3CCJ1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccj100
1YHQZ 2OTJ1 3CCLZ 3CXCY 1N8R1 3CC41 1K9M2 3CCUZ 1YIT1 2OTJZ 3G711 3I561 3CC4Z 1YJ91 3OW2Y 1YITZ 3I551 3CXCZ 3G71Z 1JJ2Z 1VQ5Z 1VQL1 3I55Z 1QVFZ 3CCQ1 3CPWZ 1YJW1 3CD6Z 1VQLZ 3CMEZ 1Q7Y2 3CCQZ 1VQP1 1YJWZ 3CCM1 1Q822 1VQK1 1YI21 2OTL1 1VQO1 1KC81 3CCMZ 1S721 1VQ61 1QVGY 1YI2Z 2QEX1 1YIJ1 2OTLZ 1VQOZ 1M901 3I56Z 1YJ9Z 1S72Z 3CC71 1W2BY 1KQSY 1VQ6Z 2QEXZ 1YIJZ 3CCJ1 3CCV1 3OW2Z 1K8A2 1N8R2 1VQN1 1VQ81 3CCJZ 3CCVZ 1Q812 1K9M1 1VQ71 1VQNZ 1YJN1 1M1K2 3CCE1 1VQPZ 3CCR1 1VQ7Z 1VQKZ 3CCEZ 1K732 3CMA1 3G6E1 1Q862 1KD12 3CCL1 1VQ91 3CMAZ 1NJI2 3G6EZ 1K8A1 1Q7Y1 3CC7Z 1VQ9Z 1QVGZ 1JJ2Y 2QA41 1Q811 1QVFY 1VQ41 1Q821 3CPWY 1W2BZ 1KQSZ 3G4S1 1KC82 1VQ8Z 1VQ51 1M1K1 2QA4Z 1VQ4Z 3CC21 3G4SZ 1YJNZ 1K731 3CCS1 1M902 1VQM1 3CD61 3CME1 1Q861 1KD11 3CC2Z 1YHQ1 3CCRZ 3CCSZ 1VQMZ 1NJI1 3CCU1
chains in the Genus database with same CATH superfamily
1YUKA 5C3EI 2OOXB 3MONA 3CC41 2NVTI 2R7ZI 2QKDA 1K9M2 3H3VJ 2R6MA 2OTJZ 3G711 2R92I 3QWUA 3I561 4NH1C 1YJ91 4A3KI 2Y0SA 3NH4A 4A3EI 4S1TA 1Z03A 4E32A 5A2Qb 3HOZI 1X3WA 1Q7Y2 3HOUI 1TWGI 1VQP1 1YJWZ 1USPB 4RVGA 4E31A 2JS4A 3TE5B 2O4HA 3S2HI 1YI21 2OTL1 2LIYA 3CCMZ 1VQ61 5C4JI 2JIPA 1Y1VI 1YIJ1 3GCFA 4E2ZA 2W04A 4MD7A 1W2BY 1KQSY 3IR7A 2JIOA 2VF1A 3OW2Z 4E2WA 3JAMf 1N8R2 2P28A 1QYPA 1Q812 1K9M1 2AYDA 3S14I 5T6BA 4A93I 1YJN1 2VPZA 1M1K2 3EERA 5IP9I 2IZ3A 2Q4ZA 3KIHA 3F3PC 4QTUA 3CQZI 1RLYA 1VQ7Z 2NVXI 2NAPA 1WIIA 3CMA1 3IFUA 3GTMS 4A3GI 1P9NA 4A3LI 3J81f 5FLXb 3BG0B 3NFZA 2Q51A 1K8A1 1Q7Y1 1SFOI 2R93I 4XX2A 1NUIA 2BJOA 3CPWY 1KRLA 1I3QI 2QLVB 1L1OC 1TFIA 1VQ8Z 1VQ51 1KC82 2QA4Z 4MONA 3KIFA 4CL1A 4NBCA 1VQM1 3U50C 2GTHA 2GTIA 1Q861 1KD11 2JIRA 2DE5A 1YHQZ 3CCLZ 2OOYB 3CXCY 1N8R1 2PK7A 2JA6I 1RNIA 5FLMI 3M3YI 2RIQA 3I4MI 2VPWA 3IX0A 3CC4Z 1Z02A 4RVFA 2YADA 2B63I 2QREB 2IZ4A 4NBEA 3G71Z 4HGZA 1K83I 3S2DI 1JJ2Z 4A3JI 1VQL1 3S1QI 3I07A 1QVFZ 3GTGI 3CD6Z 2E2JI 3CMEZ 2DE7A 1LQLA 3HKZA 2JIMA 1KC81 4HH4A 2JIQA 1Y1WI 3VMIA 2NVQI 1QVGY 1YI2Z 2QEX1 2JA5I 2OTLZ 2WAQA 3HOVI 2RHBA 2F4MA 2H85A 2V8KA 3CC71 2G2KA 1VQ6Z 1RO4A 3HOWI 1YIJZ 3NDIA 3NH5A 3CCJ1 2JNYA 1Y1VS 3RZOI 5C4XI 3JAMb 3PO2I 3GTKI 4DK1A 1K8A2 2F4OA 3S16I 4QTTA 3D2LA 2KI7B 2DE6A 2K5RA 3CCR1 3S1NI 1VQKZ 3FQQA 1TWHI 1Q862 1KD12 4RVDA 3F3FC 3J81b 4MH4A 2NVYI 3CMAZ 2YU9I 3RZDI 4RVHA 1S7MA 2E9HA 1Z01A 1WZNA 2M6NA 3G4S1 4NBGA 1FDIA 4NBFA 2LFUA 4BBRI 4A3FI 2V8IA 2RT9A 3VTNA 2PMZA 2VUGA 1VQMZ 1NJI1 4BBSI 3CCU1 5D1OA 3MZLB 3S1MI 1QF8A 1YIT1 2VPXA 2QR1B 1TWFI 3OW2Y 5T64A 3I551 4Y7NI 3CXCZ 1JWHC 2RBLA 3CCQ1 1VQLZ 1ZB8A 4RV9A 1WCMI 1PFTA 3GTQI 3GTLI 2HF1A 1R9TI 1VQO1 1I6HI 1S721 2V8JA 4NBBA 4AYBA 4MXUA 4X6AI 5IP7I 3D6WA 3ESWA 3I56Z 1YJ9Z 2P3YA 3D9XA 2QRDB 3MZKB 2QEXZ 3CCV1 3GTOI 3VMHA 3T4NB 1RO2A 4A3DI 1VQN1 1VQ81 3CCJZ 4MD8A 2LEXA 2HU9A 3CCE1 1NP6A 1VQPZ 4E2XA 2IV2X 3S15I 3NH8A 2J6AA 3GTPI 4Y52I 3G6E1 3CCL1 2GU2A 2O53A 5T67A 1X0TA 1VQ91 4E2YA 1NJI2 1FDOA 2WB1A 3HOXI 3P5JB 1X3ZA 4HGYA 1Y8CA 2JMOA 1JJ2Y 2VUMI 5IT9f 1QVFY 4A3MI 1VQ41 2E7ZA 2W03A 1W2BZ 1KQSZ 4BXXI 3PO3I 2I3CA 1ZB9A 3CC21 3LUSA 3G4SZ 1YJNZ 1K731 3CCS1 1M902 1TWCI 4BY1I 3CD61 2PM9A 3CME1 1AA6A 4NB9A 3J7A4 4BY7I 1YUAA 5AN9F 2OTJ1 3Q87A 4E30A 3H0GI 1N2FA 3CCUZ 2JA8I 3I4NI 1Q16A 2QRCB 3FQMA 4NOZA 3GTJI 1YITZ 1RO0A 3FKII 3S1RI 2V45A 1VQ5Z 2RPRA 3I55Z 5A2Qf 3CPWZ 1YJW1 2K3RA 3M4OI 4A3CI 3CCQZ 1ML8A 3CCM1 1Q822 1VQK1 2VPYA 3S17I 2AKLA 1VLAA 4NFRA 4A3BI 2V3VA 1ZH1A 1VQOZ 4DGLA 1M901 4EWCA 3VMGA 4MD9A 3HOYI 2JA7I 4RS4A 3EEDA 1S72Z 4A3II 3IF8A 1DL6A 4TNUA 2JUBA 1WJ2A 3CCVZ 3J80b 1VQ71 1VQNZ 3VB9A 2JR6A 2M48A 3GTMI 4NBAA 1TWAI 1USPA 2KPIA 3CCEZ 1K732 1I50I 2E2HI 1RQFA 4MRIA 1WW9A 5CM2M 5C44I 4NBDA 3G6EZ 3K7AI 5FLXf 2EGTA 2OZKA 3CC7Z 1VQ9Z 1QVGZ 5IT9b 2QA41 3NDJA 1Q811 3J80f 5D1PA 1Q821 4E33A 1M1K1 3TDHB 3BG1B 4NBHA 1VQ4Z 1SIWA 4NB8A 5D1OB 5LL6f 3CC2Z 1YHQ1 3PO3S 3CCRZ 2ZAEB 3GKQA 3CCSZ 1QXFA 2E2II 4DQYB
chains in the Genus database with same CATH topology
1YUKA 5C3EI 2OOXB 3MONA 3CC41 2NVTI 2R7ZI 2QKDA 1K9M2 3H3VJ 2R6MA 2OTJZ 3G711 2R92I 3QWUA 3I561 4NH1C 1YJ91 4A3KI 2Y0SA 3NH4A 4A3EI 4S1TA 1Z03A 4E32A 5A2Qb 3HOZI 1X3WA 1Q7Y2 3HOUI 1TWGI 1VQP1 1YJWZ 1USPB 4RVGA 4E31A 2JS4A 3TE5B 2O4HA 3S2HI 1YI21 2OTL1 2LIYA 3CCMZ 1VQ61 5C4JI 1Y1VI 1YIJ1 3GCFA 4E2ZA 2W04A 4MD7A 1W2BY 1KQSY 2VF1A 3OW2Z 4E2WA 3JAMf 1N8R2 2P28A 1QYPA 1Q812 1K9M1 3S14I 5T6BA 4A93I 1YJN1 1M1K2 3EERA 5IP9I 2IZ3A 2Q4ZA 3KIHA 3F3PC 4QTUA 3CQZI 1RLYA 1VQ7Z 2NVXI 3CMA1 1WIIA 3IFUA 3GTMS 4A3GI 1P9NA 4A3LI 3J81f 5FLXb 3BG0B 3NFZA 2Q51A 1K8A1 1Q7Y1 1SFOI 2R93I 4XX2A 1NUIA 2BJOA 3CPWY 1KRLA 1I3QI 2QLVB 1L1OC 1TFIA 1VQ8Z 1VQ51 1KC82 2QA4Z 4MONA 3KIFA 4CL1A 4NBCA 1VQM1 3U50C 2GTHA 2GTIA 1Q861 1KD11 2DE5A 1YHQZ 3CCLZ 2OOYB 3CXCY 1N8R1 2PK7A 2JA6I 1RNIA 5FLMI 3M3YI 2RIQA 3I4MI 3IX0A 3CC4Z 1Z02A 4RVFA 2YADA 2B63I 2QREB 2IZ4A 4NBEA 3G71Z 4HGZA 1K83I 3S2DI 1JJ2Z 4A3JI 1VQL1 3S1QI 3I07A 1QVFZ 3GTGI 3CD6Z 2E2JI 3CMEZ 2DE7A 1LQLA 3HKZA 1KC81 4HH4A 1Y1WI 3VMIA 2NVQI 1QVGY 1YI2Z 2QEX1 2JA5I 2OTLZ 2WAQA 3HOVI 2RHBA 2F4MA 2H85A 2V8KA 3CC71 2G2KA 1VQ6Z 1RO4A 3HOWI 1YIJZ 3NDIA 3NH5A 3CCJ1 2JNYA 1Y1VS 3RZOI 5C4XI 3JAMb 3PO2I 3GTKI 4DK1A 1K8A2 2F4OA 3S16I 4QTTA 2KI7B 2DE6A 2K5RA 3CCR1 3S1NI 1VQKZ 3FQQA 1TWHI 1Q862 1KD12 4RVDA 3F3FC 3J81b 4MH4A 2NVYI 3CMAZ 2YU9I 3RZDI 4RVHA 1S7MA 2E9HA 1Z01A 2M6NA 3G4S1 4NBGA 4NBFA 2LFUA 4BBRI 4A3FI 2V8IA 2RT9A 3VTNA 2PMZA 2VUGA 1VQMZ 1NJI1 4BBSI 3CCU1 5D1OA 3MZLB 3S1MI 1QF8A 1YIT1 2QR1B 1TWFI 3OW2Y 5T64A 3I551 4Y7NI 3CXCZ 1JWHC 2RBLA 3CCQ1 1VQLZ 1ZB8A 4RV9A 1WCMI 1PFTA 3GTQI 3GTLI 2HF1A 1R9TI 1VQO1 1I6HI 1S721 2V8JA 4NBBA 4AYBA 4MXUA 4X6AI 5IP7I 3D6WA 3ESWA 3I56Z 1YJ9Z 2P3YA 3D9XA 2QRDB 3MZKB 2QEXZ 3CCV1 3GTOI 3VMHA 3T4NB 1RO2A 4A3DI 1VQN1 1VQ81 3CCJZ 4MD8A 2HU9A 3CCE1 1NP6A 1VQPZ 4E2XA 3S15I 3NH8A 2J6AA 3GTPI 4Y52I 3G6E1 3CCL1 2GU2A 2O53A 5T67A 1X0TA 1VQ91 4E2YA 1NJI2 2WB1A 3HOXI 3P5JB 1X3ZA 4HGYA 2JMOA 1JJ2Y 2VUMI 5IT9f 1QVFY 4A3MI 1VQ41 2W03A 1W2BZ 1KQSZ 4BXXI 3PO3I 2I3CA 1ZB9A 3CC21 3LUSA 3G4SZ 1YJNZ 1K731 3CCS1 1M902 1TWCI 4BY1I 3CD61 2PM9A 3CME1 4NB9A 3J7A4 4BY7I 1YUAA 5AN9F 2OTJ1 3Q87A 4E30A 3H0GI 1N2FA 3CCUZ 2JA8I 3I4NI 2QRCB 3FQMA 4NOZA 3GTJI 1YITZ 1RO0A 3FKII 3S1RI 1VQ5Z 2RPRA 3I55Z 5A2Qf 3CPWZ 1YJW1 2K3RA 3M4OI 4A3CI 3CCQZ 1ML8A 3CCM1 1Q822 1VQK1 3S17I 2AKLA 1VLAA 4NFRA 4A3BI 1ZH1A 1VQOZ 4DGLA 1M901 4EWCA 3VMGA 4MD9A 3HOYI 2JA7I 4RS4A 3EEDA 1S72Z 4A3II 3IF8A 1DL6A 4TNUA 2JUBA 3CCVZ 3J80b 1VQ71 1VQNZ 3VB9A 2JR6A 2M48A 3GTMI 4NBAA 1TWAI 1USPA 2KPIA 3CCEZ 1K732 1I50I 2E2HI 1RQFA 4MRIA 1WW9A 5CM2M 5C44I 4NBDA 3G6EZ 3K7AI 5FLXf 2EGTA 2OZKA 3CC7Z 1VQ9Z 1QVGZ 5IT9b 2QA41 3NDJA 1Q811 3J80f 5D1PA 1Q821 4E33A 1M1K1 3TDHB 3BG1B 4NBHA 1VQ4Z 4NB8A 5D1OB 5LL6f 3CC2Z 1YHQ1 3PO3S 3CCRZ 2ZAEB 3GKQA 3CCSZ 2E2II 4DQYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ Z;  2OTJ 1;  3CCL Z;  3CXC Y;  1N8R 1;  3CC4 1;  1K9M 2;  3CCU Z;  1YIT 1;  2OTJ Z;  3G71 1;  3I56 1;  3CC4 Z;  1YJ9 1;  3OW2 Y;  1YIT Z;  3I55 1;  3CXC Z;  3G71 Z;  1JJ2 Z;  1VQ5 Z;  1VQL 1;  3I55 Z;  1QVF Z;  3CCQ 1;  3CPW Z;  1YJW 1;  3CD6 Z;  1VQL Z;  3CME Z;  1Q7Y 2;  3CCQ Z;  1VQP 1;  1YJW Z;  3CCM 1;  1Q82 2;  1VQK 1;  1YI2 1;  2OTL 1;  1VQO 1;  1KC8 1;  3CCM Z;  1S72 1;  1VQ6 1;  1QVG Y;  1YI2 Z;  2QEX 1;  1YIJ 1;  2OTL Z;  1VQO Z;  1M90 1;  3I56 Z;  1YJ9 Z;  1S72 Z;  3CC7 1;  1W2B Y;  1KQS Y;  1VQ6 Z;  2QEX Z;  1YIJ Z;  3CCJ 1;  3CCV 1;  3OW2 Z;  1K8A 2;  1N8R 2;  1VQN 1;  1VQ8 1;  3CCJ Z;  3CCV Z;  1Q81 2;  1K9M 1;  1VQ7 1;  1VQN Z;  1YJN 1;  1M1K 2;  3CCE 1;  1VQP Z;  3CCR 1;  1VQ7 Z;  1VQK Z;  3CCE Z;  1K73 2;  3CMA 1;  3G6E 1;  1Q86 2;  1KD1 2;  3CCL 1;  1VQ9 1;  3CMA Z;  1NJI 2;  3G6E Z;  1K8A 1;  1Q7Y 1;  3CC7 Z;  1VQ9 Z;  1QVG Z;  1JJ2 Y;  2QA4 1;  1Q81 1;  1QVF Y;  1VQ4 1;  1Q82 1;  3CPW Y;  1W2B Z;  1KQS Z;  3G4S 1;  1KC8 2;  1VQ8 Z;  1VQ5 1;  1M1K 1;  2QA4 Z;  1VQ4 Z;  3CC2 1;  3G4S Z;  1YJN Z;  1K73 1;  3CCS 1;  1M90 2;  1VQM 1;  3CD6 1;  3CME 1;  1Q86 1;  1KD1 1;  3CC2 Z;  1YHQ 1;  3CCR Z;  3CCS Z;  1VQM Z;  1NJI 1;  3CCU 1; 
#chains in the Genus database with same CATH topology
 1YUK A;  5C3E I;  2OOX B;  3MON A;  3CC4 1;  2NVT I;  2R7Z I;  2QKD A;  1K9M 2;  3H3V J;  2R6M A;  2OTJ Z;  3G71 1;  2R92 I;  3QWU A;  3I56 1;  4NH1 C;  1YJ9 1;  4A3K I;  2Y0S A;  3NH4 A;  4A3E I;  4S1T A;  1Z03 A;  4E32 A;  5A2Q b;  3HOZ I;  1X3W A;  1Q7Y 2;  3HOU I;  1TWG I;  1VQP 1;  1YJW Z;  1USP B;  4RVG A;  4E31 A;  2JS4 A;  3TE5 B;  2O4H A;  3S2H I;  1YI2 1;  2OTL 1;  2LIY A;  3CCM Z;  1VQ6 1;  5C4J I;  2JIP A;  1Y1V I;  1YIJ 1;  3GCF A;  4E2Z A;  2W04 A;  4MD7 A;  1W2B Y;  1KQS Y;  3IR7 A;  2JIO A;  2VF1 A;  3OW2 Z;  4E2W A;  3JAM f;  1N8R 2;  2P28 A;  1QYP A;  1Q81 2;  1K9M 1;  2AYD A;  3S14 I;  5T6B A;  4A93 I;  1YJN 1;  2VPZ A;  1M1K 2;  3EER A;  5IP9 I;  2IZ3 A;  2Q4Z A;  3KIH A;  3F3P C;  4QTU A;  3CQZ I;  1RLY A;  1VQ7 Z;  2NVX I;  2NAP A;  1WII A;  3CMA 1;  3IFU A;  3GTM S;  4A3G I;  1P9N A;  4A3L I;  3J81 f;  5FLX b;  3BG0 B;  3NFZ A;  2Q51 A;  1K8A 1;  1Q7Y 1;  1SFO I;  2R93 I;  4XX2 A;  1NUI A;  2BJO A;  3CPW Y;  1KRL A;  1I3Q I;  2QLV B;  1L1O C;  1TFI A;  1VQ8 Z;  1VQ5 1;  1KC8 2;  2QA4 Z;  4MON A;  3KIF A;  4CL1 A;  4NBC A;  1VQM 1;  3U50 C;  2GTH A;  2GTI A;  1Q86 1;  1KD1 1;  2JIR A;  2DE5 A;  1YHQ Z;  3CCL Z;  2OOY B;  3CXC Y;  1N8R 1;  2PK7 A;  2JA6 I;  1RNI A;  5FLM I;  3M3Y I;  2RIQ A;  3I4M I;  2VPW A;  3IX0 A;  3CC4 Z;  1Z02 A;  4RVF A;  2YAD A;  2B63 I;  2QRE B;  2IZ4 A;  4NBE A;  3G71 Z;  4HGZ A;  1K83 I;  3S2D I;  1JJ2 Z;  4A3J I;  1VQL 1;  3S1Q I;  3I07 A;  1QVF Z;  3GTG I;  3CD6 Z;  2E2J I;  3CME Z;  2DE7 A;  1LQL A;  3HKZ A;  2JIM A;  1KC8 1;  4HH4 A;  2JIQ A;  1Y1W I;  3VMI A;  2NVQ I;  1QVG Y;  1YI2 Z;  2QEX 1;  2JA5 I;  2OTL Z;  2WAQ A;  3HOV I;  2RHB A;  2F4M A;  2H85 A;  2V8K A;  3CC7 1;  2G2K A;  1VQ6 Z;  1RO4 A;  3HOW I;  1YIJ Z;  3NDI A;  3NH5 A;  3CCJ 1;  2JNY A;  1Y1V S;  3RZO I;  5C4X I;  3JAM b;  3PO2 I;  3GTK I;  4DK1 A;  1K8A 2;  2F4O A;  3S16 I;  4QTT A;  3D2L A;  2KI7 B;  2DE6 A;  2K5R A;  3CCR 1;  3S1N I;  1VQK Z;  3FQQ A;  1TWH I;  1Q86 2;  1KD1 2;  4RVD A;  3F3F C;  3J81 b;  4MH4 A;  2NVY I;  3CMA Z;  2YU9 I;  3RZD I;  4RVH A;  1S7M A;  2E9H A;  1Z01 A;  1WZN A;  2M6N A;  3G4S 1;  4NBG A;  1FDI A;  4NBF A;  2LFU A;  4BBR I;  4A3F I;  2V8I A;  2RT9 A;  3VTN A;  2PMZ A;  2VUG A;  1VQM Z;  1NJI 1;  4BBS I;  3CCU 1;  5D1O A;  3MZL B;  3S1M I;  1QF8 A;  1YIT 1;  2VPX A;  2QR1 B;  1TWF I;  3OW2 Y;  5T64 A;  3I55 1;  4Y7N I;  3CXC Z;  1JWH C;  2RBL A;  3CCQ 1;  1VQL Z;  1ZB8 A;  4RV9 A;  1WCM I;  1PFT A;  3GTQ I;  3GTL I;  2HF1 A;  1R9T I;  1VQO 1;  1I6H I;  1S72 1;  2V8J A;  4NBB A;  4AYB A;  4MXU A;  4X6A I;  5IP7 I;  3D6W A;  3ESW A;  3I56 Z;  1YJ9 Z;  2P3Y A;  3D9X A;  2QRD B;  3MZK B;  2QEX Z;  3CCV 1;  3GTO I;  3VMH A;  3T4N B;  1RO2 A;  4A3D I;  1VQN 1;  1VQ8 1;  3CCJ Z;  4MD8 A;  2LEX A;  2HU9 A;  3CCE 1;  1NP6 A;  1VQP Z;  4E2X A;  2IV2 X;  3S15 I;  3NH8 A;  2J6A A;  3GTP I;  4Y52 I;  3G6E 1;  3CCL 1;  2GU2 A;  2O53 A;  5T67 A;  1X0T A;  1VQ9 1;  4E2Y A;  1NJI 2;  1FDO A;  2WB1 A;  3HOX I;  3P5J B;  1X3Z A;  4HGY A;  1Y8C A;  2JMO A;  1JJ2 Y;  2VUM I;  5IT9 f;  1QVF Y;  4A3M I;  1VQ4 1;  2E7Z A;  2W03 A;  1W2B Z;  1KQS Z;  4BXX I;  3PO3 I;  2I3C A;  1ZB9 A;  3CC2 1;  3LUS A;  3G4S Z;  1YJN Z;  1K73 1;  3CCS 1;  1M90 2;  1TWC I;  4BY1 I;  3CD6 1;  2PM9 A;  3CME 1;  1AA6 A;  4NB9 A;  3J7A 4;  4BY7 I;  1YUA A;  5AN9 F;  2OTJ 1;  3Q87 A;  4E30 A;  3H0G I;  1N2F A;  3CCU Z;  2JA8 I;  3I4N I;  1Q16 A;  2QRC B;  3FQM A;  4NOZ A;  3GTJ I;  1YIT Z;  1RO0 A;  3FKI I;  3S1R I;  2V45 A;  1VQ5 Z;  2RPR A;  3I55 Z;  5A2Q f;  3CPW Z;  1YJW 1;  2K3R A;  3M4O I;  4A3C I;  3CCQ Z;  1ML8 A;  3CCM 1;  1Q82 2;  1VQK 1;  2VPY A;  3S17 I;  2AKL A;  1VLA A;  4NFR A;  4A3B I;  2V3V A;  1ZH1 A;  1VQO Z;  4DGL A;  1M90 1;  4EWC A;  3VMG A;  4MD9 A;  3HOY I;  2JA7 I;  4RS4 A;  3EED A;  1S72 Z;  4A3I I;  3IF8 A;  1DL6 A;  4TNU A;  2JUB A;  1WJ2 A;  3CCV Z;  3J80 b;  1VQ7 1;  1VQN Z;  3VB9 A;  2JR6 A;  2M48 A;  3GTM I;  4NBA A;  1TWA I;  1USP A;  2KPI A;  3CCE Z;  1K73 2;  1I50 I;  2E2H I;  1RQF A;  4MRI A;  1WW9 A;  5CM2 M;  5C44 I;  4NBD A;  3G6E Z;  3K7A I;  5FLX f;  2EGT A;  2OZK A;  3CC7 Z;  1VQ9 Z;  1QVG Z;  5IT9 b;  2QA4 1;  3NDJ A;  1Q81 1;  3J80 f;  5D1P A;  1Q82 1;  4E33 A;  1M1K 1;  3TDH B;  3BG1 B;  4NBH A;  1VQ4 Z;  1SIW A;  4NB8 A;  5D1O B;  5LL6 f;  3CC2 Z;  1YHQ 1;  3PO3 S;  3CCR Z;  2ZAE B;  3GKQ A;  3CCS Z;  1QXF A;  2E2I I;  4DQY B; 
#chains in the Genus database with same CATH homology
 1YUK A;  5C3E I;  2OOX B;  3MON A;  3CC4 1;  2NVT I;  2R7Z I;  2QKD A;  1K9M 2;  3H3V J;  2R6M A;  2OTJ Z;  3G71 1;  2R92 I;  3QWU A;  3I56 1;  4NH1 C;  1YJ9 1;  4A3K I;  2Y0S A;  3NH4 A;  4A3E I;  4S1T A;  1Z03 A;  4E32 A;  5A2Q b;  3HOZ I;  1X3W A;  1Q7Y 2;  3HOU I;  1TWG I;  1VQP 1;  1YJW Z;  1USP B;  4RVG A;  4E31 A;  2JS4 A;  3TE5 B;  2O4H A;  3S2H I;  1YI2 1;  2OTL 1;  2LIY A;  3CCM Z;  1VQ6 1;  5C4J I;  1Y1V I;  1YIJ 1;  3GCF A;  4E2Z A;  2W04 A;  4MD7 A;  1W2B Y;  1KQS Y;  2VF1 A;  3OW2 Z;  4E2W A;  3JAM f;  1N8R 2;  2P28 A;  1QYP A;  1Q81 2;  1K9M 1;  3S14 I;  5T6B A;  4A93 I;  1YJN 1;  1M1K 2;  3EER A;  5IP9 I;  2IZ3 A;  2Q4Z A;  3KIH A;  3F3P C;  4QTU A;  3CQZ I;  1RLY A;  1VQ7 Z;  2NVX I;  3CMA 1;  1WII A;  3IFU A;  3GTM S;  4A3G I;  1P9N A;  4A3L I;  3J81 f;  5FLX b;  3BG0 B;  3NFZ A;  2Q51 A;  1K8A 1;  1Q7Y 1;  1SFO I;  2R93 I;  4XX2 A;  1NUI A;  2BJO A;  3CPW Y;  1KRL A;  1I3Q I;  2QLV B;  1L1O C;  1TFI A;  1VQ8 Z;  1VQ5 1;  1KC8 2;  2QA4 Z;  4MON A;  3KIF A;  4CL1 A;  4NBC A;  1VQM 1;  3U50 C;  2GTH A;  2GTI A;  1Q86 1;  1KD1 1;  2DE5 A;  1YHQ Z;  3CCL Z;  2OOY B;  3CXC Y;  1N8R 1;  2PK7 A;  2JA6 I;  1RNI A;  5FLM I;  3M3Y I;  2RIQ A;  3I4M I;  3IX0 A;  3CC4 Z;  1Z02 A;  4RVF A;  2YAD A;  2B63 I;  2QRE B;  2IZ4 A;  4NBE A;  3G71 Z;  4HGZ A;  1K83 I;  3S2D I;  1JJ2 Z;  4A3J I;  1VQL 1;  3S1Q I;  3I07 A;  1QVF Z;  3GTG I;  3CD6 Z;  2E2J I;  3CME Z;  2DE7 A;  1LQL A;  3HKZ A;  1KC8 1;  4HH4 A;  1Y1W I;  3VMI A;  2NVQ I;  1QVG Y;  1YI2 Z;  2QEX 1;  2JA5 I;  2OTL Z;  2WAQ A;  3HOV I;  2RHB A;  2F4M A;  2H85 A;  2V8K A;  3CC7 1;  2G2K A;  1VQ6 Z;  1RO4 A;  3HOW I;  1YIJ Z;  3NDI A;  3NH5 A;  3CCJ 1;  2JNY A;  1Y1V S;  3RZO I;  5C4X I;  3JAM b;  3PO2 I;  3GTK I;  4DK1 A;  1K8A 2;  2F4O A;  3S16 I;  4QTT A;  2KI7 B;  2DE6 A;  2K5R A;  3CCR 1;  3S1N I;  1VQK Z;  3FQQ A;  1TWH I;  1Q86 2;  1KD1 2;  4RVD A;  3F3F C;  3J81 b;  4MH4 A;  2NVY I;  3CMA Z;  2YU9 I;  3RZD I;  4RVH A;  1S7M A;  2E9H A;  1Z01 A;  2M6N A;  3G4S 1;  4NBG A;  4NBF A;  2LFU A;  4BBR I;  4A3F I;  2V8I A;  2RT9 A;  3VTN A;  2PMZ A;  2VUG A;  1VQM Z;  1NJI 1;  4BBS I;  3CCU 1;  5D1O A;  3MZL B;  3S1M I;  1QF8 A;  1YIT 1;  2QR1 B;  1TWF I;  3OW2 Y;  5T64 A;  3I55 1;  4Y7N I;  3CXC Z;  1JWH C;  2RBL A;  3CCQ 1;  1VQL Z;  1ZB8 A;  4RV9 A;  1WCM I;  1PFT A;  3GTQ I;  3GTL I;  2HF1 A;  1R9T I;  1VQO 1;  1I6H I;  1S72 1;  2V8J A;  4NBB A;  4AYB A;  4MXU A;  4X6A I;  5IP7 I;  3D6W A;  3ESW A;  3I56 Z;  1YJ9 Z;  2P3Y A;  3D9X A;  2QRD B;  3MZK B;  2QEX Z;  3CCV 1;  3GTO I;  3VMH A;  3T4N B;  1RO2 A;  4A3D I;  1VQN 1;  1VQ8 1;  3CCJ Z;  4MD8 A;  2HU9 A;  3CCE 1;  1NP6 A;  1VQP Z;  4E2X A;  3S15 I;  3NH8 A;  2J6A A;  3GTP I;  4Y52 I;  3G6E 1;  3CCL 1;  2GU2 A;  2O53 A;  5T67 A;  1X0T A;  1VQ9 1;  4E2Y A;  1NJI 2;  2WB1 A;  3HOX I;  3P5J B;  1X3Z A;  4HGY A;  2JMO A;  1JJ2 Y;  2VUM I;  5IT9 f;  1QVF Y;  4A3M I;  1VQ4 1;  2W03 A;  1W2B Z;  1KQS Z;  4BXX I;  3PO3 I;  2I3C A;  1ZB9 A;  3CC2 1;  3LUS A;  3G4S Z;  1YJN Z;  1K73 1;  3CCS 1;  1M90 2;  1TWC I;  4BY1 I;  3CD6 1;  2PM9 A;  3CME 1;  4NB9 A;  3J7A 4;  4BY7 I;  1YUA A;  5AN9 F;  2OTJ 1;  3Q87 A;  4E30 A;  3H0G I;  1N2F A;  3CCU Z;  2JA8 I;  3I4N I;  2QRC B;  3FQM A;  4NOZ A;  3GTJ I;  1YIT Z;  1RO0 A;  3FKI I;  3S1R I;  1VQ5 Z;  2RPR A;  3I55 Z;  5A2Q f;  3CPW Z;  1YJW 1;  2K3R A;  3M4O I;  4A3C I;  3CCQ Z;  1ML8 A;  3CCM 1;  1Q82 2;  1VQK 1;  3S17 I;  2AKL A;  1VLA A;  4NFR A;  4A3B I;  1ZH1 A;  1VQO Z;  4DGL A;  1M90 1;  4EWC A;  3VMG A;  4MD9 A;  3HOY I;  2JA7 I;  4RS4 A;  3EED A;  1S72 Z;  4A3I I;  3IF8 A;  1DL6 A;  4TNU A;  2JUB A;  3CCV Z;  3J80 b;  1VQ7 1;  1VQN Z;  3VB9 A;  2JR6 A;  2M48 A;  3GTM I;  4NBA A;  1TWA I;  1USP A;  2KPI A;  3CCE Z;  1K73 2;  1I50 I;  2E2H I;  1RQF A;  4MRI A;  1WW9 A;  5CM2 M;  5C44 I;  4NBD A;  3G6E Z;  3K7A I;  5FLX f;  2EGT A;  2OZK A;  3CC7 Z;  1VQ9 Z;  1QVG Z;  5IT9 b;  2QA4 1;  3NDJ A;  1Q81 1;  3J80 f;  5D1P A;  1Q82 1;  4E33 A;  1M1K 1;  3TDH B;  3BG1 B;  4NBH A;  1VQ4 Z;  4NB8 A;  5D1O B;  5LL6 f;  3CC2 Z;  1YHQ 1;  3PO3 S;  3CCR Z;  2ZAE B;  3GKQ A;  3CCS Z;  2E2I I;  4DQY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...