZA 4YCJA 1RBQA 2VT6A 1P9NA 4URXR 4IPTA 4BFLA 2CNLA 4Q4JB 1BMTA 5ALEA 1XXHE 2FRDA 4EB6A 4MSUA 3ICCA 2HF2A 2XCSB 3GWZA 3QMVA 1NUSA 1P1CA 3QYFA 2POQX 2PZLA 1PIWA 4X0EA 3HJTA 1RYBA 2B37A 5CM2Z 3L7KA 5FJJA 5DP1A 3KPWA 3Q8XB 2PKYX 4OKNA 3WYDA 2XDAA 4TSFD 2QTWB 5KOJB 2CDRA 2I55A 1LJUA 2FGJA 1U0SY 4MVJP 5BW8A 2XUPA 5BSUA 4ZCLA 4BRUA 4C5AA 3JAWB 1CPYA 2GBPA 1T5HX 2DOKA 2BGWA 5AVQA 4YI5A 4JI2B 2EJVA 3UWDA 4NE7A 3MT0A 3PHGA 2EAUA 4Y7CA 4BQQA 1A8SA 3AIKA 5EE1A 5B1EA 5K99A 4UU7A 3GDFA 3DT8A 4URZR 2GRJA 4DCGA 3BDAA 3C6ZA 4NJEA 4BX3A 2WDPA 1N6PA 3BULA 1KZ1A 2IKSA 2AD1A 2A9PA 2FPUA 2K5UA 4JC4A 4L5YA 3L1JA 1GUYA 4HNAB 2BJVA 4PFKA 2ZBRA 4U2GA 5CURA 3NS7A 2V55B 3NGMA 4WXYB 1W59A 1GZUA 3A4MA 3GRUA 4OM7A 4WLEA 1XLTC 4WVLA 5CU7A 4F7DA 3FSGD 1RLMA 1Z0SA 5EWLB 2VHEA 1S9HA 2ZQYA 1HLFA 4J2TA 1TQHA 3EZ6A 3TI7A 3DMDA 2E4VA 5SZJA 3LP6A 3WE7A 1XD2A 1Z5ZA 2X7XA 3EG9A 2W48A 2J5QA 4I5GA 2ZT5A 1K6JA 3DJYA 3NRJA 2NTYC 3A3PA 4PPFA 4U0JA 2LIPA 3MB8A 1IBRA 5E0KB 3BC1A 3OI7A 2PWZA 4MITA 1FDIA 4GSYA 3WWEA 2BMDA 2ILTA 3KV3O 5AM5A 2O3QA 1TFIA 2CHUA 2EXXA 3L0IB 5JECA 5KOHB 1QR6A 3MWKA 2QN6A 3I6QA 3FRIA 2VP2A 3INYA 4NNOA 4O2LA 4PPQA 1T26A 4RY8A 5ALYA 1W73A 4BFCA 3STHA 1PLJA 2WF7A 2I6XA 5CD1A 3K96A 2FUG6 2WHYA 1H05A 3OE5A 2ZBFA 3P0JA 4JJ6A 4XXHA 4QOSA 2KLBA 4F93B 5T7BA 1VJCA 1FDUA 1D1SA 4IFTA 4IXNA 3Q3VA 3UBMA 5JCPA 4WDRA 1O9BA 3W34A 3MHPA 2WMNB 1DP4A 3I4LA 2QRDB 2P5UA 2J0EA 3T1QA 2HSGA 1Z0IA 1C9KA 1DT3A 2JLUA 4IMIB 3LVRE 1D2NA 1ZNYA 2C03A 1WKVA 2QGNA 5B55A 1NAIA 3VO1A 4X91A 4YVFA 4D4LA 3I23A 1UC9A 3F1LA 3SY8A 1XNRB 2A9RA 4PFJA 5HBGA 1PUXA 5DP2A 2ZEJA 1VB5A 2G82A 5CRIA 2ZJ1A 4RTMA 5DB4A 3KQLA 2O20A 1P44A 1YB6A 221PA 3H17A 5DNWA 4RVDA 2QRCB 4X7BA 3TSOA 3W8RA 1NOIA 1RQGA 1HQYE 3PL1A 4HX9A 4HXFB 2GCNA 3DOIA 4RD0A 1OXTA 4R0NA 3SQLA 2GZSA 1P6XA 1DWQA 2GM9A 2DEUA 2JCYA 2WIBA 4C6RA 1UXOA 1PL0A 1E1QA 2YY7A 4MS3B 4E5MA 1VQ6Z 3H3VJ 2WSLA 3PI6A 4LWOA 2I76A 1EB9A 2BRUC 2XIJA 3FF1A 4IIHA 3H87A 4NOJA 4NH0A 3SHVA 3A6EA 3H1BA 3NHFA 3R5TA 3F6RA 5H3HA 4A93I 2XHZA 1H66A 4TRMA 2IXEA 2JNWA 2V03A 3NCHA 1D0IA 3V2GA 2R8EA 4QJBA 3A14A 4LZZA 1PSWA 3KZOA 1Q0QA 3AU8A 3KDAA 4G1BA 2P7IA 2FFJA 4EA7A 5LYJA 5I7AA 2WWRA 4ZARA 2VUSA 4Q6BA 4ALJA 1ZJYA 1EHCA 5CLFA 3OQIB 3SXUA 2XLCA 4JROA 1DZ3A 2E4UA 2H1SA 3BXZA 3KUDA 1VJ1A 2FPIA 1AQ6A 2H0RA 4JBLA 3Q8WA 4OLFA 4OP2A 3W77A 1A2OA 5MGNA 1JQBA 2HCBA 4UTZA 1CHDA 3KTFA 5AP9A 5IC5A 4W5TA 1SRQA 1VKHA 4FU0A 2PM9A 3B36A 3ER6A 5E95A 5EPUA 3TL3A 2VL7A 3U7GA 4IDBA 2QRMA 3GH3A 2JAPA 4TS4A 4PHGA 3GCXA 1U11A 3GO4A 1B8UA 2X58A 3MYYA 1LDEA 1KYZA 2X4IA 3OT1A 4L28A 5ED0A 2OQRA 1IY8A 2W2OA 1FBTA 3Q5DA 4NG5A 4ZRMA 4QXAA 1KJNA 2QYTA 1Q811 3QKRA 4O4LF 2KPOA 2G1AA 2J41A 4KWHA 1JKJA 4RJKA 2IV7A 4L2IA 4G4IA 3UW3A 1YIJ1 2E3JA 2YHSA 3M9XA 1CX9B 1EP3B 4F3CA 3ORRA 3B38A 4BNDB 4DA4A 3I01A 3CJQA 4ZRNA 4MIEA 3ECSA 4H60A 3QVMA 4JA0A 1QGAA 4JBIA 4RIFA 4DNFA 2VDVE 1W94A 5EI5A 1M74A 2JCSA 2ZWIA 1P9WA 1RYFA 4S1WA 5G53C 3RG8A 7GPBA 3DDUA 1C1HA 3T7SA 5I3CA 1O5OA 4ZT2A 3TE7A 1K6MA 1TLTA 1BEZA 2HHHB 1C1XB 1GKKA 2IU6A 1WXGA 3JRWA 3HU2A 2YDXA 4B74A 3ZHOA 2PAFA 3X1KA 2ACKA 1QHHB 4KBYA 1XU4A 4PHHA 1WETA 2B7BA 2XZPA 2JIDA 5LD2C 2H65A 2H6EA 4Z9YA 3GFFA 4NV1A 4H1TA 2PRYA 1JHYA 2HMVA 1LI5A 1CJKC 3BSFA 1UKVY 2Q5QA 3DA8A 3FYDA 3FXAA 3RK0A 5CB4F 1VOTA 5HZGA 4I1VA 3SF8B 1LTQA 2VF4X 1NXPA 3RRBA 4QOHA 2QZZA 4P86A 3RFCA 4E3ZA 4HYQA 3F67A 2HHAA 2D5CA 3L6UA 4YRRA 1GG5A 3OIFA 3WLOA 3I56Z 3SD7A 2XUFA 2CN1A 1BQ3A 3QKSA 1ZIDA 1XD2B 2BEKA 2D7CA 3P9YA 4E30A 1J8QA 2OCGA 3C2QA 3KYDA 3V7NA 2DMRA 4N3GA 4MVWA 4YONB 5CEFA 1U9YA 1BX1A 2JDID 4I8DA 4MMXB 2J6AA 2ZGVA 4CQMA 1VLLA 1JA0A 5I9TA 2JFZA 1W6RA 4OU5A 3X1YA 3A4NA 1Z26A 1PU2A 5BR1A 3TGWA 2IIBA 2AE2A 5E6RB 3TMAA 4TLCA 2P1DA 3PFNA 1KH1A 3R6GA 4ACAA 1MAHA 4A3FI 1Q2XA 2QY6A 2NPOA 3ROXA 2AT1A 1FZQA 4M37A 2OK7A 3OPYI 5GTDA 4FFMA 4IKEA 5K3OA 2QRNA 1UWCA 1IEVA 3ZV4A 2Y66A 3AUYA 4DIEA 4CV3A 4O4LB 4XB6B 3TRDA 3S5UA 4D5GA 1RD4A 3DTNA 1YVRA 4NZPA 3WBBA 3QX3A 3LP8A 3R9XB 2OXRA 2O1WA 4PY2A 2YW2A 3RS3A 2BSAA 4HP8A 2VJQA 2ANBA 3R6DA 4BCBA 2CL0X 2B25A 2G70A 1OIXA 1BKYA 2XMQA 2EG9A 2JKZA 2OZPA 2BISA 2FZCA 5LXTF 2C2WA 3F3PC 1JFTA 5IJ9B 2D7DA 1EDBA 3R9KA 4DR4B 2EZ4A 3ZGYA 2YUIA 3WO0A 2Q5LA 4IVRA 4G0OA 1KZYC 3GZTB 3PS9A 1LA2A 1LNZA 5K3BA 3RHSA 5IK2D 1RWXA 1US8A 4FQ7A 2C3OA 3QQPA 5AJWA 2CJYA 3KQNA 1MBZA 1PHPA 4FLFA 4DILA 5BNFA 3BOSA 3KTDA 4D9EA 4JVNA 4UMDA 4W1QA 3MJRA 2WE7A 4CM8B 2ZYAA 2RE8A 2ZAMA 2Q4DA 5CB4B 4RXTA 1BXRA 4CEJB 4X6UA 1F0YA 2ZRJA 3I64A 4Q9NA 1H23A 3FYSA 3NTQA 1ZUD1 3OD1A 3R0ZA 3L7JA 4M7RA 2VDQB 1IJKA 1BG6A 4MRMA 3QX7A 2CVQA 4CL3A 5JLAA 4AQ7A 2YY5A 3DE5X 3DUWA 3JVIA 3CBQA 4Z51A 1FFDA 1TM2A 3D3QA 3I3OA 1T1IA 2A1UB 2PG3A 4N5NA 4FI3C 1J21A 1LK5A 4GXNA 5ULLA 1T9CA 1TTPB 4JLAA 4ZODA 4E0BA 4KIGA 5EN4A 1HA3A 5F21A 4A36A 3UEOA 2HK7A 2AG0A 3F0TA 1A3CA 1IFXA 5CTAA 3ZHZA 1NATA 4E1BA 2QQGA 4GT1A 4M1QA 3SZGA 1PV2A 3VR3A 2BTQA 3H99A 1A04A 4AW9A 3IP5A 3P71T 3OPMA 2N47A 1KOLA 5LDGA 3CXCZ 3BZBA 3VJLA 2X0IA 5AVSA 3PIRA 5JSQA 3TXYA 2JZNA 2O52A 4GVPA 3BMOB 4GGPA 2CXNA 4PQEA 4GD3Q 3GPBA 4H3HB 2Q5EA 5ALMA 5LLTA 4DCSA 5HUJA 2XRFA 2V45A 3ILSA 2H7CA 2PKQP 2XY4A 3QKRB 5EIFA 3ZIAA 4F11A 3I62A 4IIYA 4OFBA 2JLYA 2YNMD 3BICA 4Y6QA 2XCOA 4YAKA 4DUYB 3BQNB 3QLVC 3TLGA 4AQYB 1RBMA 4R5HA 2ZB7A 1VKNA 3AHDA 1T9GR 3L6EA 4BCCA 5ADHA 2ZJZA 4WJLA 1JFFA 3ZDRA 3PC8A 2PKQO 3NJ4A 4HYYA 1VHDA 4WK2B 3S0JA 5M7EA 2ZUFA 2GZRA 3G2IA 2Y92A 3DZCA 3VYSB 1J00A 2AQHA 3JX9A 5LOVA 1X8LA 2EARA 3JCZA 1JEJA 3DT6A 3LECA 4BOYA 3EUWA 3EE6A 4YRPA 1FVFA 3C85A 3SBDA 4ZVUA 3EQ7A 3RO7A 4EI9A 3ROPA 1YCGA 1K7YA 1KQOA 2PY6A 1WNTA 3L9WA 5T41A 4DCVA 2PA3A 1Z12A 4KO3S 5CR9A 1NHWA 2Y05A 1Y4AE 2A0KA 2JH8A 2WHQA 4TL9A 3T3HA 2F6RA 2V5VA 1MQAA 2ERCA 1J5EB 2X2EA 3CMA1 2XE4A 3EDRA 4EG7A 4D3YA 4TXHA 4M9ZA 4WCFB 5HQ3B 3KETA 1VBNA 1PS8A 2QJWA 3WIBA 3MWJA 1EU1A 3DVQX 4X95A 1A5TA 3WJ2A 2JHCA 1W1UA 2CF6A 4PLZA 2YN0A 3O03A 1Q83A 1GNSA 4RIGA 1ZA1A 3AJRA 5DGIA 4AJPA 5C7IO 3NT2A 4TKMA 3D7NA 1Z6PA 5IVIA 3USZA 2ICAA 4JHLA 2C77A 3PXAA 2WWTA 3QKSB 4ZAWA 2QUJA 1NVVQ 2B7LA 2QTGA 3HYLA 3G8BA 1CY1A 1E2LA 1TC2A 4UNQA 3FI9A 3JPYA 3M4JA 4MVJG 4B87A 2C7BA 2R65A 4H27A 5E7MA 4TS1A 2GU2A 4GRDA 3U4IA 1EVJA 4CQMB 2JFWA 4MW7A 3VTFA 3TSAA 1UOPA 1TD9A 4G5QA 4MARA 4F3KA 1KJ9A 4MWSA 3UB4A 4PU0A 3WNQA 3COYA 4YJ3A 1OH6A 4WKPA 4N7MA 5KVSA 3G2QA 1BS1A 2FGKA 2WU1A 2BFAA 2ADMA 2FW8A 2X9NA 2HRQA 3BFXA 1XTZA 4NE2A 2VRBA 1U7TA 2OQVA 3RPEA 1J2TA 3ENVA 3NTVA 5D3QA 3OMLA 5TQ0B 5ENZA 2H00A 3VGJA 1E3LA 3EWSA 3D9QX 1WVMA 5FI3A 3T1TA 3UHAA 1MZVA 1BMDA 2GT1A 1PK9A 3LYUA 1KTIA 5JSZA 5FTKA 5SV2A 4UEQA 4YK7A 4QYXA 4Z1MA 1TYEB 2ZIEA 5EZ6B 1DEXA 3UJ6A 3WLKX 4GL4A 3R6LA 1GU7A 2HU7A 3MMNA 5BQPA 5HJ2A 5C0OE 3VNUA 1R0LA 3FOFC 3CLUC 4UOQA 1KPGA 1ONSA 4FXPA 3CVVA 1VLMA 2TRSB 3AM1A 1OZ0A 4C89A 1T5IA 3IPRA 3KU1A 3KXKA 1N5IA 2P3SA 1DC8A 2BKEA 3NHPA 4MA4A 3AIIA 1UDWA 3RWBA 3IQHX 2WYIA 1A9PA 2FZGA 2QMQA 3I2YX 4RTOA 3ZCSA 1CUZA 3A70A 3IBSA 3LV8A 4FKMA 3R7WB 5L40A 1GRRA 3IHTA 4ZAGA 2D2XA 1LSOA 4MKXA 4XUGB 1V95A 4QDTA 3TQHA 3X1XA 1NN3A 1U9IA 4L0CA 1QF9A 1BXRB 4O2AF 1HDEA 4UHHA 4XQEA 1O9HA 3QFRA 4G0YA 1L7NA 2AKAB 4N5DA 4ZC8A 4FFSA 3DMRA 4DMRA 2Q6OA 4IJMA 4EUEA 1RYNA 2FPMA 1TCCA 3ICEA 3OF5A 4W4TA 4ENPA 4WEQA 5KC8A 4A3CI 3F7MA 3PR3A 1S2DA 1WU7A 3ZKWB 2BM8A 5HVNA 1NE7A 4LMAA 2IS6A 1XLUA 5ALGA 1GL9B 2J1LA 2OBYA 2PWYA 5F4BA 1JMKC 2V74B 2PUWA 3KXPA 4B7UA 2GKOA 2HT6A 7MHTA 4DY4A 3UA4A 2VH1A 5F4ZA 4ZV4A 3MTEA 1FFBA 1JQEA 4HAOA 4KSCA 1MEEA 3Q98A 1VQ5Z 4ZMSA 3QFTA 3V1LA 1RTTA 1WAMA 2J87A 5J58A 2XUOA 2VJOA 3ENZA 4IJ5A 4MV0A 5EEHA 4KHZA 2AOTB 3EWNA 3EUAA 4CT4B 3BJIC 3WGIA 4D9KA 5AW4A 1PAUA 4KWEA 2X8AA 3VPBA 4AROA 4Q9KA 4JU9A 1KP3A 3GEPA 4MYTA 4KMOA 4WDQA 3I05A 3SZMA 3VM6A 4HZGA 2FR0A 4W5QA 4NJMB 1TEXA 1U2DC 4LJSA 4LOKA 4J90A 4P98A 4JI5B 2VPZA 3VZBA 4C9BA 2EP7A 3ASZA 1CVLA 1N9KA 3FKSA 3HP4A 1N6LA 3CX6A 1L7RA 3TTVA 4O3MA 1MOPA 1ACMA 1W88B 1HE8B 3H2BA 3SKYA 4DM4A 1J0BA 4UUPA 5LOVB 4FGJA 4KDEA 4YP0A 5EE3A 5HEKA 4BLOA 2VZ8A 3Q6IA 2O2GA 4MROA 1FLVA 1WSDA 5CH8A 2PUTA 2R47A 2X8LA 3LG2A 4E1VA 2I66A 4EKEA 3IESA 2C61A 4UUMA 1GCUA 2BL4A 2HIAA 3HJAA 1IM5A 3EX7C 1WHTA 1W19A 1ZD3A 1YB7A 1QAQA 2DWUA 3OX1A 4EW3A 5T8KA 4O0LA 1UK6A 2C54A 2MYPA 4JUAA 3EPPA 4NB8A 2QN8A 1NW4A 2XQJA 3DHVA 4KTTE 4PZPA 4CIAA 3O8CA 1FUYB 4LTNA 4PBRA 1CIJA 3CIOA 4RA9B 1VPVA 4O2AB 4R2JA 4PW0A 4BP3A 1ZQ1A 2G1UA 2HYIC 2XGMA 1LEHA 1UKYA 4HSGA 4C0AC 2BSQA 2M6LA 1R2QA 1SG6A 2Q9CA 3CINA 3P8ZA 4WXHA 1X7ZA 3QI7A 1HDCA 5DTMA 2V1XA 5KZMB 1L5QA 3U39A 1TOAA 1W34A 4N0PA 3K1JA 3BTVA 3SHTA 2AKEA 2WZCA 2YIDA 4MR7A 4KAAA 4J03A 1T0JB 1H6CA 3J80A 3UCFA 2YXNA 5ALJA 4P7JA 1NJI2 3AFHA 2QNIA 4DMLA 5L4LA 1YUNA 2PUVA 3SMQA 4OJYA 1DG9A 1QC5A 1ZK1A 5BPHA 5IKXA 1Z7EA 5BNIA 2Q4BA 4D9HA 5DNYB 1CD5A 2IP4A 1PR2A 3IHLA 1AGYA 4YJ3B 4CXMA 2HMWA 4MWCA 3ZPXA 4KXQA 4JUDX 5JRZA 1F2TB 1BGVA 4NKRA 4CM5A 3ZHTA 2QE7A 5CD9A 3HWRA 2BGGA 1P73A 4F6CA 1V5IA 5FT9A 2WF8A 4PG8A 4JD5A 3V4VB 5LU9A 3MOIA 1JE0A 4NPHA 4TL8A 4XX0A 4HMPA 2ZBDA 4DAOA 2A33A 1O08A 2YVAA 3PWSA 1OR8A 4HY3A 4XOUA 4HC4A 4BWVA 2PKCA 3R76A 4BAZA 4U3JA 4CEHB 3PJDA 2R4QA 1MVNA 1ZCAA 3OE1A 4RPCA 3WDLA 3TO5A 3FWNA 3QA9A 2E18A 1EI9A 1UIRA 1Q11A 1UUFA 2O3RA 3SQDA 2EOAA 4WZBE 3VFDA 4BVBA 4EHJA 3KOUA 1AHPA 2O4CA 1XNQB 2HJHA 1PR0A 1VQK1 4L3WA 1B6TA 1OYYA 3I55Z 4GW3A 4Q3CA 1QRAA 1Z07A 4QXMA 3W9SA 4C0BA 4YAFA 2IPNA 4RK0A 5JDIC 3UMJA 3B1XA 1YGPA 3OTGA 4MDYA 5HOQA 2UXDB 3NEYA 4IRUB 2MIIA 4CM1A 4E4YA 3D4PA 1O77A 1GV1A 2ZDGA 2ODEA 3C3YA 3KVYA 4I3FA 4WT7A 3M4ZA 4IR7A 3PTAA 4D4KA 1TKBA 4QGAA 1F1JA 2ZSAA 2FRDC 3VR6D 2C8VA 3BE5A 1RWKA 3MJVA 3VNSA 1OAAA 1G5PA 1U5AA 1WD7A 2AI2A 3EOAI 4NHEA 4DJTA 3Q6MA 4GE3A 5IC4A 2PXAA 1VKJA 2BSXA 1E4OA 2FX5A 2I7VA 2QD4A 2ZW9A 3JYOA 2FPPA 1TE2A 2J4CA 1QX4A 4Y2JA 4IDGA 3Q15C 4X3PA 4MKZA 3WB1A 4P1ZA 4IUCS 2XGSA 1OXXK 1SBCA 1T6ZA 1Y98A 1CUHA 1JEDA 3F7NA 3TINA 2QR1B 5E4YA 1CS0A 1J99A 3B2NA 5DW3A 3RUIA 3VZPA 1EK5A 4B2PA 1KFBB 5FORA 2WK1A 4CV1A 2W2KA 4EYOA 1O0CA 4RV9A 3L4SO 3TTXA 3JD3A 2J3DA 2ADFA 2ZT8A 4D0GA 2CXXA 2NO0A 3CT4A 2RG1A 1MAUA 4C3VA 1Z37A 2Q5HA 1SOAA 1GQ2A 1QIKA 2GHQA 4DBLC 4KYIB 3NH6A 5KTMA 3FBGA 2B35A 3H5RA 2C2BA 5D86A 3SX0A 4JX8A 1ZSYA 3RUDA 3PL5A 1C3JA 3S28A 2VUIB 3J80b 2CT8A 1G64A 3MJHA 4KQGA 4OXIA 2UU9B 1WIIA 4O29A 3AO0B 1SU7A 1MD9A 2G0TA 1T0HB 1U0FA 5SY9A 3CU5A 2FMIA 2OILA 4BLUA 3TJZA 4LYAA 1UQRA 1ZD2P 7ADHA 1F2UB 4CUJA 4R1LA 3JALA 4UNRA 4AWXA 5HRAA 1RPJA 1T8SA 2NO9A 3RFTA 4B3CA 3GAAA 4WWHA 5B3AA 2K2QB 3GG2A 3TSWA 5GMOA 1XZJA 2F8MA 3B8HA 1GQQA 4J3JA 2WTAA 2W2MA 3QA3E 4HDAA 1FFEA 2R79A 1DIAA 1LQUA 1CEYA 1XT6A 3TTTA 5FHQA 1C7FA 1NP6A 1RI4A 4JQZA 2GYUA 3UK0A 3JR3A 4E09A 3CVYA 4MVJM 4EJFA 5CFMA 4UMFA 1Y6RA 3FZYA 2HREA 4CFSA 5JTTA 1M2HA 3KWMA 4G07A 5ESRA 4J94A 4DXAA 2VNIA 2GK4A 1M34B 2ZPAA 1K8YB 3AM5A 3R77A 4CI9A 5IUJC 4O1HA 3T9DA 1YWGO 3C45A 2XA1A 3QE4A 5IKEA 2XZOA 1THGA 2NSLA 1BWPA 2MMGA 2JJMA 3ANLA 3CA8A 3V7UA 4ML3A 4MI1A 3V34A 1SK9A 3DOOA 4J1TA 2BFNA 2XNDD 2FHPA 1EP1B 3EIEA 3PHCA 3EDQA 1AJEA 3Q2IA 3FNQA 3KKQA 1YJXA 3NIGB 3ZHBA 4LFCB 3ILYA 3CPSA 2HSDA 2V8BA 4S1OA 3DOJA 3IAUA 4UD6A 2GBFA 4C0WA 3NXSA 3HKDA 4FYPA 5ILOA 1RQXA 1OKKA 3V7FA 2VDWA 4BMDA 1PW5A 2YFYA 4MR7B 5AVWA 2ZTMA 2WUGA 3AHIA 3NJ8A 3BXGA 5EJGA 2GR9A 1DELA 2CK3D 1NUAA 4KU4A 4PZ9A 4HH4A 5E9AA 1S1MA 2C97A 2QP4A 3ZQKA 4B7XA 5IXSA 3K70D 2EFCB 2P62A 1QC5B 1R0CA 4QQKA 3ZUGA 1QB8A 3OIDA 5JROA 3SKXA 4TT8A 2DKOA 1E2HA 1YZKA 4YRIA 2H7VA 3ZDZB 3ZI0A 5CHEA 4F5DA 3HL0A 5EIXA 3F2IA 5KYWB 1AQJA 1X1TA 2O8DB 1BFKA 5JASA 4KUEA 1B6RA 3EARA 3QEMB 4MJ3A 4DS3A 2GJ8A 3WGGA 1MTZA 1GG8A 2W8BA 3QJGA 5EHNA 2RB4A 3DVAB 4I4NA 3I6MA 3QUTA 4RVUA 5JWHA 2YXLA 3VAYA 4ECEA 3LMKA 3ETEA 4ZQCB 3EPJA 1JIKA 4P4LA 3SDSA 4BN4A 3ONDA 4UDOA 4GPAA 4BS9A 1F3OA 5IKMA 2WNSA 4MGHA 4YQFA 1FLAA 3H2GA 1XTUA 5EXXA 3IPLA 2CXRA 1R0RE 1HX7A 1RE1A 4HLUA 1UMDB 4HX5A 2C7VA 5F2NA 2AOUB 2AR9A 1G5IA 4PYOA 4HTAA 1TLLA 3GTMI 2YOHA 1ATZA 3AHFA 5C8XA 4D45A 2C00A 4BFXA 3V4RA 1DFIA 3O9ZA 3BG0B 1M0TA 1NF2A 1SG0A 3GLTA 3U4HA 5BXYA 5KNBH 1FTQA 2QGFA 5FLYA 1E5XA 1P77A 3T3MB 3VYWA 2WG0A 3CCE1 3N2NA 4FX2A 2BZ0A 2HF9A 1E18A 1Z2DA 4XQ0A 1NM5A 3QTLA 4NBGA 1QTRA 5G41A 1NY5A 3MCVA 2JK1A 4H59A 5WRFA 5L3ZA 3CV3A 3HN6A 3RF7A 5C8YF 4BRWA 4DRXA 3GDWA 2CE7A 4FILA 1Z5NA 1G5RA 2FEWB 4MUBA 3CC2Z 3AUFA 3T52A 1DQPA 3IUBA 3E3LA 4XJTA 2W4QA 3CX4A 4FJ2A 1DX6A 1T4CA 5TJHA 3S1SA 2IH4A 1NKSA 2J0UA 5K51A 2W6ZA 4EKDA 2EDAA 3T61A 1OWMA 1D03A 1YIT1 1NQWA 4YLEA 2A30A 3NWEA 3OZAA 5TMBA 1XAHA 3U0BA 4YHHB 1KO4A 2AF4C 4G3XA 1T9GS 3V9PA 1R6BX 3KEQA 2RH9B 2WLSA 3MS7A 4MP3A 1YO6A 4RIIA 1STOA 4AWAA 1PK8A 1JR2A 4ISCA 1TO2E 3FPJA 4F9TA 2RGYA 4W7IA 5G0WA 1MOZA 3QPUA 3RRMA 3UUFA 3EOBI 2Q2WA 3EZ9A 3O2JA 2JLCA 3S2YA 4TKUB 2ZSUA 2GPBA 1CV2A 3MN1A 2P9CA 4JV5B 3BD8A 2IXTA 1NFRA 1IVYA 3DZHA 5AJTA 3N7AA 5D87A 4KR2A 1TA9A 3BJMA 3LUSA 4YRCA 1MB3A 3DBVO 4KODA 3DSRA 4M1KA 1GA1A 2AXEA 5A4IS 1HT0A 3NBMA 1DG1G 1RLIA 2HCTA 4YP6A 3ZE9A 1IUNA 2Q5OA 4QBHA 5LLSA 3RYFA 5ICCA 3RRXA 3KE9A 2DUMA 4MQEB 3EGDB 4UAVA 5F9FA 3RNOA 3H0CA 4M83A 5B1YA 2RGBA 3RIYA 2NU6A 3QYAA 4YV2A 2DPGA 2ZRBA 5AM1A 4N41A 4HPJB 5C7LO 5KWSA 3HOVI 4WKGA 3PXUA 2PNFA 3AETB 4HEQA 1GPUA 2IZ1A 2I4IA 2CD7A 3LAWA 4PYMA 2VQSA 1DDGA 4QPPA 3WL3A 1UBLS 3D7MA 2O7QA 2ZYWX 4LRWA 3SM9A 4ENTA 3BGVA 1C4XA 2IQ5A 2V6JA 2QW8A 5JJIA 2Q62A 4MYHA 4RTSA 3DZBA 4MDHA 3GY0A 4OBWA 3CH4B 4JZYA 2M2IA 1G20B 3IKTA 3DE4X 3BCSA 1TKCA 2IFTA 3NB0A 2I4NA 1JDPA 3ETDA 4EGCB 3FMOB 2EVWX 2OBBA 1Z0JA 2GILA 2IIQA 4Y6PA 4IRXA 1GEEA 1F60A 2AK3A 4E2FA 5C8YB 3NHJA 1ZR2A 1NUHA 1KERA 3FHCB 3I76A 4MWZA 4JK3A 4QWWA 1XJ0A 4GWGA 5K09A 1C7ZA 2C4MA 1DGQA 5IF3A 3R9WA 1NV9A 1PQ4A 2QSYA 4ETMA 2B8JA 3HKDB 4MW4A 3L8HA 1C3LA 3HYSA 3OUUA 4MW6A 4O5AA 1PV1A 3T35A 3B1VA 3F6BX 4N9WA 2FZWA 2Q6VA 5DULA 1UBUS 2NV6A 3CJRA 4CG0A 1TT5A 3KT8A 4BGDA 4A8JB 2IPLA 3TUZC 4BGEA 2EW2A 5B7PA 2G09A 2W93A 3GZ4A 4NMHA 2DBVO 3B1YA 2Y1WA 2CMKA 2IWRA 3ZV3A 1EFTA 2WZQA 4IFBA 1SUCA 5FA5A 1J9GA 2DT8A 1NW9B 3AEQA 2QN3A 4M0LA 4RTKA 3HCDA 2AZ4A 2VSQA 4YS6A 4A3EI 2AV6A 4Y0AA 3QI2A 4I2VA 2FG7C 1XG5A 2IYOA 3LGSA 5YASA 1RPNA 3TW0A 2W8BB 1WEHA 3NAZA 5BW6B 1E2QA 1GNLA 1XRMA 3L8ZA 3Q7RA 2GKGA 1X3LA 4CF3A 2EZUA 1BMQA 4U6QA 1HNZB 1KYXA 1HDYA 2N42A 2V7WA 3KKEA 4HEA1 5EYPA 1BDIA 3N05A 2IUYA 1NR5A 4GSKA 2XF2A 3OFVA 2Q5CA 2YCBA 4L85A 1CUXA 1XTTA 4NDNE 4U2FA 1VQOZ 4PX5A 1XCPA 2BMWA 4YMVA 2AFRA 5CVDA 5B36A 5I7UA 1DBIA 3T9CA 4CIYA 1VKOA 1W0CA 5KC9A 5FBLB 4DLAA 1UZLA 3NDJA 1ARZA 3MHTA 1LS6A 2Z5GA 5JI2E 1KETA 2I1LA 1MGPA 3FOZA 1SBIA 4M88A 2DTXA 3V7WA 5IC6A 5E3IA 1EUCB 2A5LA 3W5HA 2OZVA 4BNXA 5DGHA 3D4NA 3E8XA 2NZ8A 4QTTB 3PC8C 4G5SA 1YTLA 4LSZA 3TNLA 3W6UA 1UADA 2G36A 2VT2A 3FYCA 1AKWA 1JHPA 2XUIA 4DRXB 3NAMA 4HAWA 1CCWA 3OX2A 3RW9A 2V6FA 4KBFA 3T9BA 2ZM5A 5AJHA 2O5CA 2O7RA 1V8FA 3ZBQA 4EL5A 2EX1A 2J0UB 1ID1A 1YJ8A 4FMDB 4NV0A 1VE3A 1ZOOA 1WMAA 3C3KA 2FEPA 2H11A 3DMYA 4A0HA 4PNPA 2X8WA 1R37A 1TM5E 2C2OA 1XHEA 5SICE 5FI5A 2J0VA 1CY2A 2XMDA 1DKNA 4U7FA 2OCDA 2NNWB 1IY2A 2NPIA 4X7PA 1RYYA 2FUCA 3NHRA 2C5BA 3HV0A 2PLNA 3RIHA 4GPZA 2Z0MA 3WL4A 3RDPA 2DBZA 4MUAA 1RO4A 1WXIA 1BWQA 1UK7A 1FB5A 4D5EA 3KAQA 3K1AA 4XLLA 2KYRA 4O63O 5GJWC 1CJBA 2XV1A 2WBLC 1HYGA 1I3NA 5BVHA 2RG7A 1J49A 2OP0A 1QG6A 1SIOA 4N5LA 5CXUA 3E9CA 5DO9A 1N5OX 1OYWA 4D81A 2VDUE 1U9JA 3B3JA 3G17A 2JCBA 5D8DA 5AVOA 1XTIA 4R9UC 4A8TA 3L82B 3PKIA 3CD61 2DH6A 2X5XA 4WK4B 2VQEB 4GMHA 4DV0B 3NASA 2P75A 2A4KA 3KTAB 4AZWA 2UZ0A 3AJAA 1DEOA 1VPLA 2O9JA 4B3BA 3ODPA 3MT7A 1N5LA 2NU8A 4LTMA 4RM3A 3L0OA 1HNNA 3RGGA 3B3QA 3WNZA 5KQLA 4K3VA 1DKMA 3GTMS 3IDQA 1HR0B 4C01A 1JG6A 2V96A 3BBLA 3TL2A 3C3XA 4XASA 2O1SA 3N3AC 3OZVA 3E0QA 1TWHI 4HG2A 3ELBA 3VPCA 5A0VA 1L9XA 1V39A 3JAMf 2WU0A 2ZUSA 4LZJA 2D0OB 3NNSA 1DRUA 2EKDA 2C5EA 1U8CB 4M21A 5FUXA 5KPJA 4X8OA 2FWPA 1K68A 5EHXA 3HRIA 4OQXA 2HU2A 4XD7D 1GSOA 3Q87A 5HF6A 1E4VA 2GK6A 1QZXA 1RIFA 2OZEA 4DT1B 3ZDDA 4IXDA 3O3MB 1E7MA 5DGTA 2W11A 4R7TA 5K20A 2DERA 1WZIA 3QUBA 5COBA 1E6KA 1YI21 2W6NA 1R6DA 3LVBA 3BUSA 1VIMA 3ENKA 5FWAA 1H2RS 5IULC 2FQYA 3MINB 2G0NA 3WLRA 2V6GA 1YIJZ 1RC8A 3MFQA 1ZNWA 4E5VA 2IX3A 4QYIB 3C1UA 1I36A 1ZW1A 1V8BA 4NG4A 3RK4A 4ZKEA 1VQ41 1H1DA 1YNOA 3TS1A 1RYMA 3FETA 1FE8A 4OBXA 1D2CA 4PN7A 1DHTA 1ORHA 3IVXA 2J9GA 2R84A 1KVUA 1UM9B 2O8NA 3U5TA 2GCIA 4C06A 4E13A 3TTYA 5GP1A 1JR4A 3B60A 4QU9A 1U9IC 1Y8AA 4GZ5A 3C3AA 3NG1A 4X1YA 4WFKA 3TTUA 3NHKA 4FGWA 1RQFA 1HE4A 1T43A 1N2SA 1LK7A 1NIJA 3G89A 4KQIA 1O6GA 1GLVA 4DNOA 4C21A 2WJYA 2P6MA 4J6FA 4QUJA 5GOZA 2GCPA 4RANA 2B1QA 1A71A 3CCCA 4IS2A 4JUCA 1ZONA 4OMCA 1I4TD 1AO3A 1ESCA 1R12A 3AKEA 4Y9TA 5IJ0B 3OTWA 3VPAA 2YMMA 3VBCA 1LFDB 2HGZA 4I6EA 4ARAA 3LUAA 2VDOB 4YQZA 2XNSA 3NDRA 3KOYA 3PNSA 2VP9A 3WYBA 4AP6A 2JLVA 4QASA 1W49A 4BQIA 4ENUA 1AB5A 4GPD1 2BF4A 3C7DB 3FRJA 2G4CA 1A4XA 2WZDA 3PNYA 1Q3HA 3SP1A 4AY4A 1UC8A 1GCGA 3QNUA 4FFRA 2Y0PA 1ZVMA 1L3CA 2BJWA 2I29A 1T36B 1FUUA 3U4AA 3CG4A 3IDOA 4TWJA 1M6WA 3T7DA 4FGLA 4QRIA 4RJTA 3ZU2A 1Q2UA 2YRWA 1DBQA 4P84A 4QQNA 4ENVA 3EPHA 4B6OA 1G2IA 2J09A 4MRRA 3ESRA 1VL5A 3TOCA 4JR1A 3QJYA 5LSAA 1Y8RB 3L4BA 1M2JA 1TKRA 1USGA 1HBJA 1Z35A 3GZNA 1KMQA 1VSBA 3IQEA 1YVDA 4N18A 4P7BA 3DMGA 1TADA 1N9GB 4E88A 1CERA 1GPLA 1EDOA 4RE5A 2GN0A 1WP9A 2NUPB 4Y1EA 2WM9B 5TGZA 5ICSA 2H63A 1TA0A 1FXWF 1TEVA 2PYZA 3GXBA 1P0PA 3NBXX 1O4VA 3S6JA 4FM9A 2CW5A 2GFQA 2IHJA 2VHQA 4FEAA 4GM1A 3ZDQA 1GGKA 4YDHB 4AAYA 5IT9f 4X97A 4CCYA 821PA 4OQEA 1E7YA 3FDFA 3EXG2 4PGGA 2CMGA 2IEDA 5EJAA 3AJ8A 3UGTA 4OQYA 4YAOA 5DLQC 2QYHA 4Z3DA 3LW8A 2DFLA 4HB2A 3E23A 4RL4A 1LBEA 4X3OA 2AGVA 5EIBC 3JD4A 4AKIA 4P93A 1MP0A 1I2ZA 1T35A 4AC9A 5T8KC 3ENWA 3C24A 2CV1A 1F5SA 4DSTA 2RHRA 2UAGA 1TO1E 4G86A 4MAAA 3TLYA 3EDCA 4EQ6A 1ILWA 5AKXA 3GPIA 2FZ4A 4ND5A 4NEHB 4DDMA 3JRXA 1Z28A 4CT0A 1HYHA 3OVMA 3K1AB 3WS7A 1KEVA 3DNPA 3DFMA 3IPXA 5BVHB 3QOXA 4OU4A 2EHJA 2ZJ0A 1C4KA 5G0TA 4KE6A 1CR4A 2D6FA 1G0NA 3A2MA 1M0WA 1F2VA 3O73A 3SZLA 2X7JA 3D3NA 4CLXA 5AKLA 4TSKA 5HF5A 2FEKA 3WIEA 3E2PA 1QUFA 4DLSA 1NASA 2HQBA 1K5PA 1WABA 4XQCA 3GX1A 1XTRA 3F9RA 4BX9A 3DZFA 4F8YA 1Q22A 2JGIA 2ZXFA 4GKVA 1KMMA 2EGGA 5CAEB 4BJ5A 3EH2A 1YQXA 3A6HA 3K0AA 3OEED 2C8JA 5JC8A 5DK4A 3U9TA 1LX7A 2HPAA 1ISIA 3N8GA 3CGGA 3NOVA 5IW8A 4G8JA 3TOSA 4DWOA 2MR5A 4YT5A 4DJEC 5ADUS 4XARA 1XYGA 5ADWA 3NYIA 3H83A 2XUQA 3ZH2A 2IHKA 2IYAA 3C3MA 3Q9LA 1PNQA 1UBNA 2WWGA 4XIYA 2CLLB 5DLEA 4D41A 4DDKA 3I5XA 1PKEA 2J3EA 3KQVA 4G0XA 5IAOA 2ZATA 1W0KA 1C1DA 3GDHA 3DH0A 4KSYA 4ZPJA 1W2GA 2PR2A 5H3LA 3S14I 1RWMA 3HGTA 3HU3A 4JP5A 1M5TA 3N07A 5IS2A 2O8BA 3Q7EA 4J0DA 3PXCX 5DBOA 1IMOA 1LDNA 2O0KA 2XKBA 3O2SB 3RHFA 3VR4D 4XFDA 4D79A 4JCCA 4ZTUB 1HSOA 3DYIA 2YFQA 2F1KA 4EKYA 5DT2A 1QE0A 2H2DA 1VG0B 2XF8A 3QY9A 4ODIA 3PPWA 4C4SA 4OB6A 3R5XA 2VQFB 5ITZA 1J0EA 1UK8A 2EKPA 2WKQA 2BEUA 2OBFA 1XTKA 3F74A 3NNNA 4QOGA 4ESEA 4BU0A 4ZI7A 3CC71 2Z9DA 2PH5A 1H1LA 1BJKA 2ODPA 1Q7Y1 3KVVA 1REQB 2VWHA 4Q3AA 4LXTA 4X1YB 2QT0A 1W1WA 3REOA 1LI7A 3AZPA 3DTTA 5A2Qf 3FWYA 4PZAA 3B52X 2BD0A 3SPXA 1EGVB 5KBYA 1QJCA 2F64A 3FCSB 5HCIA 4WLVA 2IBTA 3FTPA 3CLKA 5D3KA 5JDCA 3MWEA 4KQXA 3E53A 3WSTA 5IDWA 3CMAZ 1AGNA 2AYDA 3K0HA 2VYFA 1CUBA 1HGXA 5K8VA 1P31A 5G1NA 3DWFA 4QKQA 3DNMA 4QVKA 4YMTA 3GBVA 1ZI9A 3MUOA 4ZYWA 1UL1X 5CYGA 3KIPA 1GPMA 2GCEA 2VJKA 4H7KA 5IAGA 1I5OA 4C4ZA 1E0DA 3T7CA 3W2IA 2BPOA 4JLNA 2J7PD 5IJXA 2G63A 1LWNA 1K4KA 1X7GA 1SKBA 4CE6A 3GCZA 4YJFA 1CEQA 4N8SA 4WGFA 3MWYW 1DKUA 5J1SB 2V7TA 4HI0E 4M0EA 3TRIA 4AN0A 3GPCA 4ZT3A 4DL9A 1H2BA 3I72A 3IR7A 5H5JA 3W3AD 3EN0A 1JLRA 1U94A 3GAFA 1DAEA 3C3PA 2B78A 4FMPA 3VH1A 2WNHA 4I9GA 4ZT6A 5ERYA 3IFSA 1DAFA 3ZY2A 4I3HA 4X44A 3U61B 5FPHA 3PR2B 2AMYA 3L04A 3WFJA 4PQYA 4AJJA 4F71A 1JU9A 1JHDA 2IDMA 2XGOA 2OPHA 3F4BA 3N7TA 4MVXA 5CDGA 1RKQA 4RSMA 1SIBE 2IOHA 4FT2A 4AY3A 1GILA 3BXOA 2RBLA 4BFSA 1Z02A 2C3PA 2LD4A 3IMFA 2VS1A 3CCVZ 3A1EA 5TC4A 4BEVA 2VJYA 2XD4A 4EF6A 1P61B 4INZA 2FV8A 1UMBB 1DRWA 5CFZA 1AS0A 1FFSA 3L49A 1GP2A 1T8WA 4UZEA 3KSDO 3WLNA 2PQMA 4CCYB 4JL5A 5DIFA 3SHWA 1OI7A 1S5PA 1XF9A 3V2UA 1NLUA 1HEIA 3DHWC 4J0GA 1GSHA 1Y80A 2PO7A 2Y77A 1PI3A 2AA3A 3C43A 3I1IA 3LVFO 3N2GB 4IZOA 4OJKA 4X62B 3GLIA 3ZBPA 3NWPA 3BE6A 1DUSA 1XYYA 2V7UA 3K6KA 1N3YA 3KEFA 2O3UA 3SU8A 3FDXA 1SK8A 3QBDA 4RZQA 5U9CA 1A9QA 4MWGA 3ZWPA 1Z6AA 4EQ6B 2XZDA 4LOLA 4DA6A 2FMFA 2FY8A 4NBCA 2I99A 3DPIA 4GNKA 4J1TC 3T9FA 4RVGA 3CVWA 1DLJA 1QAOA 4IH4A 2VPWA 4WXPA 4MVJH 1PJRA 5BP7A 5KUTA 1U8EA 4JELA 4K28A 3T41A 1AN9A 3U17A 4Q3BA 3QVKA 3JYPA 4XWYA 5K8CA 3DBRA 2EATA 1NPDA 1MB9A 1T3ZA 4FYJA 3T4EA 4QT0A 3O90A 2OHIA 4KPEC 1KRXA 2GETA 3HNPA 4ARIA 2GVDC 1CY7A 2AFIA 2UUPA 3DOHA 1QTQA 2XMRA 2GO7A 1JEAA 1Q6ZA 2PJRA 3IH5A 2JA8I 1ODLA 1RQPA 1BE0A 1FA9A 1NJSA 2MSWA 4OQNA 4R9VA 1DXOA 5IBPA 4G5YA 4B3FX 2PGOA 1K88A 2D4HA 4G81A 3CUEF 3NC0C 2DPYA 3WQQA 4CMEA 1Z0FA 1DUIA 1BD4A 3K0AB 4JYZA 4LF6B 4QGGA 4ZVLA 5KX5A 3WBJA 2V6IA 5L8VA 1JECA 2W90A 3TZLA 1RXYA 1UC4B 2PSEA 1GAWA 3WICA 1R4NA 4D1YA 5LPNA 2Z5LA 4NDAA 1PQWA 1NMZA 3H97A 4GRIA 4G1MB 2V0NA 3IQGX 3M8KA 1TQ8A 3P0IA 2KI7B 4LYDA 4MI3A 3T5BA 5KKNB 1O8BA 3DMHA 4IZ6A 3A58B 1H4VB 3UPTA 3CIFA 4OHOA 2RC5A 1R6VA 2Z1DA 4TL6A 3N8KA 1SXIA 4QOEA 5CX1B 3GLGB 4E70A 5CA0A 3L0PA 4YCCA 5DYGA 3D6JA 4BMXA 5FOTA 3U80A 3B20A 3CBGA 4HLUC 5CVEA 2VRCD 1EXVA 1XTPA 3QUSA 3SYKA 4XWKA 2OZLA 3DQZA 4RKQA 4AXXA 1V11A 5SYMA 5BMVA 3WWYA 2JGRA 4A8PA 4CPDA 5COQA 4ZHQB 2RFLA 1EUYA 3GCFA 2ID4A 1P5HA 4QUDA 1TC1A 4ZQBA 2PZAA 4F3TA 1YCDA 4FXOA 1G2QA 4MAMA 2BOVA 1DT5A 2B20A 3R3JA 5GJVC 5TGDA 3DYBA 3UB2A 4DDTA 2CSUA 2XRMA 4Z7OB 5ITZB 1E20A 1USIA 3WLSA 621PA 2RARA 4JS0A 1IU9A 4GI3A 2FW1A 4YBRA 1JAHA 4ZCQA 2BI7A 4N3AA 4CF5A 2LFUA 3H3JA 1BQEA 1WVGA 4U7HA 3LCVB 2VPYA 1R4ZA 4E14A 3URKA 3VNAA 2A9OA 2QTNA 1G9TA 4RY9A 3KHSA 4CDMA 4R1SA 2PGJA 2PFGA 3G1TA 4MS1A 3D1VA 4TVBA 4Q05A 4FINA 4FB4A 4UM5A 2UVPA 3E5RA 4IEEA 2EL9A 3FWKA 2OXTA 5JWRA 2AMVA 1JFRA 5CXSA 1GZ5A 3RF6A 3T0GA 4CIXA 4WFQA 4ENQA 5BSKA 4MV3A 4ITUA 3KC2A 1ZI8A 1PR5A 1XDGA 3OJOA 4HR7A 4LHVA 1OPXA 2WI8A 4FKBA 4FNGA 2PRZA 2FFHA 2XDQA 2N3ZA 5E2BA 4ERNA 4CIBA 3THXA 2P8SA 2H1OA 4NFHA 1ODTC 1KSGA 4AP9A 4OAPA 4IO1A 3ZDCA 2JIBA 3RK1A 4ZTZB 2GK3A 3S2HI 5LB2A 4YJFB 3HC7A 1Z7YA 2CFSA 3N8HA 3ZCRA 3PB3A 2ZDHA 1SOVA 1OB5A 3UVEA 3AKZA 1DC5A 4HQKA 1DX4A 3K1YA 2HW8A 4Z9FA 4NMWA 4YN3A 2GPJA 2QREB 2O06A 3HUUA 5H82A 1JSRA 1J4AA 2ZKLA 3WA7A 4PO1A 4Y1FA 2W6MA 5HWSA 4ZEVA 1XEXA 2GZAA 1KY4A 2IPMA 3S2ZA 1ZPDA 5FFFA 1DC7A 2CUKA 5COAA 2H9YA 3A3YA 3GNSA 3LY9A 4GNRA 1SQSA 1WCYA 1U98A 2YC2C 2FSIA 2XUHA 3K32A 5IYZB 5DTIA 3OM1A 2CUTA 1Z0UA 3V8QA 4DIOA 3FPLA 3IUYA 1YA6A 4HVTA 3WV4A 2C4NA 3O6VA 1HFJA 2Z83A 5JJ5A 1KFJB 4G23A 4UAGA 1WDMA 1X42A 3GCGA 1NU8A 4BE9A 1JWAB 4XSVA 3FGOA 5IUKC 4BGVA 5KU1A 4X66B 1Q44A 3UAOA 4K8OA 3PR1A 3GOHA 5CT5A 4AJKA 4BB5A 4C05A 1V25A 2JGEA 4ZU6X 5FUQA 4HNHA 3DD1A 2ZRQA 4KN9S 1CF2O 2JZCA 3U19A 2G83A 2L2QA 3N2EA 4MKRA 3GLIB 1KMCA 1A4UA 1ECCA 3D8HA 1LPOA 5FUBA 1XZLA 1ECFA 2K5RA 1X9HA 2DQYA 3WGYA 5LJLA 1K7XB 2YJZA 2F4NA 2VT7A 3HBLA 1VQKZ 2DUNA 3IP7A 1T4MA 3L8MA 4DQKA 1FPQA 1JZQA 1SCIA 5EKXA 2BMEA 2OMEA 3SXJA 3TAXA 1W1IA 2QS9A 3TKYA 4YRBA 1INLA 2XVMA 4RWZA 5FWXB 2GN2A 2QI9F 1DPFA 1YBVA 2JEOA 2Q1UA 4OGFA 4R2HA 4R31A 4HVCA 2YDYA 3HXKA 3UAYA 1HFKA 3UXMA 3G9XA 5DEOA 2EKZA 4UCQA 1JQKA 1BSVA 2IV3A 1YL6A 2YS7A 2BI8A 2PSDA 3O95A 5HE9A 5B2FA 4HFMA 3SYMA 3ND9A 3VU0A 4F5ZA 3X1MA 1P80A 2PKRA 1K92A 3A0UA 2XWSA 3DDNA 4MA0A 1NJ2A 3UJ3X 3L84A 2A5DA 4TN1A 5B1DA 1CG6A 3QV1A 3QG5A 2YXEA 1CE8B 3CNQS 3WLAA 4JJ4A 3X3HA 5D3MA 4JENA 5A1TA 2JVJA 3F1KA 3QXJA 3U7HB 1NX9A 2Q45A 4JI4B 5EZYF 1MB2A 4MW1A 1C7RA 2J30A 3PQFA 5EMLA 3TNDA 5KX5B 3SVTA 1DDIA 4ZQEA 3D1LA 1WHSB 4TZ0A 2E2II 2RJ3A 4P58A 3W5IA 2AFHA 4ITVA 2RKBA 1J8FA 3PQ5A 1DBPA 1W4AA 3FBTA 4XYMA 3RASA 5AXDA 4CM4B 1NNSA 2WQZA 4Z4FA 1UR5A 1XXLA 3CCSZ 3DEKA 3DXYA 3IVGA 5KSWB 4L50A 4M8IA 3ZLTA 2CZQA 3DNFA 3MOGA 5BVGB 4UBNA 4DC1A 1L6IA 3E3OA 2BLNA 4HQLA 1OT3A 3GLHE 4BASA 1CR2A 1M10A 1DHRA 1RABA 1YZYA 4GUAA 1JAZA 2VSFA 4U2DA 4UARA 4B2YA 1GU0A 1JHXA 1VHLA 1UOQA 2Q0HA 2Q6KA 4FCWA 4CFZA 4GP9A 5BR4A 1IN7A 5K03A 1G9XA 4KMSA 4OIFA 4TQGA 4HQ6A 5TT1A 3WAGA 4K9DA 1VMAA 1MXFA 1UBCA 2P2CA 3O8NA 3CT6A 1FFXA 5DNAA 4HWKA 4EY5A 3MYRA 3SE0A 4DGLA 4RVFA 4DRZA 3LDFA 3V7YA 4TTQA 2XHEA 2QW1A 3M1LA 4MPPA 4GBGA 1ZMBA 2C2ZA 1NLFA 2QPOA 2P2SA 4HZUB 4O4JA 4X45A 1N7GA 4K87A 1JKFA 1OGYA 1UBHS 2X5JO 3E7PA 3GRAA 3GMTA 3KUCA 3AC0A 4J0QA 4MW9A 2W83A 1A5BB 2I2AA 1PJTA 1KJ8A 4YUAA 2G5CA 3RJZA 2RHCA 1MJGM 1W48A 4Q02A 4RACA 4AXBA 2XTAA 2R6CA 2GEJA 3QU2A 5CBKA 2BFOA 4ASUD 3ABIA 3OZGA 2G9RA 4CM9A 4HNTA 1VQP1 1AC5A 1U1EA 1X7XA 2PXHA 1ZH4A 3ENQA 1K8ZB 3HADA 5ALXA 1X15A 1N57A 5IEBA 1JAIA 4NE9A 1L4BA 1NA5A 3H2ZA 3GJ3A 3Q12A 4LCBA 2CHFA 2UVPB 4QYWA 1SXJB 1PQYA 1FTNA 1KP2A 1RAEA 1WPRA 3I9MA 3PWKA 2WU4A 1PVVA 1XCOA 2E2WA 5BQ5A 1ZCJA 2HN9A 1VQ91 2XDQB 2GHTA 3LCCA 1IHPA 3E48A 3M9WA 2FPXA 3O2NA 4ND8A 1N7JA 3UOAB 2DQSA 1ZN2A 3DEJA 4B0OA 3ED5A 4KQFA