3CCJ1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccj100
1VQMZ 1VQ91 3CPWY 1K9M1 1Q811 3CME1 1VQLZ 1VQ41 1M1K1 2OTL1 1M902 1KQSZ 3G6EZ 1YJ9Z 1JJ2Z 1Q862 1VQM1 1YIJZ 1K731 1KC82 1VQL1 3I55Z 3CD6Z 3G4SZ 3G6E1 1VQ7Z 1YHQ1 3OW2Z 3CCS1 1Q821 1YIJ1 3CCQZ 1YJNZ 1VQKZ 1K8A1 3I551 3CCEZ 1S72Z 3CD61 3G4S1 1VQ71 1KQSY 3CCMZ 1JJ2Y 1QVGZ 1KD11 3CCQ1 1VQK1 3CCLZ 3CCE1 1S721 3CCVZ 1VQOZ 1YJW1 3CCM1 2QA4Z 3OW2Y 3CC7Z 1Q7Y2 3CMAZ 3CCL1 3G71Z 3CCV1 1QVFZ 1YJ91 3CC2Z 1YJWZ 1N8R1 1QVGY 3CC71 2OTJZ 3CMA1 1Q812 3CXCZ 3G711 1YI2Z 1M1K2 1W2BZ 1NJI2 3CCRZ 2QEXZ 1YITZ 1YJN1 3CPWZ 2OTJ1 1K732 1YI21 1QVFY 1M901 1Q861 3CCR1 1Q7Y1 2QEX1 1YIT1 1Q822 1KC81 1VQNZ 1VQO1 1K8A2 1VQ8Z 2QA41 2OTLZ 3CCJZ 3I56Z 1K9M2 1VQ5Z 1VQN1 1KD12 3CCUZ 1VQ81 1VQ6Z 3CC21 1NJI1 3CCJ1 1YHQZ 1VQPZ 3I561 3CCSZ 1VQ51 3CCU1 1VQ61 3CC4Z 1VQP1 1N8R2 1VQ9Z 3CMEZ 3CXCY 1VQ4Z 1W2BY 3CC41
chains in the Genus database with same CATH superfamily
2VUGA 3VMIA 2K5RA 3F3PC 1YJ9Z 3VTNA 1JJ2Z 1VQM1 5IT9f 4NBEA 2R92I 1Z02A 5D1PA 1KC82 3S17I 1RLYA 3BG1B 3IX0A 3CCQZ 3M3YI 3HKZA 2RT9A 3PO3I 2O53A 5D1OA 2E7ZA 1VQ71 3Q87A 3CCMZ 1Z03A 4NBDA 3J80f 3F3FC 3GTPI 4XX2A 2LFUA 4HGZA 2V3VA 1Q7Y2 1WCMI 1ML8A 4HGYA 1YJ91 3HOXI 1USPA 4E33A 2RHBA 2J6AA 4A3KI 5AN9F 3CMA1 2Q4ZA 1Q812 2GTIA 3NDIA 5LL6f 2KI7B 3VMGA 5A2Qf 1M1K2 1RO2A 2DE6A 2E2HI 2QEXZ 4A3EI 3CPWZ 3NH5A 1Z01A 1QVFY 2AYDA 3S1QI 2AKLA 3CCR1 4MD8A 1TWHI 2DE7A 1Q822 1KC81 3HOUI 1VQNZ 1NP6A 2NVYI 1K8A2 1Q16A 1KD12 4NB8A 2QRCB 4RVFA 5T6BA 3CCJ1 3CCSZ 3J81b 2V8IA 1VQ51 3CCU1 4RVHA 3TE5B 1VQP1 1QXFA 2JA5I 4A3CI 2BJOA 4EWCA 1N8R2 4QTUA 3D2LA 4MH4A 4E32A 4DQYB 3PO3S 4BY1I 1YJWZ 1W2BY 3S16I 1VQMZ 4A3LI 1K9M1 1Q811 4S1TA 3S2DI 1VQ41 1M1K1 3HOYI 3JAMb 2Y0SA 3P5JB 1WJ2A 3H3VJ 4A3BI 2R7ZI 2F4OA 2JA7I 2JA6I 2W04A 2JA8I 4DK1A 1VQ7Z 4NBGA 3CCS1 3OW2Z 1Q821 4RV9A 1K8A1 3I551 2VPWA 2E9HA 3D6WA 1JJ2Y 3FQMA 1KD11 1VQK1 3HOVI 3CCE1 2M48A 1YJW1 1RNIA 4A3MI 1S7MA 4E31A 3NDJA 2NVXI 1X3ZA 3CMAZ 3CCL1 2I3CA 1N8R1 2R6MA 3CC71 3ESWA 3J81f 3K7AI 4CL1A 5IP9I 3CXCZ 3G711 4X6AI 4A3DI 3CCRZ 4A3GI 3CQZI 1K732 2WB1A 4Y52I 1Y1VS 3D9XA 2E2II 4NBBA 3LUSA 4HH4A 1YIT1 2RIQA 3JAMf 1L1OC 3TDHB 3KIHA 3CCJZ 2O4HA 5IP7I 1K9M2 1VQ5Z 3KIFA 1WIIA 5C4XI 3CCUZ 1VQ81 1NJI1 1TWFI 2Q51A 1YHQZ 1VQPZ 3I561 1ZB8A 2IZ4A 2JNYA 4RS4A 1Y8CA 3GTMI 1VQ61 5T67A 2GTHA 4BXXI 3GTJI 2PM9A 3HOWI 4Y7NI 1VQ4Z 3H0GI 3CC41 3VMHA 2DE5A 2VUMI 5C44I 2IZ3A 3FQQA 4E2ZA 1VQ91 3CME1 3QWUA 2LIYA 4NBCA 2LEXA 1M902 1KQSZ 4NH1C 3MONA 1Q862 2VPXA 3NH8A 3S2HI 1K731 2QRDB 1VQL1 3I55Z 1I50I 3S1RI 4E2XA 3G6E1 1YHQ1 2RPRA 1YIJ1 4NB9A 1YJNZ 1VQKZ 3S1MI 3CCEZ 4NBHA 3CD61 1K83I 3VB9A 1N2FA 1RO0A 3G4S1 3M4OI 1QVGZ 4RVGA 4E2WA 2HF1A 3CCLZ 3I07A 1S721 4DGLA 2RBLA 3PO2I 5T64A 2QA4Z 3OW2Y 3CC7Z 3MZLB 3G71Z 2QR1B 3CCV1 3IR7A 2JIRA 2G2KA 1VLAA 2V8KA 5D1OB 3J7A4 4A3JI 2OOYB 1I3QI 1W2BZ 1NJI2 1TFIA 1YITZ 2OTJ1 1YJN1 3MZKB 1YI21 1M901 5FLMI 3GTMS 2IV2X 1RO4A 1Q861 5A2Qb 1YUAA 4RVDA 2EGTA 1USPB 1VQ8Z 4MXUA 2QA41 2OTLZ 3I56Z 2H85A 4MRIA 1NUIA 1KRLA 4NBFA 1JWHC 1VQ6Z 2P3YA 3T4NB 2YU9I 3RZOI 2V45A 2PK7A 3IF8A 1SIWA 3IFUA 3CC4Z 1DL6A 4NOZA 1VQ9Z 3NH4A 1ZH1A 3CMEZ 2B63I 3I4MI 4A3FI 2OOXB 4E2YA 2JR6A 3CPWY 1Y1WI 3BG0B 1QF8A 1VQLZ 3S14I 3GCFA 2KPIA 3GTOI 2OTL1 2QKDA 3G6EZ 3GTLI 3FKII 2P28A 1YIJZ 2JIOA 2VPZA 3CD6Z 3G4SZ 5C4JI 4MD9A 3NFZA 2JUBA 1S72Z 3GTQI 2OZKA 1KQSY 5FLXb 3I4NI 1PFTA 3S15I 2VPYA 1WW9A 2VF1A 1QYPA 3EERA 3CCQ1 1SFOI 4BBSI 3CCVZ 1VQOZ 4E30A 4AYBA 1FDIA 3CCM1 3EEDA 2YADA 2JIQA 4TNUA 1QVFZ 4A3II 4BBRI 3CC2Z 3U50C 1QVGY 2OTJZ 5IT9b 3RZDI 2ZAEB 4QTTA 2WAQA 2K3RA 1YI2Z 2M6NA 2NVQI 4BY7I 1TWGI 1YUKA 1FDOA 2V8JA 4A93I 1RQFA 1X3WA 1Y1VI 1ZB9A 3GTKI 3GTGI 1Q7Y1 2QLVB 2QEX1 2NVTI 2F4MA 1VQO1 3J80b 1P9NA 2GU2A 1R9TI 2JMOA 1VQN1 2W03A 3CC21 2PMZA 1LQLA 1TWCI 2NAPA 2R93I 3HOZI 1I6HI 4MONA 3S1NI 2JIPA 4NBAA 1X0TA 2QREB 5C3EI 5FLXf 2JIMA 2HU9A 2JS4A 4MD7A 3CXCY 5CM2M 4NFRA 3GKQA 1AA6A 2E2JI 1TWAI 1WZNA
chains in the Genus database with same CATH topology
2VUGA 3VMIA 2K5RA 3F3PC 1YJ9Z 3VTNA 1JJ2Z 1VQM1 5IT9f 4NBEA 2R92I 1Z02A 5D1PA 1KC82 3S17I 1RLYA 3BG1B 3IX0A 3CCQZ 3M3YI 3HKZA 2RT9A 3PO3I 2O53A 5D1OA 1VQ71 3Q87A 3CCMZ 1Z03A 4NBDA 3J80f 3F3FC 3GTPI 4XX2A 2LFUA 4HGZA 1Q7Y2 1WCMI 1ML8A 4HGYA 1YJ91 3HOXI 1USPA 4E33A 2RHBA 2J6AA 4A3KI 5AN9F 3CMA1 2Q4ZA 1Q812 2GTIA 3NDIA 5LL6f 2KI7B 3VMGA 5A2Qf 1M1K2 1RO2A 2DE6A 2E2HI 2QEXZ 4A3EI 3CPWZ 3NH5A 1Z01A 1QVFY 3S1QI 2AKLA 3CCR1 4MD8A 1TWHI 2DE7A 1Q822 1KC81 3HOUI 1VQNZ 1NP6A 2NVYI 1K8A2 1KD12 4NB8A 2QRCB 4RVFA 5T6BA 3CCJ1 3CCSZ 3J81b 2V8IA 1VQ51 3CCU1 4RVHA 3TE5B 1VQP1 2JA5I 4A3CI 2BJOA 4EWCA 1N8R2 4QTUA 4MH4A 4E32A 4DQYB 3PO3S 4BY1I 1YJWZ 1W2BY 3S16I 1VQMZ 4A3LI 1K9M1 1Q811 4S1TA 3S2DI 1VQ41 1M1K1 3HOYI 3JAMb 2Y0SA 3P5JB 3H3VJ 4A3BI 2R7ZI 2F4OA 2JA7I 2JA6I 2W04A 2JA8I 4DK1A 1VQ7Z 4NBGA 3CCS1 3OW2Z 1Q821 4RV9A 1K8A1 3I551 2E9HA 3D6WA 1JJ2Y 3FQMA 1KD11 1VQK1 3HOVI 3CCE1 2M48A 1YJW1 1RNIA 4A3MI 1S7MA 4E31A 3NDJA 2NVXI 1X3ZA 3CMAZ 3CCL1 2I3CA 1N8R1 2R6MA 3CC71 3ESWA 3J81f 3K7AI 4CL1A 5IP9I 3CXCZ 3G711 4X6AI 4A3DI 3CCRZ 4A3GI 3CQZI 1K732 2WB1A 4Y52I 1Y1VS 3D9XA 2E2II 4NBBA 3LUSA 4HH4A 1YIT1 2RIQA 3JAMf 1L1OC 3TDHB 3KIHA 3CCJZ 2O4HA 5IP7I 1K9M2 1VQ5Z 3KIFA 1WIIA 5C4XI 3CCUZ 1VQ81 1NJI1 1TWFI 2Q51A 1YHQZ 1VQPZ 3I561 1ZB8A 2IZ4A 2JNYA 4RS4A 3GTMI 1VQ61 5T67A 2GTHA 4BXXI 3GTJI 2PM9A 3HOWI 4Y7NI 1VQ4Z 3H0GI 3CC41 3VMHA 2DE5A 2VUMI 5C44I 2IZ3A 3FQQA 4E2ZA 1VQ91 3CME1 3QWUA 2LIYA 4NBCA 1M902 1KQSZ 4NH1C 3MONA 1Q862 3NH8A 3S2HI 1K731 2QRDB 1VQL1 3I55Z 1I50I 3S1RI 4E2XA 3G6E1 1YHQ1 2RPRA 1YIJ1 4NB9A 1YJNZ 1VQKZ 3S1MI 3CCEZ 4NBHA 3CD61 1K83I 3VB9A 1N2FA 1RO0A 3G4S1 3M4OI 1QVGZ 4RVGA 4E2WA 2HF1A 3CCLZ 3I07A 1S721 4DGLA 2RBLA 3PO2I 5T64A 2QA4Z 3OW2Y 3CC7Z 3MZLB 3G71Z 2QR1B 3CCV1 2G2KA 1VLAA 2V8KA 5D1OB 3J7A4 4A3JI 2OOYB 1I3QI 1W2BZ 1NJI2 1TFIA 1YITZ 2OTJ1 1YJN1 3MZKB 1YI21 1M901 5FLMI 3GTMS 1RO4A 1Q861 5A2Qb 1YUAA 4RVDA 2EGTA 1USPB 1VQ8Z 4MXUA 2QA41 2OTLZ 3I56Z 2H85A 4MRIA 1NUIA 1KRLA 4NBFA 1JWHC 1VQ6Z 2P3YA 3T4NB 2YU9I 3RZOI 2PK7A 3IF8A 3IFUA 3CC4Z 1DL6A 4NOZA 1VQ9Z 3NH4A 1ZH1A 3CMEZ 2B63I 3I4MI 4A3FI 2OOXB 4E2YA 2JR6A 3CPWY 1Y1WI 3BG0B 1QF8A 1VQLZ 3S14I 3GCFA 2KPIA 3GTOI 2OTL1 2QKDA 3G6EZ 3GTLI 3FKII 2P28A 1YIJZ 3CD6Z 3G4SZ 5C4JI 4MD9A 3NFZA 2JUBA 1S72Z 3GTQI 2OZKA 1KQSY 5FLXb 3I4NI 1PFTA 3S15I 1WW9A 2VF1A 1QYPA 3EERA 3CCQ1 1SFOI 4BBSI 3CCVZ 1VQOZ 4E30A 4AYBA 3CCM1 3EEDA 2YADA 4TNUA 1QVFZ 4A3II 4BBRI 3CC2Z 3U50C 1QVGY 2OTJZ 5IT9b 3RZDI 2ZAEB 4QTTA 2WAQA 2K3RA 1YI2Z 2M6NA 2NVQI 4BY7I 1TWGI 1YUKA 2V8JA 4A93I 1RQFA 1X3WA 1Y1VI 1ZB9A 3GTKI 3GTGI 1Q7Y1 2QLVB 2QEX1 2NVTI 2F4MA 1VQO1 3J80b 1P9NA 2GU2A 1R9TI 2JMOA 1VQN1 2W03A 3CC21 2PMZA 1LQLA 1TWCI 2R93I 3HOZI 1I6HI 4MONA 3S1NI 4NBAA 1X0TA 2QREB 5C3EI 5FLXf 2HU9A 2JS4A 4MD7A 3CXCY 5CM2M 4NFRA 3GKQA 2E2JI 1TWAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM Z;  1VQ9 1;  3CPW Y;  1K9M 1;  1Q81 1;  3CME 1;  1VQL Z;  1VQ4 1;  1M1K 1;  2OTL 1;  1M90 2;  1KQS Z;  3G6E Z;  1YJ9 Z;  1JJ2 Z;  1Q86 2;  1VQM 1;  1YIJ Z;  1K73 1;  1KC8 2;  1VQL 1;  3I55 Z;  3CD6 Z;  3G4S Z;  3G6E 1;  1VQ7 Z;  1YHQ 1;  3OW2 Z;  3CCS 1;  1Q82 1;  1YIJ 1;  3CCQ Z;  1YJN Z;  1VQK Z;  1K8A 1;  3I55 1;  3CCE Z;  1S72 Z;  3CD6 1;  3G4S 1;  1VQ7 1;  1KQS Y;  3CCM Z;  1JJ2 Y;  1QVG Z;  1KD1 1;  3CCQ 1;  1VQK 1;  3CCL Z;  3CCE 1;  1S72 1;  3CCV Z;  1VQO Z;  1YJW 1;  3CCM 1;  2QA4 Z;  3OW2 Y;  3CC7 Z;  1Q7Y 2;  3CMA Z;  3CCL 1;  3G71 Z;  3CCV 1;  1QVF Z;  1YJ9 1;  3CC2 Z;  1YJW Z;  1N8R 1;  1QVG Y;  3CC7 1;  2OTJ Z;  3CMA 1;  1Q81 2;  3CXC Z;  3G71 1;  1YI2 Z;  1M1K 2;  1W2B Z;  1NJI 2;  3CCR Z;  2QEX Z;  1YIT Z;  1YJN 1;  3CPW Z;  2OTJ 1;  1K73 2;  1YI2 1;  1QVF Y;  1M90 1;  1Q86 1;  3CCR 1;  1Q7Y 1;  2QEX 1;  1YIT 1;  1Q82 2;  1KC8 1;  1VQN Z;  1VQO 1;  1K8A 2;  1VQ8 Z;  2QA4 1;  2OTL Z;  3CCJ Z;  3I56 Z;  1K9M 2;  1VQ5 Z;  1VQN 1;  1KD1 2;  3CCU Z;  1VQ8 1;  1VQ6 Z;  3CC2 1;  1NJI 1;  3CCJ 1;  1YHQ Z;  1VQP Z;  3I56 1;  3CCS Z;  1VQ5 1;  3CCU 1;  1VQ6 1;  3CC4 Z;  1VQP 1;  1N8R 2;  1VQ9 Z;  3CME Z;  3CXC Y;  1VQ4 Z;  1W2B Y;  3CC4 1; 
#chains in the Genus database with same CATH topology
 2VUG A;  3VMI A;  2K5R A;  3F3P C;  1YJ9 Z;  3VTN A;  1JJ2 Z;  1VQM 1;  5IT9 f;  4NBE A;  2R92 I;  1Z02 A;  5D1P A;  1KC8 2;  3S17 I;  1RLY A;  3BG1 B;  3IX0 A;  3CCQ Z;  3M3Y I;  3HKZ A;  2RT9 A;  3PO3 I;  2O53 A;  5D1O A;  2E7Z A;  1VQ7 1;  3Q87 A;  3CCM Z;  1Z03 A;  4NBD A;  3J80 f;  3F3F C;  3GTP I;  4XX2 A;  2LFU A;  4HGZ A;  2V3V A;  1Q7Y 2;  1WCM I;  1ML8 A;  4HGY A;  1YJ9 1;  3HOX I;  1USP A;  4E33 A;  2RHB A;  2J6A A;  4A3K I;  5AN9 F;  3CMA 1;  2Q4Z A;  1Q81 2;  2GTI A;  3NDI A;  5LL6 f;  2KI7 B;  3VMG A;  5A2Q f;  1M1K 2;  1RO2 A;  2DE6 A;  2E2H I;  2QEX Z;  4A3E I;  3CPW Z;  3NH5 A;  1Z01 A;  1QVF Y;  2AYD A;  3S1Q I;  2AKL A;  3CCR 1;  4MD8 A;  1TWH I;  2DE7 A;  1Q82 2;  1KC8 1;  3HOU I;  1VQN Z;  1NP6 A;  2NVY I;  1K8A 2;  1Q16 A;  1KD1 2;  4NB8 A;  2QRC B;  4RVF A;  5T6B A;  3CCJ 1;  3CCS Z;  3J81 b;  2V8I A;  1VQ5 1;  3CCU 1;  4RVH A;  3TE5 B;  1VQP 1;  1QXF A;  2JA5 I;  4A3C I;  2BJO A;  4EWC A;  1N8R 2;  4QTU A;  3D2L A;  4MH4 A;  4E32 A;  4DQY B;  3PO3 S;  4BY1 I;  1YJW Z;  1W2B Y;  3S16 I;  1VQM Z;  4A3L I;  1K9M 1;  1Q81 1;  4S1T A;  3S2D I;  1VQ4 1;  1M1K 1;  3HOY I;  3JAM b;  2Y0S A;  3P5J B;  1WJ2 A;  3H3V J;  4A3B I;  2R7Z I;  2F4O A;  2JA7 I;  2JA6 I;  2W04 A;  2JA8 I;  4DK1 A;  1VQ7 Z;  4NBG A;  3CCS 1;  3OW2 Z;  1Q82 1;  4RV9 A;  1K8A 1;  3I55 1;  2VPW A;  2E9H A;  3D6W A;  1JJ2 Y;  3FQM A;  1KD1 1;  1VQK 1;  3HOV I;  3CCE 1;  2M48 A;  1YJW 1;  1RNI A;  4A3M I;  1S7M A;  4E31 A;  3NDJ A;  2NVX I;  1X3Z A;  3CMA Z;  3CCL 1;  2I3C A;  1N8R 1;  2R6M A;  3CC7 1;  3ESW A;  3J81 f;  3K7A I;  4CL1 A;  5IP9 I;  3CXC Z;  3G71 1;  4X6A I;  4A3D I;  3CCR Z;  4A3G I;  3CQZ I;  1K73 2;  2WB1 A;  4Y52 I;  1Y1V S;  3D9X A;  2E2I I;  4NBB A;  3LUS A;  4HH4 A;  1YIT 1;  2RIQ A;  3JAM f;  1L1O C;  3TDH B;  3KIH A;  3CCJ Z;  2O4H A;  5IP7 I;  1K9M 2;  1VQ5 Z;  3KIF A;  1WII A;  5C4X I;  3CCU Z;  1VQ8 1;  1NJI 1;  1TWF I;  2Q51 A;  1YHQ Z;  1VQP Z;  3I56 1;  1ZB8 A;  2IZ4 A;  2JNY A;  4RS4 A;  1Y8C A;  3GTM I;  1VQ6 1;  5T67 A;  2GTH A;  4BXX I;  3GTJ I;  2PM9 A;  3HOW I;  4Y7N I;  1VQ4 Z;  3H0G I;  3CC4 1;  3VMH A;  2DE5 A;  2VUM I;  5C44 I;  2IZ3 A;  3FQQ A;  4E2Z A;  1VQ9 1;  3CME 1;  3QWU A;  2LIY A;  4NBC A;  2LEX A;  1M90 2;  1KQS Z;  4NH1 C;  3MON A;  1Q86 2;  2VPX A;  3NH8 A;  3S2H I;  1K73 1;  2QRD B;  1VQL 1;  3I55 Z;  1I50 I;  3S1R I;  4E2X A;  3G6E 1;  1YHQ 1;  2RPR A;  1YIJ 1;  4NB9 A;  1YJN Z;  1VQK Z;  3S1M I;  3CCE Z;  4NBH A;  3CD6 1;  1K83 I;  3VB9 A;  1N2F A;  1RO0 A;  3G4S 1;  3M4O I;  1QVG Z;  4RVG A;  4E2W A;  2HF1 A;  3CCL Z;  3I07 A;  1S72 1;  4DGL A;  2RBL A;  3PO2 I;  5T64 A;  2QA4 Z;  3OW2 Y;  3CC7 Z;  3MZL B;  3G71 Z;  2QR1 B;  3CCV 1;  3IR7 A;  2JIR A;  2G2K A;  1VLA A;  2V8K A;  5D1O B;  3J7A 4;  4A3J I;  2OOY B;  1I3Q I;  1W2B Z;  1NJI 2;  1TFI A;  1YIT Z;  2OTJ 1;  1YJN 1;  3MZK B;  1YI2 1;  1M90 1;  5FLM I;  3GTM S;  2IV2 X;  1RO4 A;  1Q86 1;  5A2Q b;  1YUA A;  4RVD A;  2EGT A;  1USP B;  1VQ8 Z;  4MXU A;  2QA4 1;  2OTL Z;  3I56 Z;  2H85 A;  4MRI A;  1NUI A;  1KRL A;  4NBF A;  1JWH C;  1VQ6 Z;  2P3Y A;  3T4N B;  2YU9 I;  3RZO I;  2V45 A;  2PK7 A;  3IF8 A;  1SIW A;  3IFU A;  3CC4 Z;  1DL6 A;  4NOZ A;  1VQ9 Z;  3NH4 A;  1ZH1 A;  3CME Z;  2B63 I;  3I4M I;  4A3F I;  2OOX B;  4E2Y A;  2JR6 A;  3CPW Y;  1Y1W I;  3BG0 B;  1QF8 A;  1VQL Z;  3S14 I;  3GCF A;  2KPI A;  3GTO I;  2OTL 1;  2QKD A;  3G6E Z;  3GTL I;  3FKI I;  2P28 A;  1YIJ Z;  2JIO A;  2VPZ A;  3CD6 Z;  3G4S Z;  5C4J I;  4MD9 A;  3NFZ A;  2JUB A;  1S72 Z;  3GTQ I;  2OZK A;  1KQS Y;  5FLX b;  3I4N I;  1PFT A;  3S15 I;  2VPY A;  1WW9 A;  2VF1 A;  1QYP A;  3EER A;  3CCQ 1;  1SFO I;  4BBS I;  3CCV Z;  1VQO Z;  4E30 A;  4AYB A;  1FDI A;  3CCM 1;  3EED A;  2YAD A;  2JIQ A;  4TNU A;  1QVF Z;  4A3I I;  4BBR I;  3CC2 Z;  3U50 C;  1QVG Y;  2OTJ Z;  5IT9 b;  3RZD I;  2ZAE B;  4QTT A;  2WAQ A;  2K3R A;  1YI2 Z;  2M6N A;  2NVQ I;  4BY7 I;  1TWG I;  1YUK A;  1FDO A;  2V8J A;  4A93 I;  1RQF A;  1X3W A;  1Y1V I;  1ZB9 A;  3GTK I;  3GTG I;  1Q7Y 1;  2QLV B;  2QEX 1;  2NVT I;  2F4M A;  1VQO 1;  3J80 b;  1P9N A;  2GU2 A;  1R9T I;  2JMO A;  1VQN 1;  2W03 A;  3CC2 1;  2PMZ A;  1LQL A;  1TWC I;  2NAP A;  2R93 I;  3HOZ I;  1I6H I;  4MON A;  3S1N I;  2JIP A;  4NBA A;  1X0T A;  2QRE B;  5C3E I;  5FLX f;  2JIM A;  2HU9 A;  2JS4 A;  4MD7 A;  3CXC Y;  5CM2 M;  4NFR A;  3GKQ A;  1AA6 A;  2E2J I;  1TWA I;  1WZN A; 
#chains in the Genus database with same CATH homology
 2VUG A;  3VMI A;  2K5R A;  3F3P C;  1YJ9 Z;  3VTN A;  1JJ2 Z;  1VQM 1;  5IT9 f;  4NBE A;  2R92 I;  1Z02 A;  5D1P A;  1KC8 2;  3S17 I;  1RLY A;  3BG1 B;  3IX0 A;  3CCQ Z;  3M3Y I;  3HKZ A;  2RT9 A;  3PO3 I;  2O53 A;  5D1O A;  1VQ7 1;  3Q87 A;  3CCM Z;  1Z03 A;  4NBD A;  3J80 f;  3F3F C;  3GTP I;  4XX2 A;  2LFU A;  4HGZ A;  1Q7Y 2;  1WCM I;  1ML8 A;  4HGY A;  1YJ9 1;  3HOX I;  1USP A;  4E33 A;  2RHB A;  2J6A A;  4A3K I;  5AN9 F;  3CMA 1;  2Q4Z A;  1Q81 2;  2GTI A;  3NDI A;  5LL6 f;  2KI7 B;  3VMG A;  5A2Q f;  1M1K 2;  1RO2 A;  2DE6 A;  2E2H I;  2QEX Z;  4A3E I;  3CPW Z;  3NH5 A;  1Z01 A;  1QVF Y;  3S1Q I;  2AKL A;  3CCR 1;  4MD8 A;  1TWH I;  2DE7 A;  1Q82 2;  1KC8 1;  3HOU I;  1VQN Z;  1NP6 A;  2NVY I;  1K8A 2;  1KD1 2;  4NB8 A;  2QRC B;  4RVF A;  5T6B A;  3CCJ 1;  3CCS Z;  3J81 b;  2V8I A;  1VQ5 1;  3CCU 1;  4RVH A;  3TE5 B;  1VQP 1;  2JA5 I;  4A3C I;  2BJO A;  4EWC A;  1N8R 2;  4QTU A;  4MH4 A;  4E32 A;  4DQY B;  3PO3 S;  4BY1 I;  1YJW Z;  1W2B Y;  3S16 I;  1VQM Z;  4A3L I;  1K9M 1;  1Q81 1;  4S1T A;  3S2D I;  1VQ4 1;  1M1K 1;  3HOY I;  3JAM b;  2Y0S A;  3P5J B;  3H3V J;  4A3B I;  2R7Z I;  2F4O A;  2JA7 I;  2JA6 I;  2W04 A;  2JA8 I;  4DK1 A;  1VQ7 Z;  4NBG A;  3CCS 1;  3OW2 Z;  1Q82 1;  4RV9 A;  1K8A 1;  3I55 1;  2E9H A;  3D6W A;  1JJ2 Y;  3FQM A;  1KD1 1;  1VQK 1;  3HOV I;  3CCE 1;  2M48 A;  1YJW 1;  1RNI A;  4A3M I;  1S7M A;  4E31 A;  3NDJ A;  2NVX I;  1X3Z A;  3CMA Z;  3CCL 1;  2I3C A;  1N8R 1;  2R6M A;  3CC7 1;  3ESW A;  3J81 f;  3K7A I;  4CL1 A;  5IP9 I;  3CXC Z;  3G71 1;  4X6A I;  4A3D I;  3CCR Z;  4A3G I;  3CQZ I;  1K73 2;  2WB1 A;  4Y52 I;  1Y1V S;  3D9X A;  2E2I I;  4NBB A;  3LUS A;  4HH4 A;  1YIT 1;  2RIQ A;  3JAM f;  1L1O C;  3TDH B;  3KIH A;  3CCJ Z;  2O4H A;  5IP7 I;  1K9M 2;  1VQ5 Z;  3KIF A;  1WII A;  5C4X I;  3CCU Z;  1VQ8 1;  1NJI 1;  1TWF I;  2Q51 A;  1YHQ Z;  1VQP Z;  3I56 1;  1ZB8 A;  2IZ4 A;  2JNY A;  4RS4 A;  3GTM I;  1VQ6 1;  5T67 A;  2GTH A;  4BXX I;  3GTJ I;  2PM9 A;  3HOW I;  4Y7N I;  1VQ4 Z;  3H0G I;  3CC4 1;  3VMH A;  2DE5 A;  2VUM I;  5C44 I;  2IZ3 A;  3FQQ A;  4E2Z A;  1VQ9 1;  3CME 1;  3QWU A;  2LIY A;  4NBC A;  1M90 2;  1KQS Z;  4NH1 C;  3MON A;  1Q86 2;  3NH8 A;  3S2H I;  1K73 1;  2QRD B;  1VQL 1;  3I55 Z;  1I50 I;  3S1R I;  4E2X A;  3G6E 1;  1YHQ 1;  2RPR A;  1YIJ 1;  4NB9 A;  1YJN Z;  1VQK Z;  3S1M I;  3CCE Z;  4NBH A;  3CD6 1;  1K83 I;  3VB9 A;  1N2F A;  1RO0 A;  3G4S 1;  3M4O I;  1QVG Z;  4RVG A;  4E2W A;  2HF1 A;  3CCL Z;  3I07 A;  1S72 1;  4DGL A;  2RBL A;  3PO2 I;  5T64 A;  2QA4 Z;  3OW2 Y;  3CC7 Z;  3MZL B;  3G71 Z;  2QR1 B;  3CCV 1;  2G2K A;  1VLA A;  2V8K A;  5D1O B;  3J7A 4;  4A3J I;  2OOY B;  1I3Q I;  1W2B Z;  1NJI 2;  1TFI A;  1YIT Z;  2OTJ 1;  1YJN 1;  3MZK B;  1YI2 1;  1M90 1;  5FLM I;  3GTM S;  1RO4 A;  1Q86 1;  5A2Q b;  1YUA A;  4RVD A;  2EGT A;  1USP B;  1VQ8 Z;  4MXU A;  2QA4 1;  2OTL Z;  3I56 Z;  2H85 A;  4MRI A;  1NUI A;  1KRL A;  4NBF A;  1JWH C;  1VQ6 Z;  2P3Y A;  3T4N B;  2YU9 I;  3RZO I;  2PK7 A;  3IF8 A;  3IFU A;  3CC4 Z;  1DL6 A;  4NOZ A;  1VQ9 Z;  3NH4 A;  1ZH1 A;  3CME Z;  2B63 I;  3I4M I;  4A3F I;  2OOX B;  4E2Y A;  2JR6 A;  3CPW Y;  1Y1W I;  3BG0 B;  1QF8 A;  1VQL Z;  3S14 I;  3GCF A;  2KPI A;  3GTO I;  2OTL 1;  2QKD A;  3G6E Z;  3GTL I;  3FKI I;  2P28 A;  1YIJ Z;  3CD6 Z;  3G4S Z;  5C4J I;  4MD9 A;  3NFZ A;  2JUB A;  1S72 Z;  3GTQ I;  2OZK A;  1KQS Y;  5FLX b;  3I4N I;  1PFT A;  3S15 I;  1WW9 A;  2VF1 A;  1QYP A;  3EER A;  3CCQ 1;  1SFO I;  4BBS I;  3CCV Z;  1VQO Z;  4E30 A;  4AYB A;  3CCM 1;  3EED A;  2YAD A;  4TNU A;  1QVF Z;  4A3I I;  4BBR I;  3CC2 Z;  3U50 C;  1QVG Y;  2OTJ Z;  5IT9 b;  3RZD I;  2ZAE B;  4QTT A;  2WAQ A;  2K3R A;  1YI2 Z;  2M6N A;  2NVQ I;  4BY7 I;  1TWG I;  1YUK A;  2V8J A;  4A93 I;  1RQF A;  1X3W A;  1Y1V I;  1ZB9 A;  3GTK I;  3GTG I;  1Q7Y 1;  2QLV B;  2QEX 1;  2NVT I;  2F4M A;  1VQO 1;  3J80 b;  1P9N A;  2GU2 A;  1R9T I;  2JMO A;  1VQN 1;  2W03 A;  3CC2 1;  2PMZ A;  1LQL A;  1TWC I;  2R93 I;  3HOZ I;  1I6H I;  4MON A;  3S1N I;  4NBA A;  1X0T A;  2QRE B;  5C3E I;  5FLX f;  2HU9 A;  2JS4 A;  4MD7 A;  3CXC Y;  5CM2 M;  4NFR A;  3GKQ A;  2E2J I;  1TWA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...