2AYDA

Crystal structure of the c-terminal wrky domainof atwrky1, an sa-induced and partially npr1-dependent transcription factor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
SRIVVHTQTLFDIVNDGYRWRKYGQKSVKGSPYPRSYYRCSSPGCPVKKHVERSSHDTKLLITTYEGKHDHDMPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords WRKY transcription factor 1
publication title DNA binding mechanism revealed by high resolution crystal structure of Arabidopsis thaliana WRKY1 protein.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 2aydA01
2AYDA 1WJ2A 2LEXA
chains in the Genus database with same CATH superfamily
1YI2Z 1VQ51 4A3GI 2E7ZA 3CCE1 4MD9A 3CCV1 3CCUZ 3FQMA 1QF8A 1L1OC 1FDIA 1VQMZ 2DE6A 3GTPI 4NBDA 2J6AA 3P5JB 2JMOA 3H0GI 3D2LA 5T67A 1KD11 1S7MA 1M902 3KIFA 2DE5A 3I4MI 2HU9A 3S15I 5C4JI 3TE5B 1VQK1 1Q811 4NBGA 2VPWA 1YIT1 2JS4A 1VQPZ 1I50I 1QXFA 1Y1VS 2OOYB 5C4XI 2IZ3A 2RPRA 2R92I 1X0TA 3VMHA 3HOYI 5A2Qb 3CD6Z 1YJW1 3CCR1 2GTHA 2VPZA 4E2ZA 3CCM1 2O53A 3D9XA 2AKLA 2PMZA 3J81f 1VQL1 2E2II 1K83I 3IF8A 3CMEZ 3K7AI 4DQYB 1VQ6Z 2E2JI 1USPA 3VB9A 4MD7A 2YU9I 3MONA 3NH5A 2QA41 4A3DI 2Y0SA 5FLMI 4RVHA 1YIJ1 3NDJA 3OW2Y 1VQO1 1N8R1 2OTL1 3CC21 3CXCY 1TWAI 2HF1A 4NBBA 3NDIA 4HGZA 1M1K2 1VQ8Z 3I4NI 1NUIA 1QYPA 3CCSZ 2WB1A 3Q87A 1VQ71 3J80b 3G4S1 3CCL1 4QTUA 3OW2Z 2VUGA 3GCFA 3GTJI 2JA8I 2OTJZ 4RVGA 3I55Z 3GTLI 2QEX1 1WZNA 2Q51A 3CQZI 5FLXf 1Q821 4X6AI 3GTKI 2V8KA 2B63I 1Y8CA 2GTIA 1QVGZ 1S72Z 1K731 1VQNZ 2EGTA 1KC81 1VQ5Z 4RV9A 4NBAA 1K8A2 3HOXI 1WIIA 4S1TA 1K9M1 2G2KA 3G6E1 3FQQA 1X3ZA 4EWCA 2VPYA 3G711 4NBEA 4NBHA 1W2BY 4E2XA 1Q861 1VQKZ 1RNIA 1DL6A 3HOZI 1YITZ 2V8JA 3J81b 1AA6A 3GTGI 3CCJ1 1NJI1 2OOXB 3S17I 1YJWZ 3CPWZ 1YUAA 3CCMZ 4CL1A 1W2BZ 2M6NA 3ESWA 3CMA1 3RZOI 3S14I 1QVFY 4A3CI 4QTTA 1VQLZ 3M4OI 3U50C 1ML8A 2JA6I 1KQSZ 2QRDB 2V3VA 3RZDI 2AYDA 4A3EI 3VMGA 2R6MA 1ZB9A 2IZ4A 2RBLA 1TWHI 5D1OA 3CCQ1 1YJN1 1WJ2A 2E9HA 2W04A 2QA4Z 1Q7Y2 1QVFZ 1Z01A 1RO4A 3MZLB 4AYBA 1YIJZ 3GTMI 4XX2A 1VQOZ 2OTLZ 2H85A 3CCU1 3CC2Z 3I07A 3PO2I 1VLAA 2NVTI 5FLXb 3GTQI 2JR6A 4NBCA 2QREB 1YUKA 1VQ7Z 2JNYA 1ZH1A 3G4SZ 3CCLZ 2WAQA 3S2HI 4RVFA 3NH8A 2QEXZ 1P9NA 2LEXA 4BXXI 1KD12 4A93I 3PO3I 5IT9f 3TDHB 3MZKB 3F3PC 4DGLA 4MXUA 3CD61 1QVGY 5IP7I 1VQ91 5T6BA 2LIYA 1Q812 1N2FA 3M3YI 4E31A 2VPXA 3GTOI 4DK1A 1SIWA 2QLVB 2P3YA 3I561 1YJ91 2W03A 1Y1WI 3G6EZ 1RO2A 1WW9A 4HH4A 4A3MI 3IR7A 1YHQ1 5C3EI 1Y1VI 3VMIA 2BJOA 3CC41 3CCEZ 3CCVZ 2O4HA 2M48A 2V45A 3NFZA 4E30A 2P28A 2VUMI 3S1RI 3BG0B 3HKZA 1RLYA 3CPWY 3CMAZ 1VQ41 1N8R2 2F4OA 5CM2M 3T4NB 1KQSY 2NVYI 3QWUA 4BBSI 4A3FI 3IX0A 3JAMf 2QRCB 3CCRZ 2QR1B 3CCQZ 5T64A 1S721 1YJNZ 1TWCI 2NVQI 4BY1I 3FKII 3HOVI 4BBRI 2E2HI 4NOZA 3S1NI 2YADA 4E2YA 1Q822 2JIPA 3CC71 2OZKA 2RT9A 3D6WA 1X3WA 5IP9I 1K732 5IT9b 2JIQA 2V8IA 1LQLA 2VF1A 5AN9F 1M1K1 1JJ2Z 1WCMI 1KC82 3IFUA 3VTNA 1YI21 4MRIA 4BY7I 2JIMA 2NVXI 1K9M2 4A3II 4E32A 2NAPA 2IV2X 1VQM1 1KRLA 2KI7B 1Q862 2RHBA 1VQ9Z 5C44I 3S1MI 4NB8A 4MONA 4A3KI 1Z02A 2QKDA 2DE7A 1ZB8A 3I56Z 2GU2A 5LL6f 1VQP1 1YJ9Z 1NJI2 5D1OB 2PM9A 1K8A1 1TFIA 4E2WA 3EEDA 3H3VJ 1Q16A 4TNUA 1YHQZ 2R7ZI 4HGYA 2K3RA 1NP6A 3CC4Z 2JA7I 1USPB 2I3CA 2JIOA 4NH1C 4MH4A 3CME1 1R9TI 1TWGI 1VQ61 3EERA 5A2Qf 2F4MA 3NH4A 3KIHA 3G71Z 3JAMb 3F3FC 2JA5I 2LFUA 1M901 1JWHC 1VQ4Z 2JIRA 1RQFA 2ZAEB 2RIQA 1Z03A 2PK7A 2K5RA 1I6HI 3CCJZ 3CXCZ 3S1QI 4NFRA 3HOUI 1TWFI 4RS4A 3GTMS 3HOWI 2KPIA 1I3QI 4NB9A 1FDOA 1VQ81 2R93I 3BG1B 3GKQA 2Q4ZA 3S2DI 1RO0A 3CCS1 4A3BI 5D1PA 4A3LI 1Q7Y1 4Y52I 2OTJ1 4NBFA 3I551 3CC7Z 3LUSA 4A3JI 4RVDA 1PFTA 4MD8A 4E33A 4Y7NI 1SFOI 1JJ2Y 3J7A4 3PO3S 3J80f 1VQN1 3S16I 2JUBA
chains in the Genus database with same CATH topology
2AYDA 1WJ2A 2LEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYD A;  1WJ2 A;  2LEX A; 
#chains in the Genus database with same CATH topology
 1YI2 Z;  1VQ5 1;  4A3G I;  2E7Z A;  3CCE 1;  4MD9 A;  3CCV 1;  3CCU Z;  3FQM A;  1QF8 A;  1L1O C;  1FDI A;  1VQM Z;  2DE6 A;  3GTP I;  4NBD A;  2J6A A;  3P5J B;  2JMO A;  3H0G I;  3D2L A;  5T67 A;  1KD1 1;  1S7M A;  1M90 2;  3KIF A;  2DE5 A;  3I4M I;  2HU9 A;  3S15 I;  5C4J I;  3TE5 B;  1VQK 1;  1Q81 1;  4NBG A;  2VPW A;  1YIT 1;  2JS4 A;  1VQP Z;  1I50 I;  1QXF A;  1Y1V S;  2OOY B;  5C4X I;  2IZ3 A;  2RPR A;  2R92 I;  1X0T A;  3VMH A;  3HOY I;  5A2Q b;  3CD6 Z;  1YJW 1;  3CCR 1;  2GTH A;  2VPZ A;  4E2Z A;  3CCM 1;  2O53 A;  3D9X A;  2AKL A;  2PMZ A;  3J81 f;  1VQL 1;  2E2I I;  1K83 I;  3IF8 A;  3CME Z;  3K7A I;  4DQY B;  1VQ6 Z;  2E2J I;  1USP A;  3VB9 A;  4MD7 A;  2YU9 I;  3MON A;  3NH5 A;  2QA4 1;  4A3D I;  2Y0S A;  5FLM I;  4RVH A;  1YIJ 1;  3NDJ A;  3OW2 Y;  1VQO 1;  1N8R 1;  2OTL 1;  3CC2 1;  3CXC Y;  1TWA I;  2HF1 A;  4NBB A;  3NDI A;  4HGZ A;  1M1K 2;  1VQ8 Z;  3I4N I;  1NUI A;  1QYP A;  3CCS Z;  2WB1 A;  3Q87 A;  1VQ7 1;  3J80 b;  3G4S 1;  3CCL 1;  4QTU A;  3OW2 Z;  2VUG A;  3GCF A;  3GTJ I;  2JA8 I;  2OTJ Z;  4RVG A;  3I55 Z;  3GTL I;  2QEX 1;  1WZN A;  2Q51 A;  3CQZ I;  5FLX f;  1Q82 1;  4X6A I;  3GTK I;  2V8K A;  2B63 I;  1Y8C A;  2GTI A;  1QVG Z;  1S72 Z;  1K73 1;  1VQN Z;  2EGT A;  1KC8 1;  1VQ5 Z;  4RV9 A;  4NBA A;  1K8A 2;  3HOX I;  1WII A;  4S1T A;  1K9M 1;  2G2K A;  3G6E 1;  3FQQ A;  1X3Z A;  4EWC A;  2VPY A;  3G71 1;  4NBE A;  4NBH A;  1W2B Y;  4E2X A;  1Q86 1;  1VQK Z;  1RNI A;  1DL6 A;  3HOZ I;  1YIT Z;  2V8J A;  3J81 b;  1AA6 A;  3GTG I;  3CCJ 1;  1NJI 1;  2OOX B;  3S17 I;  1YJW Z;  3CPW Z;  1YUA A;  3CCM Z;  4CL1 A;  1W2B Z;  2M6N A;  3ESW A;  3CMA 1;  3RZO I;  3S14 I;  1QVF Y;  4A3C I;  4QTT A;  1VQL Z;  3M4O I;  3U50 C;  1ML8 A;  2JA6 I;  1KQS Z;  2QRD B;  2V3V A;  3RZD I;  2AYD A;  4A3E I;  3VMG A;  2R6M A;  1ZB9 A;  2IZ4 A;  2RBL A;  1TWH I;  5D1O A;  3CCQ 1;  1YJN 1;  1WJ2 A;  2E9H A;  2W04 A;  2QA4 Z;  1Q7Y 2;  1QVF Z;  1Z01 A;  1RO4 A;  3MZL B;  4AYB A;  1YIJ Z;  3GTM I;  4XX2 A;  1VQO Z;  2OTL Z;  2H85 A;  3CCU 1;  3CC2 Z;  3I07 A;  3PO2 I;  1VLA A;  2NVT I;  5FLX b;  3GTQ I;  2JR6 A;  4NBC A;  2QRE B;  1YUK A;  1VQ7 Z;  2JNY A;  1ZH1 A;  3G4S Z;  3CCL Z;  2WAQ A;  3S2H I;  4RVF A;  3NH8 A;  2QEX Z;  1P9N A;  2LEX A;  4BXX I;  1KD1 2;  4A93 I;  3PO3 I;  5IT9 f;  3TDH B;  3MZK B;  3F3P C;  4DGL A;  4MXU A;  3CD6 1;  1QVG Y;  5IP7 I;  1VQ9 1;  5T6B A;  2LIY A;  1Q81 2;  1N2F A;  3M3Y I;  4E31 A;  2VPX A;  3GTO I;  4DK1 A;  1SIW A;  2QLV B;  2P3Y A;  3I56 1;  1YJ9 1;  2W03 A;  1Y1W I;  3G6E Z;  1RO2 A;  1WW9 A;  4HH4 A;  4A3M I;  3IR7 A;  1YHQ 1;  5C3E I;  1Y1V I;  3VMI A;  2BJO A;  3CC4 1;  3CCE Z;  3CCV Z;  2O4H A;  2M48 A;  2V45 A;  3NFZ A;  4E30 A;  2P28 A;  2VUM I;  3S1R I;  3BG0 B;  3HKZ A;  1RLY A;  3CPW Y;  3CMA Z;  1VQ4 1;  1N8R 2;  2F4O A;  5CM2 M;  3T4N B;  1KQS Y;  2NVY I;  3QWU A;  4BBS I;  4A3F I;  3IX0 A;  3JAM f;  2QRC B;  3CCR Z;  2QR1 B;  3CCQ Z;  5T64 A;  1S72 1;  1YJN Z;  1TWC I;  2NVQ I;  4BY1 I;  3FKI I;  3HOV I;  4BBR I;  2E2H I;  4NOZ A;  3S1N I;  2YAD A;  4E2Y A;  1Q82 2;  2JIP A;  3CC7 1;  2OZK A;  2RT9 A;  3D6W A;  1X3W A;  5IP9 I;  1K73 2;  5IT9 b;  2JIQ A;  2V8I A;  1LQL A;  2VF1 A;  5AN9 F;  1M1K 1;  1JJ2 Z;  1WCM I;  1KC8 2;  3IFU A;  3VTN A;  1YI2 1;  4MRI A;  4BY7 I;  2JIM A;  2NVX I;  1K9M 2;  4A3I I;  4E32 A;  2NAP A;  2IV2 X;  1VQM 1;  1KRL A;  2KI7 B;  1Q86 2;  2RHB A;  1VQ9 Z;  5C44 I;  3S1M I;  4NB8 A;  4MON A;  4A3K I;  1Z02 A;  2QKD A;  2DE7 A;  1ZB8 A;  3I56 Z;  2GU2 A;  5LL6 f;  1VQP 1;  1YJ9 Z;  1NJI 2;  5D1O B;  2PM9 A;  1K8A 1;  1TFI A;  4E2W A;  3EED A;  3H3V J;  1Q16 A;  4TNU A;  1YHQ Z;  2R7Z I;  4HGY A;  2K3R A;  1NP6 A;  3CC4 Z;  2JA7 I;  1USP B;  2I3C A;  2JIO A;  4NH1 C;  4MH4 A;  3CME 1;  1R9T I;  1TWG I;  1VQ6 1;  3EER A;  5A2Q f;  2F4M A;  3NH4 A;  3KIH A;  3G71 Z;  3JAM b;  3F3F C;  2JA5 I;  2LFU A;  1M90 1;  1JWH C;  1VQ4 Z;  2JIR A;  1RQF A;  2ZAE B;  2RIQ A;  1Z03 A;  2PK7 A;  2K5R A;  1I6H I;  3CCJ Z;  3CXC Z;  3S1Q I;  4NFR A;  3HOU I;  1TWF I;  4RS4 A;  3GTM S;  3HOW I;  2KPI A;  1I3Q I;  4NB9 A;  1FDO A;  1VQ8 1;  2R93 I;  3BG1 B;  3GKQ A;  2Q4Z A;  3S2D I;  1RO0 A;  3CCS 1;  4A3B I;  5D1P A;  4A3L I;  1Q7Y 1;  4Y52 I;  2OTJ 1;  4NBF A;  3I55 1;  3CC7 Z;  3LUS A;  4A3J I;  4RVD A;  1PFT A;  4MD8 A;  4E33 A;  4Y7N I;  1SFO I;  1JJ2 Y;  3J7A 4;  3PO3 S;  3J80 f;  1VQN 1;  3S16 I;  2JUB A; 
#chains in the Genus database with same CATH homology
 2AYD A;  1WJ2 A;  2LEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...