2AYDA

Crystal structure of the c-terminal wrky domainof atwrky1, an sa-induced and partially npr1-dependent transcription factor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
SRIVVHTQTLFDIVNDGYRWRKYGQKSVKGSPYPRSYYRCSSPGCPVKKHVERSSHDTKLLITTYEGKHDHDMPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords WRKY transcription factor 1
publication title DNA binding mechanism revealed by high resolution crystal structure of Arabidopsis thaliana WRKY1 protein.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 2aydA01
2LEXA 1WJ2A 2AYDA
chains in the Genus database with same CATH superfamily
3LUSA 2JIPA 5AN9F 3GTGI 2E9HA 3I551 3CC4Z 1VQ9Z 4A3GI 1WZNA 3CCU1 4Y52I 4MD9A 3D2LA 1YUAA 1K732 1K731 3CCRZ 4NBHA 4A3KI 2VPXA 3FQMA 5D1OA 2JA6I 3MONA 4MD8A 3CMEZ 2V45A 1QVFZ 4HH4A 2H85A 2GTHA 3OW2Z 3I4NI 3NH8A 3IX0A 3G711 2LEXA 4NBAA 1ZH1A 3CCE1 1Q822 1Q821 4E31A 2QEXZ 5D1OB 3CCJZ 3FQQA 2IZ3A 2RBLA 2E7ZA 1TFIA 2QRCB 3S17I 1VQNZ 3TE5B 1WJ2A 3S1QI 3OW2Y 4BY1I 1Z02A 3G4SZ 1QYPA 2K3RA 4XX2A 1AA6A 4X6AI 3J81f 1NJI2 1NJI1 3MZKB 3CD61 1N8R2 1N8R1 4E32A 2V8JA 2JIOA 2JMOA 4A3CI 2R93I 2HU9A 3VMHA 3GTJI 1TWCI 1RO0A 3D9XA 2YADA 1TWHI 2V3VA 2QKDA 3GTKI 4RVFA 4NFRA 4QTUA 2JR6A 1Y1VS 2BJOA 2Q4ZA 1VQP1 4HGYA 1Z03A 3I561 4S1TA 3J80f 2OTLZ 3CQZI 1FDIA 3F3PC 1L1OC 2JA5I 2K5RA 1RNIA 3HOXI 4Y7NI 3CXCY 3CPWZ 1YJW1 4E2ZA 2JA8I 3M3YI 1YJN1 1R9TI 3CC7Z 1Y8CA 3Q87A 2NVYI 4AYBA 4RVHA 2VPZA 2RHBA 2G2KA 4E33A 1Q16A 1NP6A 2O4HA 3J80b 3I07A 3CCQZ 1WCMI 1TWAI 5T64A 2QLVB 3S1RI 4RVGA 1W2BZ 4A93I 4NBCA 1I6HI 3HOVI 4TNUA 3P5JB 2WAQA 1VQ8Z 3CCL1 5IT9f 2AYDA 1VQL1 3G6E1 2W04A 2NAPA 2JS4A 1VQMZ 1RO2A 1YHQ1 1VQ61 5A2Qf 1YI2Z 2R7ZI 3IF8A 1VLAA 1KRLA 4E2YA 4A3BI 1VQKZ 3HOWI 1FDOA 2J6AA 1W2BY 1YUKA 1VQ4Z 3CC21 2LIYA 1VQ71 3GCFA 2JA7I 1VQOZ 3S14I 5C4XI 5FLXb 3S2DI 3GTOI 5T67A 3CCV1 4E2XA 2V8KA 2KI7B 3S1NI 5IT9b 2R6MA 5A2Qb 3IR7A 1ML8A 1I3QI 3CC41 1VQ91 1QVFY 2F4OA 2QA4Z 4NBDA 2PK7A 4RVDA 3CCR1 3ESWA 1KC82 1KC81 3CME1 1Y1WI 5LL6f 1LQLA 4EWCA 4A3JI 2ZAEB 4RV9A 3H3VJ 3H0GI 2RIQA 2M48A 1YJ9Z 2O53A 3PO2I 2QEX1 4BXXI 2QR1B 3NH4A 2IV2X 1N2FA 3CCJ1 1P9NA 1QF8A 3EEDA 3U50C 3M4OI 1VQN1 3CCSZ 2F4MA 4NB8A 5CM2M 2I3CA 4CL1A 2P3YA 3GTPI 4E30A 3G4S1 1S72Z 1YITZ 1KD12 1KD11 2IZ4A 4A3EI 4NBBA 4MXUA 2QREB 4HGZA 4E2WA 1DL6A 1M902 1M901 2DE5A 3CMAZ 4DQYB 2W03A 1K83I 2JNYA 3KIHA 3I55Z 2LFUA 5C44I 3CCUZ 1JJ2Z 4A3DI 3CPWY 3MZLB 1WIIA 1NUIA 5FLXf 2OTL1 2DE6A 2M6NA 3NH5A 3PO3S 1VQ5Z 1QXFA 3RZDI 2RPRA 2PMZA 3G71Z 1KQSZ 2E2HI 3KIFA 4A3LI 3VB9A 4NOZA 2HF1A 3CC71 1PFTA 3I4MI 3BG1B 1X0TA 3VMIA 5C4JI 3J7A4 2Y0SA 4A3FI 1K9M1 1K9M2 3PO3I 2JIRA 1QVGZ 1RLYA 2GU2A 3GTQI 3CCQ1 3CCMZ 4MD7A 2QRDB 3CD6Z 1KQSY 2OOYB 5C3EI 4MRIA 3S2HI 1ZB8A 2DE7A 2R92I 4BY7I 3NDIA 1VQ51 1VQ81 1I50I 1Q7Y2 1Q7Y1 1QVGY 1VQM1 3HOYI 2NVXI 4DK1A 1VQPZ 3T4NB 1YI21 3S15I 1Q812 2P28A 1Q811 3HOUI 2V8IA 3GTMS 5T6BA 3I56Z 1USPA 1VQK1 3F3FC 2GTIA 1VQ41 4A3MI 2JIQA 5FLMI 1TWGI 1VQO1 4NBFA 2WB1A 3CCM1 2PM9A 4MONA 2Q51A 3BG0B 4A3II 2B63I 3TDHB 1USPB 2NVTI 1YJWZ 3JAMf 3GTMI 1M1K2 1M1K1 1YJNZ 2VUMI 3GKQA 1X3WA 1SIWA 1S7MA 2EGTA 3K7AI 2AKLA 2QA41 3CXCZ 4NH1C 1ZB9A 3S1MI 1TWFI 2VUGA 5IP9I 2OTJZ 4NBEA 2NVQI 4BBSI 3VTNA 3J81b 2OOXB 3NFZA 4NB9A 2VPYA 4DGLA 1YIJZ 2E2JI 3EERA 1X3ZA 3HKZA 3HOZI 3D6WA 2KPIA 3JAMb 1YJ91 3QWUA 3CCLZ 1Y1VI 1VQLZ 3G6EZ 1Q862 1Q861 1RO4A 1YHQZ 1VQ6Z 2VF1A 3IFUA 4RS4A 3RZOI 4BBRI 3CCS1 3S16I 2VPWA 1WW9A 2E2II 3VMGA 1SFOI 5D1PA 3CC2Z 1S721 1VQ7Z 1YIT1 2RT9A 5IP7I 1Z01A 3GTLI 1RQFA 3CCEZ 2OZKA 2JUBA 2YU9I 1JWHC 2OTJ1 3FKII 3CCVZ 2JIMA 4QTTA 3NDJA 4MH4A 1K8A2 1K8A1 1JJ2Y 3CMA1 1YIJ1 4NBGA
chains in the Genus database with same CATH topology
2LEXA 1WJ2A 2AYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEX A;  1WJ2 A;  2AYD A; 
#chains in the Genus database with same CATH topology
 3LUS A;  2JIP A;  5AN9 F;  3GTG I;  2E9H A;  3I55 1;  3CC4 Z;  1VQ9 Z;  4A3G I;  1WZN A;  3CCU 1;  4Y52 I;  4MD9 A;  3D2L A;  1YUA A;  1K73 2;  1K73 1;  3CCR Z;  4NBH A;  4A3K I;  2VPX A;  3FQM A;  5D1O A;  2JA6 I;  3MON A;  4MD8 A;  3CME Z;  2V45 A;  1QVF Z;  4HH4 A;  2H85 A;  2GTH A;  3OW2 Z;  3I4N I;  3NH8 A;  3IX0 A;  3G71 1;  2LEX A;  4NBA A;  1ZH1 A;  3CCE 1;  1Q82 2;  1Q82 1;  4E31 A;  2QEX Z;  5D1O B;  3CCJ Z;  3FQQ A;  2IZ3 A;  2RBL A;  2E7Z A;  1TFI A;  2QRC B;  3S17 I;  1VQN Z;  3TE5 B;  1WJ2 A;  3S1Q I;  3OW2 Y;  4BY1 I;  1Z02 A;  3G4S Z;  1QYP A;  2K3R A;  4XX2 A;  1AA6 A;  4X6A I;  3J81 f;  1NJI 2;  1NJI 1;  3MZK B;  3CD6 1;  1N8R 2;  1N8R 1;  4E32 A;  2V8J A;  2JIO A;  2JMO A;  4A3C I;  2R93 I;  2HU9 A;  3VMH A;  3GTJ I;  1TWC I;  1RO0 A;  3D9X A;  2YAD A;  1TWH I;  2V3V A;  2QKD A;  3GTK I;  4RVF A;  4NFR A;  4QTU A;  2JR6 A;  1Y1V S;  2BJO A;  2Q4Z A;  1VQP 1;  4HGY A;  1Z03 A;  3I56 1;  4S1T A;  3J80 f;  2OTL Z;  3CQZ I;  1FDI A;  3F3P C;  1L1O C;  2JA5 I;  2K5R A;  1RNI A;  3HOX I;  4Y7N I;  3CXC Y;  3CPW Z;  1YJW 1;  4E2Z A;  2JA8 I;  3M3Y I;  1YJN 1;  1R9T I;  3CC7 Z;  1Y8C A;  3Q87 A;  2NVY I;  4AYB A;  4RVH A;  2VPZ A;  2RHB A;  2G2K A;  4E33 A;  1Q16 A;  1NP6 A;  2O4H A;  3J80 b;  3I07 A;  3CCQ Z;  1WCM I;  1TWA I;  5T64 A;  2QLV B;  3S1R I;  4RVG A;  1W2B Z;  4A93 I;  4NBC A;  1I6H I;  3HOV I;  4TNU A;  3P5J B;  2WAQ A;  1VQ8 Z;  3CCL 1;  5IT9 f;  2AYD A;  1VQL 1;  3G6E 1;  2W04 A;  2NAP A;  2JS4 A;  1VQM Z;  1RO2 A;  1YHQ 1;  1VQ6 1;  5A2Q f;  1YI2 Z;  2R7Z I;  3IF8 A;  1VLA A;  1KRL A;  4E2Y A;  4A3B I;  1VQK Z;  3HOW I;  1FDO A;  2J6A A;  1W2B Y;  1YUK A;  1VQ4 Z;  3CC2 1;  2LIY A;  1VQ7 1;  3GCF A;  2JA7 I;  1VQO Z;  3S14 I;  5C4X I;  5FLX b;  3S2D I;  3GTO I;  5T67 A;  3CCV 1;  4E2X A;  2V8K A;  2KI7 B;  3S1N I;  5IT9 b;  2R6M A;  5A2Q b;  3IR7 A;  1ML8 A;  1I3Q I;  3CC4 1;  1VQ9 1;  1QVF Y;  2F4O A;  2QA4 Z;  4NBD A;  2PK7 A;  4RVD A;  3CCR 1;  3ESW A;  1KC8 2;  1KC8 1;  3CME 1;  1Y1W I;  5LL6 f;  1LQL A;  4EWC A;  4A3J I;  2ZAE B;  4RV9 A;  3H3V J;  3H0G I;  2RIQ A;  2M48 A;  1YJ9 Z;  2O53 A;  3PO2 I;  2QEX 1;  4BXX I;  2QR1 B;  3NH4 A;  2IV2 X;  1N2F A;  3CCJ 1;  1P9N A;  1QF8 A;  3EED A;  3U50 C;  3M4O I;  1VQN 1;  3CCS Z;  2F4M A;  4NB8 A;  5CM2 M;  2I3C A;  4CL1 A;  2P3Y A;  3GTP I;  4E30 A;  3G4S 1;  1S72 Z;  1YIT Z;  1KD1 2;  1KD1 1;  2IZ4 A;  4A3E I;  4NBB A;  4MXU A;  2QRE B;  4HGZ A;  4E2W A;  1DL6 A;  1M90 2;  1M90 1;  2DE5 A;  3CMA Z;  4DQY B;  2W03 A;  1K83 I;  2JNY A;  3KIH A;  3I55 Z;  2LFU A;  5C44 I;  3CCU Z;  1JJ2 Z;  4A3D I;  3CPW Y;  3MZL B;  1WII A;  1NUI A;  5FLX f;  2OTL 1;  2DE6 A;  2M6N A;  3NH5 A;  3PO3 S;  1VQ5 Z;  1QXF A;  3RZD I;  2RPR A;  2PMZ A;  3G71 Z;  1KQS Z;  2E2H I;  3KIF A;  4A3L I;  3VB9 A;  4NOZ A;  2HF1 A;  3CC7 1;  1PFT A;  3I4M I;  3BG1 B;  1X0T A;  3VMI A;  5C4J I;  3J7A 4;  2Y0S A;  4A3F I;  1K9M 1;  1K9M 2;  3PO3 I;  2JIR A;  1QVG Z;  1RLY A;  2GU2 A;  3GTQ I;  3CCQ 1;  3CCM Z;  4MD7 A;  2QRD B;  3CD6 Z;  1KQS Y;  2OOY B;  5C3E I;  4MRI A;  3S2H I;  1ZB8 A;  2DE7 A;  2R92 I;  4BY7 I;  3NDI A;  1VQ5 1;  1VQ8 1;  1I50 I;  1Q7Y 2;  1Q7Y 1;  1QVG Y;  1VQM 1;  3HOY I;  2NVX I;  4DK1 A;  1VQP Z;  3T4N B;  1YI2 1;  3S15 I;  1Q81 2;  2P28 A;  1Q81 1;  3HOU I;  2V8I A;  3GTM S;  5T6B A;  3I56 Z;  1USP A;  1VQK 1;  3F3F C;  2GTI A;  1VQ4 1;  4A3M I;  2JIQ A;  5FLM I;  1TWG I;  1VQO 1;  4NBF A;  2WB1 A;  3CCM 1;  2PM9 A;  4MON A;  2Q51 A;  3BG0 B;  4A3I I;  2B63 I;  3TDH B;  1USP B;  2NVT I;  1YJW Z;  3JAM f;  3GTM I;  1M1K 2;  1M1K 1;  1YJN Z;  2VUM I;  3GKQ A;  1X3W A;  1SIW A;  1S7M A;  2EGT A;  3K7A I;  2AKL A;  2QA4 1;  3CXC Z;  4NH1 C;  1ZB9 A;  3S1M I;  1TWF I;  2VUG A;  5IP9 I;  2OTJ Z;  4NBE A;  2NVQ I;  4BBS I;  3VTN A;  3J81 b;  2OOX B;  3NFZ A;  4NB9 A;  2VPY A;  4DGL A;  1YIJ Z;  2E2J I;  3EER A;  1X3Z A;  3HKZ A;  3HOZ I;  3D6W A;  2KPI A;  3JAM b;  1YJ9 1;  3QWU A;  3CCL Z;  1Y1V I;  1VQL Z;  3G6E Z;  1Q86 2;  1Q86 1;  1RO4 A;  1YHQ Z;  1VQ6 Z;  2VF1 A;  3IFU A;  4RS4 A;  3RZO I;  4BBR I;  3CCS 1;  3S16 I;  2VPW A;  1WW9 A;  2E2I I;  3VMG A;  1SFO I;  5D1P A;  3CC2 Z;  1S72 1;  1VQ7 Z;  1YIT 1;  2RT9 A;  5IP7 I;  1Z01 A;  3GTL I;  1RQF A;  3CCE Z;  2OZK A;  2JUB A;  2YU9 I;  1JWH C;  2OTJ 1;  3FKI I;  3CCV Z;  2JIM A;  4QTT A;  3NDJ A;  4MH4 A;  1K8A 2;  1K8A 1;  1JJ2 Y;  3CMA 1;  1YIJ 1;  4NBG A; 
#chains in the Genus database with same CATH homology
 2LEX A;  1WJ2 A;  2AYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...