2AYDA

Crystal structure of the c-terminal wrky domainof atwrky1, an sa-induced and partially npr1-dependent transcription factor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
b'SRIVVHTQTLFDIVNDGYRWRKYGQKSVKGSPYPRSYYRCSSPGCPVKKHVERSSHDTKLLITTYEGKHDHDMPPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords WRKY transcription factor 1
publication title DNA binding mechanism revealed by high resolution crystal structure of Arabidopsis thaliana WRKY1 protein.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 2aydA01
1WJ2A 2AYDA 2LEXA
chains in the Genus database with same CATH superfamily
2I3CA 2O4HA 2BJOA 2RT9A 1YI21 1LQLA 4E32A 1Z01A 2WB1A 3CCJZ 3I07A 3GTJI 3NH5A 2JS4A 3CC7Z 1VQ6Z 4MD7A 2Q51A 1Q822 3S2DI 2OTJ1 2B63I 1QVFY 5FLXb 3VTNA 3S17I 3CCUZ 1Q861 1VQ8Z 3VMIA 4NB9A 2VUGA 3CCQ1 1I50I 3NDJA 5C4XI 3I561 2P3YA 2R6MA 4BY1I 1TWFI 2VPZA 1VQ7Z 3F3PC 3EEDA 4NBCA 1VQN1 2LFUA 1X3ZA 1K8A1 3GTLI 2NVTI 2E2II 2R7ZI 1Y8CA 1I6HI 3HOVI 3GKQA 1N8R1 1KQSY 1Q7Y2 3IR7A 4E33A 3GTPI 1ZH1A 5LL6f 5IP9I 1L1OC 3K7AI 3CCRZ 2ZAEB 1ZB9A 5A2Qb 1KC82 1RLYA 2IV2X 1SIWA 3U50C 1AA6A 3MONA 4NH1C 5FLMI 3G711 3CC4Z 3PO3I 2OOXB 4MRIA 3NH4A 4RVGA 2JA8I 3PO3S 4BY7I 2RHBA 5C4JI 2NVYI 1DL6A 1VQ41 4DGLA 2JR6A 3CMAZ 1YJWZ 3CCM1 3J81b 4E2YA 3TE5B 1WCMI 3CCLZ 4A3JI 1I3QI 1KRLA 2JIOA 2OTLZ 1YIJZ 1RO2A 2QEXZ 1M902 3S15I 1JWHC 4NBHA 1K83I 2JA5I 1K9M1 3NH8A 3JAMf 3I55Z 4BBSI 1YHQ1 5D1PA 3J80f 1Z02A 5CM2M 1M1K2 1VQ5Z 4A3KI 3CCSZ 1QVFZ 1KD11 5D1OB 1S7MA 1Q812 1USPA 1QXFA 3GTGI 1QF8A 1VQLZ 4A93I 2NVXI 4E30A 2IZ3A 4DK1A 3OW2Y 3HOUI 1YJN1 3P5JB 1VQOZ 4A3FI 1JJ2Y 1WIIA 3ESWA 1W2BY 3CC2Z 3J7A4 3GTKI 3FQMA 4NBGA 4MD9A 2VPYA 1YJ9Z 2R93I 5AN9F 3CPWY 2F4OA 3CC71 3M3YI 2VF1A 3KIFA 2H85A 4NBEA 1PFTA 3S16I 4MONA 3CCEZ 5C44I 5FLXf 1QVGY 1KQSZ 2AYDA 3TDHB 1VQ81 3G6EZ 3CME1 2J6AA 1Y1VI 1Y1VS 5IP7I 1NP6A 3CXCY 4A3EI 1NJI2 3CQZI 3RZDI 4A3GI 2JA6I 4Y7NI 1YITZ 1YUAA 3G4SZ 2Q4ZA 2M6NA 3T4NB 4E2ZA 3FKII 1TWCI 2PK7A 4RS4A 5T6BA 4NFRA 3CCQZ 4A3BI 4NB8A 3S2HI 2DE6A 1VQM1 1TWGI 4RVHA 2VPWA 2JNYA 1FDIA 4A3LI 4MD8A 1NUIA 3Q87A 1WJ2A 2QLVB 5A2Qf 3CCR1 2OOYB 1R9TI 1QYPA 2RBLA 5C3EI 1Q862 2E2HI 1K731 3CC41 2EGTA 3FQQA 2WAQA 1VQPZ 2E7ZA 4A3DI 2GU2A 4MXUA 3BG1B 2LEXA 2RPRA 2HU9A 3IFUA 1K8A2 2QKDA 3CD6Z 2KI7B 4E2WA 3J81f 1RO0A 1VQK1 3G71Z 2G2KA 1X0TA 2OTL1 2P28A 4S1TA 1WZNA 1S721 3HKZA 1N8R2 1W2BZ 3CCVZ 3S1NI 3BG0B 4MH4A 4XX2A 4BXXI 2KPIA 1ZB8A 3I551 3CPWZ 2QA4Z 2JMOA 2V8IA 3D9XA 1VQ91 4NBBA 2PMZA 4NOZA 1QVGZ 1Q821 3HOXI 1VQL1 2V45A 1X3WA 3GTMI 2QR1B 3GTMS 3EERA 3I4NI 2YADA 3I4MI 1VQO1 4X6AI 1ML8A 3CC21 1N2FA 2R92I 1TFIA 3HOZI 2V3VA 3D2LA 1YJ91 2JUBA 2YU9I 3CCJ1 2NVQI 1VLAA 1VQ61 4HH4A 4HGZA 1Q16A 3PO2I 1TWAI 3CCU1 2M48A 2F4MA 1K9M2 4NBAA 2O53A 1YI2Z 3LUSA 3S1MI 1Q7Y1 1WW9A 2K5RA 4RV9A 2LIYA 1TWHI 2Y0SA 1KD12 1VQ71 4A3MI 2OTJZ 1KC81 2DE7A 1FDOA 1RO4A 2W04A 1YIT1 2VUMI 1RNIA 3G4S1 3GTOI 2IZ4A 3F3FC 3S14I 3CMEZ 2JIMA 4HGYA 1USPB 1YUKA 2E9HA 3KIHA 3HOYI 2NAPA 3I56Z 5IT9f 5IT9b 2RIQA 2QREB 3MZLB 1VQNZ 2QRDB 5T67A 4DQYB 4NBDA 3S1QI 2VPXA 4AYBA 1VQMZ 4TNUA 2JIQA 1RQFA 2OZKA 1M901 3IX0A 3VMGA 2JA7I 3MZKB 2AKLA 1VQP1 5D1OA 2V8JA 3CMA1 3NDIA 2W03A 1P9NA 1M1K1 1YJW1 4NBFA 3QWUA 3CD61 5T64A 1Q811 3VB9A 3CCL1 3OW2Z 3H3VJ 3IF8A 4CL1A 4A3II 3M4OI 2GTIA 1JJ2Z 1YIJ1 2QEX1 1VQ4Z 3GTQI 4Y52I 2K3RA 3CCV1 2GTHA 4QTUA 2QRCB 3CCMZ 2QA41 1VQKZ 3VMHA 4E31A 3H0GI 1VQ51 2HF1A 3CCS1 2JIRA 4RVDA 4E2XA 1K732 2JIPA 4EWCA 1S72Z 2DE5A 2E2JI 4A3CI 4BBRI 3RZOI 3D6WA 3JAMb 3NFZA 1SFOI 1YHQZ 3CXCZ 1Y1WI 3J80b 1Z03A 1VQ9Z 3HOWI 1NJI1 3S1RI 2V8KA 4QTTA 1YJNZ 3GCFA 3CCE1 4RVFA 3G6E1 2PM9A
chains in the Genus database with same CATH topology
1WJ2A 2AYDA 2LEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ2 A;  2AYD A;  2LEX A; 
#chains in the Genus database with same CATH topology
 2I3C A;  2O4H A;  2BJO A;  2RT9 A;  1YI2 1;  1LQL A;  4E32 A;  1Z01 A;  2WB1 A;  3CCJ Z;  3I07 A;  3GTJ I;  3NH5 A;  2JS4 A;  3CC7 Z;  1VQ6 Z;  4MD7 A;  2Q51 A;  1Q82 2;  3S2D I;  2OTJ 1;  2B63 I;  1QVF Y;  5FLX b;  3VTN A;  3S17 I;  3CCU Z;  1Q86 1;  1VQ8 Z;  3VMI A;  4NB9 A;  2VUG A;  3CCQ 1;  1I50 I;  3NDJ A;  5C4X I;  3I56 1;  2P3Y A;  2R6M A;  4BY1 I;  1TWF I;  2VPZ A;  1VQ7 Z;  3F3P C;  3EED A;  4NBC A;  1VQN 1;  2LFU A;  1X3Z A;  1K8A 1;  3GTL I;  2NVT I;  2E2I I;  2R7Z I;  1Y8C A;  1I6H I;  3HOV I;  3GKQ A;  1N8R 1;  1KQS Y;  1Q7Y 2;  3IR7 A;  4E33 A;  3GTP I;  1ZH1 A;  5LL6 f;  5IP9 I;  1L1O C;  3K7A I;  3CCR Z;  2ZAE B;  1ZB9 A;  5A2Q b;  1KC8 2;  1RLY A;  2IV2 X;  1SIW A;  3U50 C;  1AA6 A;  3MON A;  4NH1 C;  5FLM I;  3G71 1;  3CC4 Z;  3PO3 I;  2OOX B;  4MRI A;  3NH4 A;  4RVG A;  2JA8 I;  3PO3 S;  4BY7 I;  2RHB A;  5C4J I;  2NVY I;  1DL6 A;  1VQ4 1;  4DGL A;  2JR6 A;  3CMA Z;  1YJW Z;  3CCM 1;  3J81 b;  4E2Y A;  3TE5 B;  1WCM I;  3CCL Z;  4A3J I;  1I3Q I;  1KRL A;  2JIO A;  2OTL Z;  1YIJ Z;  1RO2 A;  2QEX Z;  1M90 2;  3S15 I;  1JWH C;  4NBH A;  1K83 I;  2JA5 I;  1K9M 1;  3NH8 A;  3JAM f;  3I55 Z;  4BBS I;  1YHQ 1;  5D1P A;  3J80 f;  1Z02 A;  5CM2 M;  1M1K 2;  1VQ5 Z;  4A3K I;  3CCS Z;  1QVF Z;  1KD1 1;  5D1O B;  1S7M A;  1Q81 2;  1USP A;  1QXF A;  3GTG I;  1QF8 A;  1VQL Z;  4A93 I;  2NVX I;  4E30 A;  2IZ3 A;  4DK1 A;  3OW2 Y;  3HOU I;  1YJN 1;  3P5J B;  1VQO Z;  4A3F I;  1JJ2 Y;  1WII A;  3ESW A;  1W2B Y;  3CC2 Z;  3J7A 4;  3GTK I;  3FQM A;  4NBG A;  4MD9 A;  2VPY A;  1YJ9 Z;  2R93 I;  5AN9 F;  3CPW Y;  2F4O A;  3CC7 1;  3M3Y I;  2VF1 A;  3KIF A;  2H85 A;  4NBE A;  1PFT A;  3S16 I;  4MON A;  3CCE Z;  5C44 I;  5FLX f;  1QVG Y;  1KQS Z;  2AYD A;  3TDH B;  1VQ8 1;  3G6E Z;  3CME 1;  2J6A A;  1Y1V I;  1Y1V S;  5IP7 I;  1NP6 A;  3CXC Y;  4A3E I;  1NJI 2;  3CQZ I;  3RZD I;  4A3G I;  2JA6 I;  4Y7N I;  1YIT Z;  1YUA A;  3G4S Z;  2Q4Z A;  2M6N A;  3T4N B;  4E2Z A;  3FKI I;  1TWC I;  2PK7 A;  4RS4 A;  5T6B A;  4NFR A;  3CCQ Z;  4A3B I;  4NB8 A;  3S2H I;  2DE6 A;  1VQM 1;  1TWG I;  4RVH A;  2VPW A;  2JNY A;  1FDI A;  4A3L I;  4MD8 A;  1NUI A;  3Q87 A;  1WJ2 A;  2QLV B;  5A2Q f;  3CCR 1;  2OOY B;  1R9T I;  1QYP A;  2RBL A;  5C3E I;  1Q86 2;  2E2H I;  1K73 1;  3CC4 1;  2EGT A;  3FQQ A;  2WAQ A;  1VQP Z;  2E7Z A;  4A3D I;  2GU2 A;  4MXU A;  3BG1 B;  2LEX A;  2RPR A;  2HU9 A;  3IFU A;  1K8A 2;  2QKD A;  3CD6 Z;  2KI7 B;  4E2W A;  3J81 f;  1RO0 A;  1VQK 1;  3G71 Z;  2G2K A;  1X0T A;  2OTL 1;  2P28 A;  4S1T A;  1WZN A;  1S72 1;  3HKZ A;  1N8R 2;  1W2B Z;  3CCV Z;  3S1N I;  3BG0 B;  4MH4 A;  4XX2 A;  4BXX I;  2KPI A;  1ZB8 A;  3I55 1;  3CPW Z;  2QA4 Z;  2JMO A;  2V8I A;  3D9X A;  1VQ9 1;  4NBB A;  2PMZ A;  4NOZ A;  1QVG Z;  1Q82 1;  3HOX I;  1VQL 1;  2V45 A;  1X3W A;  3GTM I;  2QR1 B;  3GTM S;  3EER A;  3I4N I;  2YAD A;  3I4M I;  1VQO 1;  4X6A I;  1ML8 A;  3CC2 1;  1N2F A;  2R92 I;  1TFI A;  3HOZ I;  2V3V A;  3D2L A;  1YJ9 1;  2JUB A;  2YU9 I;  3CCJ 1;  2NVQ I;  1VLA A;  1VQ6 1;  4HH4 A;  4HGZ A;  1Q16 A;  3PO2 I;  1TWA I;  3CCU 1;  2M48 A;  2F4M A;  1K9M 2;  4NBA A;  2O53 A;  1YI2 Z;  3LUS A;  3S1M I;  1Q7Y 1;  1WW9 A;  2K5R A;  4RV9 A;  2LIY A;  1TWH I;  2Y0S A;  1KD1 2;  1VQ7 1;  4A3M I;  2OTJ Z;  1KC8 1;  2DE7 A;  1FDO A;  1RO4 A;  2W04 A;  1YIT 1;  2VUM I;  1RNI A;  3G4S 1;  3GTO I;  2IZ4 A;  3F3F C;  3S14 I;  3CME Z;  2JIM A;  4HGY A;  1USP B;  1YUK A;  2E9H A;  3KIH A;  3HOY I;  2NAP A;  3I56 Z;  5IT9 f;  5IT9 b;  2RIQ A;  2QRE B;  3MZL B;  1VQN Z;  2QRD B;  5T67 A;  4DQY B;  4NBD A;  3S1Q I;  2VPX A;  4AYB A;  1VQM Z;  4TNU A;  2JIQ A;  1RQF A;  2OZK A;  1M90 1;  3IX0 A;  3VMG A;  2JA7 I;  3MZK B;  2AKL A;  1VQP 1;  5D1O A;  2V8J A;  3CMA 1;  3NDI A;  2W03 A;  1P9N A;  1M1K 1;  1YJW 1;  4NBF A;  3QWU A;  3CD6 1;  5T64 A;  1Q81 1;  3VB9 A;  3CCL 1;  3OW2 Z;  3H3V J;  3IF8 A;  4CL1 A;  4A3I I;  3M4O I;  2GTI A;  1JJ2 Z;  1YIJ 1;  2QEX 1;  1VQ4 Z;  3GTQ I;  4Y52 I;  2K3R A;  3CCV 1;  2GTH A;  4QTU A;  2QRC B;  3CCM Z;  2QA4 1;  1VQK Z;  3VMH A;  4E31 A;  3H0G I;  1VQ5 1;  2HF1 A;  3CCS 1;  2JIR A;  4RVD A;  4E2X A;  1K73 2;  2JIP A;  4EWC A;  1S72 Z;  2DE5 A;  2E2J I;  4A3C I;  4BBR I;  3RZO I;  3D6W A;  3JAM b;  3NFZ A;  1SFO I;  1YHQ Z;  3CXC Z;  1Y1W I;  3J80 b;  1Z03 A;  1VQ9 Z;  3HOW I;  1NJI 1;  3S1R I;  2V8K A;  4QTT A;  1YJN Z;  3GCF A;  3CCE 1;  4RVF A;  3G6E 1;  2PM9 A; 
#chains in the Genus database with same CATH homology
 1WJ2 A;  2AYD A;  2LEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...