2AYDA

Crystal structure of the c-terminal wrky domainof atwrky1, an sa-induced and partially npr1-dependent transcription factor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
SRIVVHTQTLFDIVNDGYRWRKYGQKSVKGSPYPRSYYRCSSPGCPVKKHVERSSHDTKLLITTYEGKHDHDMPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords WRKY transcription factor 1
publication title DNA binding mechanism revealed by high resolution crystal structure of Arabidopsis thaliana WRKY1 protein.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 2aydA01
2AYDA 2LEXA 1WJ2A
chains in the Genus database with same CATH superfamily
2OZKA 3D6WA 3NDJA 3NH5A 3GKQA 3CCV1 2JIMA 5CM2M 4DQYB 2LFUA 3T4NB 1VQ71 1WIIA 2NAPA 3TE5B 1Z03A 4E2WA 2VUMI 2QA4Z 1Q7Y1 3CCQZ 4NB9A 3CMA1 1TWCI 2EGTA 1Q822 2Q51A 4XX2A 4A3GI 2QEXZ 3CCE1 1RO2A 4S1TA 1JJ2Z 2R6MA 4HGZA 1Y1VI 4E30A 3JAMf 2R93I 3EERA 3JAMb 3HOVI 2I3CA 1WZNA 1ML8A 2VPWA 1Q811 4BY1I 2K5RA 1USPB 3CCSZ 3GTKI 3CCMZ 5LL6f 1QVFZ 4DK1A 3RZDI 2J6AA 2DE5A 2QEX1 1ZB8A 4BBRI 1ZH1A 3IFUA 4HH4A 2PK7A 2E2II 2B63I 3M4OI 5T6BA 3GTQI 4Y52I 3OW2Z 1Z01A 4NBBA 1WCMI 2YU9I 3HKZA 5T67A 3J80b 2JS4A 2VUGA 4A3BI 1VQPZ 3RZOI 3F3FC 4HGYA 1Y1VS 2YADA 2OTLZ 2KI7B 1RNIA 3CCS1 3CCM1 2QLVB 3FQMA 2E2JI 1YUAA 1ZB9A 2O4HA 3H0GI 4A3KI 1SIWA 2JA8I 1M901 1JJ2Y 2JIOA 5T64A 2JMOA 4MONA 1KQSY 5FLMI 2RBLA 1TWHI 3EEDA 1VQP1 2JNYA 3GTJI 2H85A 4NB8A 2JR6A 3K7AI 5FLXf 2GTHA 1RO4A 2OTL1 3HOWI 3FKII 2AYDA 5FLXb 2RHBA 3NH4A 2QR1B 3GTPI 3S15I 2P28A 1K83I 2JA5I 1RLYA 1K8A2 2QKDA 3PO3I 1N2FA 3NFZA 3CC2Z 1VQ9Z 4NH1C 4DGLA 1N8R2 4E2XA 4NBAA 2HF1A 1Q861 3CXCY 3MZKB 1VQ4Z 5C4JI 3GTOI 1Q16A 3D9XA 5C44I 1K9M1 2LEXA 1L1OC 3PO2I 2PMZA 1YUKA 2NVQI 3H3VJ 1X0TA 2PM9A 1YJWZ 2M48A 5D1PA 2LIYA 3FQQA 3D2LA 1NUIA 3CC21 4A3JI 4MD7A 1VQ91 3Q87A 1YIT1 1R9TI 2F4MA 3CMEZ 3PO3S 2Q4ZA 3CC4Z 1JWHC 1VQ41 4E31A 1RO0A 5IT9f 1KQSZ 2VPXA 1KD12 5IT9b 2OTJZ 4CL1A 5IP9I 1NJI2 5D1OA 3S1QI 2BJOA 4A3DI 1RQFA 1YJW1 2QA41 2P3YA 3CCQ1 3G71Z 5AN9F 2KPIA 3CME1 2M6NA 1M1K2 4AYBA 3CC41 1K732 3J80f 1KC82 1QXFA 1VQ5Z 2VPZA 3NH8A 3BG1B 3NDIA 3CXCZ 3I56Z 1DL6A 1YI2Z 2RT9A 1VQOZ 4NBEA 5A2Qf 4QTUA 1Q7Y2 2V8IA 5A2Qb 3G711 2Y0SA 2ZAEB 2IZ4A 3J81f 3G6EZ 1NP6A 3I07A 3GTMI 3J81b 3GTLI 1VLAA 1VQ51 2OOYB 1VQKZ 2RIQA 2HU9A 1WW9A 2E7ZA 3KIHA 1YI21 3VMGA 2W03A 1VQO1 1Q812 1Q821 3GTGI 4BXXI 2JA7I 4TNUA 5IP7I 5C3EI 1SFOI 1Z02A 3CCJZ 1W2BZ 1TWFI 2WB1A 3CD6Z 3CCUZ 2GTIA 3VMHA 4NBCA 1QF8A 2V8KA 4A3MI 1Y1WI 3I4NI 4RVHA 2R7ZI 1VQK1 4A3LI 2V45A 2V3VA 3GTMS 4EWCA 1VQMZ 3G4SZ 4RS4A 1WJ2A 3CMAZ 2QREB 3CCJ1 4QTTA 3CPWY 3IX0A 2DE7A 3CD61 1VQLZ 4A3CI 3CCU1 1M902 4NBGA 3S17I 2JIQA 5D1OB 3I55Z 4NOZA 3F3PC 3VTNA 3CC7Z 1Y8CA 1KRLA 1VQM1 3J7A4 3G4S1 1I6HI 2R92I 4A3FI 3IR7A 4RVGA 4MD8A 3HOYI 2W04A 4RVDA 1W2BY 4E33A 1YHQZ 4BY7I 1QVGY 2AKLA 1TWAI 1VQL1 4X6AI 1P9NA 2RPRA 2F4OA 3M3YI 5C4XI 2O53A 3S16I 1VQ6Z 2K3RA 3I551 4MH4A 3S14I 4A3EI 1AA6A 1YJ9Z 2IZ3A 2V8JA 3S1MI 2NVXI 1Q862 3CC71 4E2YA 1YIJZ 2GU2A 2OTJ1 2QRCB 4E32A 1TWGI 1K8A1 2IV2X 4MRIA 4NBDA 3S1RI 3CCRZ 1YHQ1 4BBSI 1YJNZ 1K9M2 2NVYI 3MZLB 4E2ZA 3VMIA 4A93I 1FDOA 3VB9A 4Y7NI 1N8R1 2QRDB 1S7MA 1VQNZ 1USPA 3CCLZ 4RVFA 2VF1A 1VQ8Z 1PFTA 1VQ61 3CPWZ 3HOXI 2NVTI 1YJ91 3TDHB 3I4MI 1I50I 3CQZI 2JIPA 3HOZI 3S1NI 1YIJ1 2JIRA 3IF8A 4NBHA 1I3QI 3I561 3CCR1 4RV9A 1YJN1 3ESWA 2JUBA 1X3WA 4MD9A 1VQN1 3S2DI 3CCL1 2E9HA 1QVGZ 2VPYA 1VQ81 2JA6I 3QWUA 1S72Z 3BG0B 3G6E1 4NFRA 4NBFA 3U50C 1KD11 2OOXB 1NJI1 3CCVZ 3LUSA 1TFIA 3MONA 2E2HI 1FDIA 3P5JB 1QYPA 1QVFY 1X3ZA 1VQ7Z 4MXUA 2DE6A 3KIFA 2WAQA 3HOUI 1M1K1 3GCFA 3OW2Y 1YITZ 1K731 1LQLA 3CCEZ 1S721 2G2KA 1KC81 4A3II 3S2HI
chains in the Genus database with same CATH topology
2AYDA 2LEXA 1WJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYD A;  2LEX A;  1WJ2 A; 
#chains in the Genus database with same CATH topology
 2OZK A;  3D6W A;  3NDJ A;  3NH5 A;  3GKQ A;  3CCV 1;  2JIM A;  5CM2 M;  4DQY B;  2LFU A;  3T4N B;  1VQ7 1;  1WII A;  2NAP A;  3TE5 B;  1Z03 A;  4E2W A;  2VUM I;  2QA4 Z;  1Q7Y 1;  3CCQ Z;  4NB9 A;  3CMA 1;  1TWC I;  2EGT A;  1Q82 2;  2Q51 A;  4XX2 A;  4A3G I;  2QEX Z;  3CCE 1;  1RO2 A;  4S1T A;  1JJ2 Z;  2R6M A;  4HGZ A;  1Y1V I;  4E30 A;  3JAM f;  2R93 I;  3EER A;  3JAM b;  3HOV I;  2I3C A;  1WZN A;  1ML8 A;  2VPW A;  1Q81 1;  4BY1 I;  2K5R A;  1USP B;  3CCS Z;  3GTK I;  3CCM Z;  5LL6 f;  1QVF Z;  4DK1 A;  3RZD I;  2J6A A;  2DE5 A;  2QEX 1;  1ZB8 A;  4BBR I;  1ZH1 A;  3IFU A;  4HH4 A;  2PK7 A;  2E2I I;  2B63 I;  3M4O I;  5T6B A;  3GTQ I;  4Y52 I;  3OW2 Z;  1Z01 A;  4NBB A;  1WCM I;  2YU9 I;  3HKZ A;  5T67 A;  3J80 b;  2JS4 A;  2VUG A;  4A3B I;  1VQP Z;  3RZO I;  3F3F C;  4HGY A;  1Y1V S;  2YAD A;  2OTL Z;  2KI7 B;  1RNI A;  3CCS 1;  3CCM 1;  2QLV B;  3FQM A;  2E2J I;  1YUA A;  1ZB9 A;  2O4H A;  3H0G I;  4A3K I;  1SIW A;  2JA8 I;  1M90 1;  1JJ2 Y;  2JIO A;  5T64 A;  2JMO A;  4MON A;  1KQS Y;  5FLM I;  2RBL A;  1TWH I;  3EED A;  1VQP 1;  2JNY A;  3GTJ I;  2H85 A;  4NB8 A;  2JR6 A;  3K7A I;  5FLX f;  2GTH A;  1RO4 A;  2OTL 1;  3HOW I;  3FKI I;  2AYD A;  5FLX b;  2RHB A;  3NH4 A;  2QR1 B;  3GTP I;  3S15 I;  2P28 A;  1K83 I;  2JA5 I;  1RLY A;  1K8A 2;  2QKD A;  3PO3 I;  1N2F A;  3NFZ A;  3CC2 Z;  1VQ9 Z;  4NH1 C;  4DGL A;  1N8R 2;  4E2X A;  4NBA A;  2HF1 A;  1Q86 1;  3CXC Y;  3MZK B;  1VQ4 Z;  5C4J I;  3GTO I;  1Q16 A;  3D9X A;  5C44 I;  1K9M 1;  2LEX A;  1L1O C;  3PO2 I;  2PMZ A;  1YUK A;  2NVQ I;  3H3V J;  1X0T A;  2PM9 A;  1YJW Z;  2M48 A;  5D1P A;  2LIY A;  3FQQ A;  3D2L A;  1NUI A;  3CC2 1;  4A3J I;  4MD7 A;  1VQ9 1;  3Q87 A;  1YIT 1;  1R9T I;  2F4M A;  3CME Z;  3PO3 S;  2Q4Z A;  3CC4 Z;  1JWH C;  1VQ4 1;  4E31 A;  1RO0 A;  5IT9 f;  1KQS Z;  2VPX A;  1KD1 2;  5IT9 b;  2OTJ Z;  4CL1 A;  5IP9 I;  1NJI 2;  5D1O A;  3S1Q I;  2BJO A;  4A3D I;  1RQF A;  1YJW 1;  2QA4 1;  2P3Y A;  3CCQ 1;  3G71 Z;  5AN9 F;  2KPI A;  3CME 1;  2M6N A;  1M1K 2;  4AYB A;  3CC4 1;  1K73 2;  3J80 f;  1KC8 2;  1QXF A;  1VQ5 Z;  2VPZ A;  3NH8 A;  3BG1 B;  3NDI A;  3CXC Z;  3I56 Z;  1DL6 A;  1YI2 Z;  2RT9 A;  1VQO Z;  4NBE A;  5A2Q f;  4QTU A;  1Q7Y 2;  2V8I A;  5A2Q b;  3G71 1;  2Y0S A;  2ZAE B;  2IZ4 A;  3J81 f;  3G6E Z;  1NP6 A;  3I07 A;  3GTM I;  3J81 b;  3GTL I;  1VLA A;  1VQ5 1;  2OOY B;  1VQK Z;  2RIQ A;  2HU9 A;  1WW9 A;  2E7Z A;  3KIH A;  1YI2 1;  3VMG A;  2W03 A;  1VQO 1;  1Q81 2;  1Q82 1;  3GTG I;  4BXX I;  2JA7 I;  4TNU A;  5IP7 I;  5C3E I;  1SFO I;  1Z02 A;  3CCJ Z;  1W2B Z;  1TWF I;  2WB1 A;  3CD6 Z;  3CCU Z;  2GTI A;  3VMH A;  4NBC A;  1QF8 A;  2V8K A;  4A3M I;  1Y1W I;  3I4N I;  4RVH A;  2R7Z I;  1VQK 1;  4A3L I;  2V45 A;  2V3V A;  3GTM S;  4EWC A;  1VQM Z;  3G4S Z;  4RS4 A;  1WJ2 A;  3CMA Z;  2QRE B;  3CCJ 1;  4QTT A;  3CPW Y;  3IX0 A;  2DE7 A;  3CD6 1;  1VQL Z;  4A3C I;  3CCU 1;  1M90 2;  4NBG A;  3S17 I;  2JIQ A;  5D1O B;  3I55 Z;  4NOZ A;  3F3P C;  3VTN A;  3CC7 Z;  1Y8C A;  1KRL A;  1VQM 1;  3J7A 4;  3G4S 1;  1I6H I;  2R92 I;  4A3F I;  3IR7 A;  4RVG A;  4MD8 A;  3HOY I;  2W04 A;  4RVD A;  1W2B Y;  4E33 A;  1YHQ Z;  4BY7 I;  1QVG Y;  2AKL A;  1TWA I;  1VQL 1;  4X6A I;  1P9N A;  2RPR A;  2F4O A;  3M3Y I;  5C4X I;  2O53 A;  3S16 I;  1VQ6 Z;  2K3R A;  3I55 1;  4MH4 A;  3S14 I;  4A3E I;  1AA6 A;  1YJ9 Z;  2IZ3 A;  2V8J A;  3S1M I;  2NVX I;  1Q86 2;  3CC7 1;  4E2Y A;  1YIJ Z;  2GU2 A;  2OTJ 1;  2QRC B;  4E32 A;  1TWG I;  1K8A 1;  2IV2 X;  4MRI A;  4NBD A;  3S1R I;  3CCR Z;  1YHQ 1;  4BBS I;  1YJN Z;  1K9M 2;  2NVY I;  3MZL B;  4E2Z A;  3VMI A;  4A93 I;  1FDO A;  3VB9 A;  4Y7N I;  1N8R 1;  2QRD B;  1S7M A;  1VQN Z;  1USP A;  3CCL Z;  4RVF A;  2VF1 A;  1VQ8 Z;  1PFT A;  1VQ6 1;  3CPW Z;  3HOX I;  2NVT I;  1YJ9 1;  3TDH B;  3I4M I;  1I50 I;  3CQZ I;  2JIP A;  3HOZ I;  3S1N I;  1YIJ 1;  2JIR A;  3IF8 A;  4NBH A;  1I3Q I;  3I56 1;  3CCR 1;  4RV9 A;  1YJN 1;  3ESW A;  2JUB A;  1X3W A;  4MD9 A;  1VQN 1;  3S2D I;  3CCL 1;  2E9H A;  1QVG Z;  2VPY A;  1VQ8 1;  2JA6 I;  3QWU A;  1S72 Z;  3BG0 B;  3G6E 1;  4NFR A;  4NBF A;  3U50 C;  1KD1 1;  2OOX B;  1NJI 1;  3CCV Z;  3LUS A;  1TFI A;  3MON A;  2E2H I;  1FDI A;  3P5J B;  1QYP A;  1QVF Y;  1X3Z A;  1VQ7 Z;  4MXU A;  2DE6 A;  3KIF A;  2WAQ A;  3HOU I;  1M1K 1;  3GCF A;  3OW2 Y;  1YIT Z;  1K73 1;  1LQL A;  3CCE Z;  1S72 1;  2G2K A;  1KC8 1;  4A3I I;  3S2H I; 
#chains in the Genus database with same CATH homology
 2AYD A;  2LEX A;  1WJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...