2AYDA

Crystal structure of the c-terminal wrky domainof atwrky1, an sa-induced and partially npr1-dependent transcription factor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
SRIVVHTQTLFDIVNDGYRWRKYGQKSVKGSPYPRSYYRCSSPGCPVKKHVERSSHDTKLLITTYEGKHDHDMPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA binding mechanism revealed by high resolution crystal structure of Arabidopsis thaliana WRKY1 protein.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
molecule keywords WRKY transcription factor 1
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 2aydA01
2LEXA 2AYDA 1WJ2A
chains in the Genus database with same CATH superfamily
1VQ41 4Y52I 3KIHA 3PO3I 1Q822 3RZOI 3HOWI 3IR7A 1M1K2 1Q16A 1I50I 2LFUA 2P3YA 3I4MI 4BY7I 5T6BA 1ZH1A 3U50C 5AN9F 3H0GI 3FQQA 4NBGA 1N8R2 4CL1A 3J7A4 3GTKI 1YJ91 3GCFA 1VQLZ 2QA41 3LUSA 1YJWZ 1VQP1 3GTPI 5LL6f 4RS4A 4Y7NI 3TDHB 2DE5A 2RT9A 1M1K1 2M48A 1VQ71 3OW2Y 1Q821 3M3YI 1TWAI 4HH4A 3CMAZ 3D6WA 2O4HA 2Q4ZA 2M6NA 2EGTA 3G711 1VQMZ 3NH4A 3CC7Z 4A3GI 3FQMA 4E30A 1VQN1 3G6EZ 1VQ5Z 1VQOZ 1VQ6Z 3JAMf 4MD7A 4RVGA 3CCVZ 1YIT1 4A3KI 1RNIA 4S1TA 1K732 3MZKB 1VQ91 3G4SZ 3S2HI 2WB1A 2NVQI 2OTLZ 1KQSZ 1KRLA 1Y1WI 1WW9A 4DK1A 3D9XA 1QVFZ 1N8R1 1VQL1 4E32A 1M901 3S1MI 3CCR1 2JUBA 2OOYB 2VPWA 2R93I 2RBLA 1RQFA 1Q862 1VQ7Z 2I3CA 3CCM1 3CMA1 2RIQA 2W04A 5IT9f 1YI2Z 3VMIA 4DGLA 2IZ4A 3G71Z 2GTIA 1DL6A 3CC71 2ZAEB 5C3EI 4XX2A 1VQO1 1P9NA 1VQ61 2YU9I 2Y0SA 3CCV1 2JR6A 3I07A 4MD9A 1TWHI 1K83I 3OW2Z 2E2JI 1USPB 2IZ3A 1SIWA 3I551 1Y8CA 3EEDA 2O53A 3F3FC 1YIJ1 2B63I 4NBHA 3CMEZ 1JWHC 1SFOI 1VQK1 1NP6A 3VMGA 3HOVI 3Q87A 2QEX1 2YADA 1M902 3JAMb 2QRCB 2QA4Z 3CCMZ 1YHQ1 3I4NI 1QVGY 1JJ2Y 3CC4Z 4NFRA 2K3RA 4MXUA 1KQSY 3BG1B 3RZDI 2KI7B 2WAQA 1USPA 3CD61 2VF1A 2JIOA 3J81b 3P5JB 2JMOA 3CCSZ 4E2ZA 2E2II 5D1PA 2E2HI 2OOXB 1VQM1 5IT9b 2R6MA 1W2BZ 4AYBA 1VQNZ 4A3DI 1X0TA 1L1OC 3NH8A 2AYDA 3CCQ1 2F4MA 5C4XI 4MH4A 2VPYA 3CCJZ 1K8A1 1TFIA 1ZB8A 3MZLB 3G4S1 3ESWA 4HGZA 3CME1 2JA7I 3CCU1 1VQKZ 5D1OA 2QEXZ 4NB8A 2JIPA 4A3II 2LIYA 2V8KA 1YUAA 2RPRA 3QWUA 1ML8A 3NFZA 3CCRZ 3CC41 2HF1A 1Q7Y1 2BJOA 4E2XA 5FLMI 2E9HA 2F4OA 3CD6Z 4MRIA 3HOYI 1TWFI 2W03A 1FDOA 2QREB 2LEXA 4MD8A 3J81f 1WJ2A 4RVFA 3S16I 1Q861 3CCL1 3CCQZ 2VUGA 2QKDA 1Y1VI 1QVGZ 2QRDB 1JJ2Z 3J80b 2V8IA 2QLVB 2JIRA 2VPXA 3MONA 4NBCA 2IV2X 3CCE1 3S1QI 1X3ZA 2JIMA 3CCUZ 1TWCI 1I3QI 2HU9A 4NB9A 1YJNZ 3I55Z 2K5RA 1Z01A 2JNYA 1YIJZ 4BBSI 1W2BY 1Y1VS 5IP7I 2Q51A 3GTMI 1AA6A 1I6HI 5C44I 1YHQZ 1VQ8Z 5CM2M 2JIQA 2NAPA 2J6AA 3HOXI 3GTQI 3PO2I 4RVHA 1FDIA 3F3PC 3VMHA 3NDIA 3T4NB 3CCS1 3VB9A 2OZKA 4A3FI 2H85A 3EERA 4NH1C 5FLXb 4QTTA 3S15I 3GTJI 4A3EI 2JA6I 1NJI2 1K9M1 1QF8A 2JA5I 3NH5A 3S1NI 3J80f 1YJN1 3CCJ1 1K8A2 4E31A 1RO0A 4A3MI 4NBDA 5A2Qb 3CC21 2G2KA 3CXCY 5T64A 2NVYI 3HKZA 3IF8A 5FLXf 3I561 4X6AI 4A93I 1TWGI 1VQ81 5C4JI 2JS4A 2E7ZA 4BBRI 2OTJZ 1Q811 4BY1I 2KPIA 1KC81 2GU2A 1N2FA 1Z02A 3CPWZ 4EWCA 4A3JI 1Q7Y2 2PMZA 5T67A 2VPZA 1S72Z 1RLYA 1K731 1KD11 4QTUA 2PK7A 2DE7A 2VUMI 3IX0A 3CCLZ 4BXXI 3CC2Z 3PO3S 2DE6A 4DQYB 4TNUA 4NBBA 3GTGI 3CCEZ 1RO4A 4MONA 4RV9A 2QR1B 2R7ZI 3BG0B 3I56Z 2P28A 1NJI1 5IP9I 2NVTI 3FKII 1YUKA 3S2DI 2RHBA 3NDJA 4E2YA 4RVDA 1KC82 2OTJ1 2NVXI 3G6E1 4E33A 4NBAA 1VQ51 3GKQA 1S7MA 4E2WA 3TE5B 3GTOI 1YITZ 4A3LI 1X3WA 3HOZI 2GTHA 1VQ9Z 3CXCZ 1VQ4Z 1S721 3CQZI 1VLAA 2OTL1 2V3VA 4NBFA 1QXFA 4HGYA 1R9TI 5D1OB 4NBEA 1RO2A 2V8JA 3GTMS 3D2LA 3K7AI 3KIFA 2PM9A 5A2Qf 2AKLA 1K9M2 1WCMI 3CPWY 3H3VJ 3S1RI 1YJ9Z 1PFTA 1YJW1 3S17I 1VQPZ 2JA8I 4NOZA 1KD12 1YI21 1LQLA 1QYPA 1ZB9A 1WZNA 3VTNA 4A3CI 3GTLI 3IFUA 1Z03A 3HOUI 2R92I 1WIIA 1NUIA 2V45A 3M4OI 1QVFY 1Q812 3S14I 4A3BI
chains in the Genus database with same CATH topology
2LEXA 2AYDA 1WJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEX A;  2AYD A;  1WJ2 A; 
#chains in the Genus database with same CATH topology
 1VQ4 1;  4Y52 I;  3KIH A;  3PO3 I;  1Q82 2;  3RZO I;  3HOW I;  3IR7 A;  1M1K 2;  1Q16 A;  1I50 I;  2LFU A;  2P3Y A;  3I4M I;  4BY7 I;  5T6B A;  1ZH1 A;  3U50 C;  5AN9 F;  3H0G I;  3FQQ A;  4NBG A;  1N8R 2;  4CL1 A;  3J7A 4;  3GTK I;  1YJ9 1;  3GCF A;  1VQL Z;  2QA4 1;  3LUS A;  1YJW Z;  1VQP 1;  3GTP I;  5LL6 f;  4RS4 A;  4Y7N I;  3TDH B;  2DE5 A;  2RT9 A;  1M1K 1;  2M48 A;  1VQ7 1;  3OW2 Y;  1Q82 1;  3M3Y I;  1TWA I;  4HH4 A;  3CMA Z;  3D6W A;  2O4H A;  2Q4Z A;  2M6N A;  2EGT A;  3G71 1;  1VQM Z;  3NH4 A;  3CC7 Z;  4A3G I;  3FQM A;  4E30 A;  1VQN 1;  3G6E Z;  1VQ5 Z;  1VQO Z;  1VQ6 Z;  3JAM f;  4MD7 A;  4RVG A;  3CCV Z;  1YIT 1;  4A3K I;  1RNI A;  4S1T A;  1K73 2;  3MZK B;  1VQ9 1;  3G4S Z;  3S2H I;  2WB1 A;  2NVQ I;  2OTL Z;  1KQS Z;  1KRL A;  1Y1W I;  1WW9 A;  4DK1 A;  3D9X A;  1QVF Z;  1N8R 1;  1VQL 1;  4E32 A;  1M90 1;  3S1M I;  3CCR 1;  2JUB A;  2OOY B;  2VPW A;  2R93 I;  2RBL A;  1RQF A;  1Q86 2;  1VQ7 Z;  2I3C A;  3CCM 1;  3CMA 1;  2RIQ A;  2W04 A;  5IT9 f;  1YI2 Z;  3VMI A;  4DGL A;  2IZ4 A;  3G71 Z;  2GTI A;  1DL6 A;  3CC7 1;  2ZAE B;  5C3E I;  4XX2 A;  1VQO 1;  1P9N A;  1VQ6 1;  2YU9 I;  2Y0S A;  3CCV 1;  2JR6 A;  3I07 A;  4MD9 A;  1TWH I;  1K83 I;  3OW2 Z;  2E2J I;  1USP B;  2IZ3 A;  1SIW A;  3I55 1;  1Y8C A;  3EED A;  2O53 A;  3F3F C;  1YIJ 1;  2B63 I;  4NBH A;  3CME Z;  1JWH C;  1SFO I;  1VQK 1;  1NP6 A;  3VMG A;  3HOV I;  3Q87 A;  2QEX 1;  2YAD A;  1M90 2;  3JAM b;  2QRC B;  2QA4 Z;  3CCM Z;  1YHQ 1;  3I4N I;  1QVG Y;  1JJ2 Y;  3CC4 Z;  4NFR A;  2K3R A;  4MXU A;  1KQS Y;  3BG1 B;  3RZD I;  2KI7 B;  2WAQ A;  1USP A;  3CD6 1;  2VF1 A;  2JIO A;  3J81 b;  3P5J B;  2JMO A;  3CCS Z;  4E2Z A;  2E2I I;  5D1P A;  2E2H I;  2OOX B;  1VQM 1;  5IT9 b;  2R6M A;  1W2B Z;  4AYB A;  1VQN Z;  4A3D I;  1X0T A;  1L1O C;  3NH8 A;  2AYD A;  3CCQ 1;  2F4M A;  5C4X I;  4MH4 A;  2VPY A;  3CCJ Z;  1K8A 1;  1TFI A;  1ZB8 A;  3MZL B;  3G4S 1;  3ESW A;  4HGZ A;  3CME 1;  2JA7 I;  3CCU 1;  1VQK Z;  5D1O A;  2QEX Z;  4NB8 A;  2JIP A;  4A3I I;  2LIY A;  2V8K A;  1YUA A;  2RPR A;  3QWU A;  1ML8 A;  3NFZ A;  3CCR Z;  3CC4 1;  2HF1 A;  1Q7Y 1;  2BJO A;  4E2X A;  5FLM I;  2E9H A;  2F4O A;  3CD6 Z;  4MRI A;  3HOY I;  1TWF I;  2W03 A;  1FDO A;  2QRE B;  2LEX A;  4MD8 A;  3J81 f;  1WJ2 A;  4RVF A;  3S16 I;  1Q86 1;  3CCL 1;  3CCQ Z;  2VUG A;  2QKD A;  1Y1V I;  1QVG Z;  2QRD B;  1JJ2 Z;  3J80 b;  2V8I A;  2QLV B;  2JIR A;  2VPX A;  3MON A;  4NBC A;  2IV2 X;  3CCE 1;  3S1Q I;  1X3Z A;  2JIM A;  3CCU Z;  1TWC I;  1I3Q I;  2HU9 A;  4NB9 A;  1YJN Z;  3I55 Z;  2K5R A;  1Z01 A;  2JNY A;  1YIJ Z;  4BBS I;  1W2B Y;  1Y1V S;  5IP7 I;  2Q51 A;  3GTM I;  1AA6 A;  1I6H I;  5C44 I;  1YHQ Z;  1VQ8 Z;  5CM2 M;  2JIQ A;  2NAP A;  2J6A A;  3HOX I;  3GTQ I;  3PO2 I;  4RVH A;  1FDI A;  3F3P C;  3VMH A;  3NDI A;  3T4N B;  3CCS 1;  3VB9 A;  2OZK A;  4A3F I;  2H85 A;  3EER A;  4NH1 C;  5FLX b;  4QTT A;  3S15 I;  3GTJ I;  4A3E I;  2JA6 I;  1NJI 2;  1K9M 1;  1QF8 A;  2JA5 I;  3NH5 A;  3S1N I;  3J80 f;  1YJN 1;  3CCJ 1;  1K8A 2;  4E31 A;  1RO0 A;  4A3M I;  4NBD A;  5A2Q b;  3CC2 1;  2G2K A;  3CXC Y;  5T64 A;  2NVY I;  3HKZ A;  3IF8 A;  5FLX f;  3I56 1;  4X6A I;  4A93 I;  1TWG I;  1VQ8 1;  5C4J I;  2JS4 A;  2E7Z A;  4BBR I;  2OTJ Z;  1Q81 1;  4BY1 I;  2KPI A;  1KC8 1;  2GU2 A;  1N2F A;  1Z02 A;  3CPW Z;  4EWC A;  4A3J I;  1Q7Y 2;  2PMZ A;  5T67 A;  2VPZ A;  1S72 Z;  1RLY A;  1K73 1;  1KD1 1;  4QTU A;  2PK7 A;  2DE7 A;  2VUM I;  3IX0 A;  3CCL Z;  4BXX I;  3CC2 Z;  3PO3 S;  2DE6 A;  4DQY B;  4TNU A;  4NBB A;  3GTG I;  3CCE Z;  1RO4 A;  4MON A;  4RV9 A;  2QR1 B;  2R7Z I;  3BG0 B;  3I56 Z;  2P28 A;  1NJI 1;  5IP9 I;  2NVT I;  3FKI I;  1YUK A;  3S2D I;  2RHB A;  3NDJ A;  4E2Y A;  4RVD A;  1KC8 2;  2OTJ 1;  2NVX I;  3G6E 1;  4E33 A;  4NBA A;  1VQ5 1;  3GKQ A;  1S7M A;  4E2W A;  3TE5 B;  3GTO I;  1YIT Z;  4A3L I;  1X3W A;  3HOZ I;  2GTH A;  1VQ9 Z;  3CXC Z;  1VQ4 Z;  1S72 1;  3CQZ I;  1VLA A;  2OTL 1;  2V3V A;  4NBF A;  1QXF A;  4HGY A;  1R9T I;  5D1O B;  4NBE A;  1RO2 A;  2V8J A;  3GTM S;  3D2L A;  3K7A I;  3KIF A;  2PM9 A;  5A2Q f;  2AKL A;  1K9M 2;  1WCM I;  3CPW Y;  3H3V J;  3S1R I;  1YJ9 Z;  1PFT A;  1YJW 1;  3S17 I;  1VQP Z;  2JA8 I;  4NOZ A;  1KD1 2;  1YI2 1;  1LQL A;  1QYP A;  1ZB9 A;  1WZN A;  3VTN A;  4A3C I;  3GTL I;  3IFU A;  1Z03 A;  3HOU I;  2R92 I;  1WII A;  1NUI A;  2V45 A;  3M4O I;  1QVF Y;  1Q81 2;  3S14 I;  4A3B I; 
#chains in the Genus database with same CATH homology
 2LEX A;  2AYD A;  1WJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...