2QREB

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-d-ribofuranotide (zmp)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
91
structure length
85
Chain Sequence
QYSTEIPAFLTSLQELKLPKPPSLPPHLEKCILNSNTDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 3
structure length 85
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qreB01
2OOYB 2QR1B 2QRCB 3TDHB 2QRDB 3T4NB 2OOXB 3TE5B 2QLVB 2QREB
chains in the Genus database with same CATH superfamily
2QA41 1VQMZ 2JIPA 2BJOA 2Q51A 2JIOA 2QKDA 2B63I 1QVFZ 4E32A 3VMHA 2P28A 3IF8A 3VB9A 1M1K2 1M1K1 3J81b 4NBAA 3PO2I 2RIQA 3K7AI 3S2DI 2E9HA 3GTJI 1YUAA 1K8A2 2Y0SA 3CXCZ 1K8A1 3P5JB 3GTOI 1USPA 4NBHA 3J81f 1ZH1A 1Q821 4NBFA 3QWUA 1VQO1 1K9M1 2V3VA 4NFRA 4MONA 3U50C 3GTKI 3NH8A 1Q16A 1YITZ 2E2HI 1NJI1 1VLAA 3CD6Z 3PO3S 2ZAEB 3CC71 2YU9I 1VQKZ 4QTUA 3BG1B 2M48A 1YJWZ 3CME1 1VQ6Z 1L1OC 4RS4A 4A3MI 4RVGA 1VQ5Z 3CC2Z 3CCJ1 3CCE1 3MZKB 3HOUI 1WW9A 2OTJ1 1W2BY 1RO4A 2VPXA 5CM2M 3HOYI 2F4MA 1WZNA 2JA6I 5C44I 1I50I 2OTLZ 2OZKA 2IZ3A 2M6NA 1TWAI 5D1OB 3D9XA 5C4XI 1JJ2Y 2QA4Z 3TE5B 5T64A 3G711 1YJN1 1VQ81 3TDHB 2HU9A 3KIFA 3CCQ1 3CCR1 4RVHA 4E33A 4MD9A 3G4S1 3CMA1 3GTPI 1TWHI 1KRLA 4A93I 2YADA 2F4OA 2WAQA 5D1PA 2JA8I 3GTMS 1Z01A 4A3LI 5A2Qb 2VPZA 3S1NI 4HH4A 1VQOZ 2KI7B 4E2YA 2WB1A 2J6AA 5A2Qf 2JS4A 1W2BZ 1QYPA 4BXXI 2VPWA 2JIQA 3CC7Z 2NVTI 1RQFA 5IT9b 1M902 5T6BA 3CMEZ 1Q812 1JJ2Z 3M4OI 3CC41 3H0GI 1Y1VS 3HKZA 1Y8CA 3CCJZ 3CCEZ 3NH5A 5IT9f 2OTJZ 2QRCB 1X3ZA 1Z02A 1RO0A 2R93I 1X3WA 1WJ2A 1YJNZ 3IX0A 3G71Z 1VQ8Z 3Q87A 2LEXA 3CCQZ 3S15I 3CCRZ 1Q862 1Z03A 3G4SZ 4A3EI 1YIJZ 4NB9A 3CMAZ 1VQ91 3NFZA 4Y7NI 1ZB8A 1K732 2O53A 1I6HI 1P9NA 3MZLB 4A3GI 3ESWA 2V8IA 4XX2A 2V8JA 4CL1A 1VQN1 2Q4ZA 3CPWZ 4A3KI 2DE6A 3HOXI 2RHBA 1TWGI 4Y52I 3IFUA 5FLXb 1RLYA 1NP6A 1WCMI 1VQ41 2O4HA 2W03A 3S16I 2RT9A 3GCFA 3CCS1 2EGTA 1SFOI 4NBDA 4MD8A 5FLXf 3GTLI 1S7MA 1SIWA 1N8R2 1N8R1 2GU2A 4A3BI 5C3EI 3CC4Z 2JUBA 1TWCI 2NVXI 1KD12 1FDIA 4RV9A 4A3DI 5IP9I 4MH4A 4A3FI 2QLVB 1TWFI 2DE7A 3CCL1 3I4NI 1DL6A 2R7ZI 5FLMI 1VQ9Z 1Q7Y2 2G2KA 2QREB 1Q7Y1 4NH1C 1YIJ1 3S17I 4NBCA 2AYDA 3HOVI 4BY7I 2LFUA 1ML8A 1WIIA 1VQNZ 4HGYA 3NDJA 3GTGI 1KQSY 1JWHC 4A3II 1I3QI 1VQ4Z 2AKLA 2LIYA 1PFTA 4BBSI 2K3RA 1VQP1 3CCSZ 4BBRI 1QVGY 2JA7I 3I4MI 4QTTA 2R6MA 5C4JI 5LL6f 2GTIA 3J7A4 3M3YI 3CCV1 4HGZA 1M901 3VMGA 4AYBA 2P3YA 3S14I 2V45A 1Q811 1S721 4S1TA 2NVQI 2PM9A 2R92I 2KPIA 4E31A 4E2WA 3I55Z 3G6E1 3CCLZ 3I561 1KQSZ 2JMOA 3VTNA 1QF8A 2JNYA 4TNUA 1Y1WI 1VQ71 1Q861 3CCU1 1TFIA 1ZB9A 2V8KA 2VUGA 1K731 3CCM1 1KC82 1KC81 3HOZI 3FKII 1YI21 3JAMb 4NBEA 1QVGZ 2QR1B 5IP7I 3S1QI 3LUSA 3RZOI 1FDOA 2E7ZA 2JIMA 4MRIA 3H3VJ 1X0TA 3FQQA 2NAPA 1VQPZ 1YJ9Z 3S1RI 1LQLA 3F3PC 1N2FA 4RVDA 2JR6A 3NDIA 3CCVZ 1K83I 4BY1I 2PK7A 3T4NB 1S72Z 3OW2Y 1KD11 5D1OA 4DK1A 4A3JI 2DE5A 2QEX1 1Q822 1R9TI 3PO3I 2QRDB 1K9M2 3G6EZ 1VQL1 3I551 3I56Z 1NJI2 1VQ7Z 2VF1A 4X6AI 1USPB 3F3FC 3CCUZ 4NBBA 2HF1A 2OOXB 2IV2X 3CCMZ 1YUKA 3J80b 1YI2Z 4E30A 3GTQI 3EERA 2VUMI 1NUIA 3FQMA 3J80f 4A3CI 1RNIA 5AN9F 1YHQ1 3EEDA 2JIRA 3OW2Z 3IR7A 2JA5I 1YJ91 1VQM1 3GKQA 2E2II 3BG0B 3GTMI 2NVYI 2GTHA 2RPRA 3MONA 1QXFA 4RVFA 3KIHA 3D6WA 3S2HI 3D2LA 2OOYB 2QEXZ 4MXUA 1QVFY 4NBGA 1VQLZ 4E2XA 4MD7A 4NB8A 4EWCA 3CPWY 1Y1VI 3VMIA 4NOZA 2K5RA 2H85A 1YIT1 3CXCY 4E2ZA 3CD61 4DGLA 3NH4A 4DQYB 1RO2A 1VQK1 2VPYA 2I3CA 1AA6A 3S1MI 1YJW1 1VQ61 2IZ4A 3CQZI 2E2JI 3I07A 1VQ51 3CC21 5T67A 3HOWI 2OTL1 3JAMf 2RBLA 3RZDI 2W04A 1YHQZ 2PMZA
chains in the Genus database with same CATH topology
2QA41 1VQMZ 2BJOA 2Q51A 2QKDA 2B63I 1QVFZ 4E32A 3VMHA 2P28A 3IF8A 3VB9A 1M1K2 1M1K1 3J81b 4NBAA 3PO2I 2RIQA 3K7AI 3S2DI 2E9HA 3GTJI 1YUAA 1K8A2 2Y0SA 3CXCZ 1K8A1 3P5JB 3GTOI 1USPA 4NBHA 3J81f 1ZH1A 1Q821 4NBFA 3QWUA 1VQO1 1K9M1 4NFRA 4MONA 3U50C 3GTKI 3NH8A 1YITZ 2E2HI 1NJI1 1VLAA 3CD6Z 3PO3S 2ZAEB 3CC71 2YU9I 1VQKZ 4QTUA 3BG1B 2M48A 1YJWZ 3CME1 1VQ6Z 1L1OC 4RS4A 4A3MI 4RVGA 1VQ5Z 3CC2Z 3CCJ1 3CCE1 3MZKB 3HOUI 1WW9A 2OTJ1 1W2BY 1RO4A 5CM2M 3HOYI 2F4MA 2JA6I 5C44I 1I50I 2OTLZ 2OZKA 2IZ3A 2M6NA 1TWAI 5D1OB 3D9XA 5C4XI 1JJ2Y 2QA4Z 3TE5B 5T64A 3G711 1YJN1 1VQ81 3TDHB 2HU9A 3KIFA 3CCQ1 3CCR1 4RVHA 4E33A 4MD9A 3G4S1 3CMA1 3GTPI 1TWHI 1KRLA 4A93I 2YADA 2F4OA 2WAQA 5D1PA 2JA8I 3GTMS 1Z01A 4A3LI 5A2Qb 3S1NI 4HH4A 1VQOZ 2KI7B 4E2YA 2WB1A 2J6AA 5A2Qf 2JS4A 1W2BZ 1QYPA 4BXXI 3CC7Z 2NVTI 1RQFA 5IT9b 1M902 5T6BA 3CMEZ 1Q812 1JJ2Z 3M4OI 3CC41 3H0GI 1Y1VS 3HKZA 3CCJZ 3CCEZ 3NH5A 5IT9f 2OTJZ 2QRCB 1X3ZA 1Z02A 1RO0A 2R93I 1X3WA 1YJNZ 3IX0A 3G71Z 1VQ8Z 3Q87A 3CCQZ 3S15I 3CCRZ 1Q862 1Z03A 3G4SZ 4A3EI 1YIJZ 4NB9A 3CMAZ 1VQ91 3NFZA 4Y7NI 1ZB8A 1K732 2O53A 1I6HI 1P9NA 3MZLB 4A3GI 3ESWA 2V8IA 4XX2A 2V8JA 4CL1A 1VQN1 2Q4ZA 3CPWZ 4A3KI 2DE6A 3HOXI 2RHBA 1TWGI 4Y52I 3IFUA 5FLXb 1RLYA 1NP6A 1WCMI 1VQ41 2O4HA 2W03A 3S16I 2RT9A 3GCFA 3CCS1 2EGTA 1SFOI 4NBDA 4MD8A 5FLXf 3GTLI 1S7MA 1N8R2 1N8R1 2GU2A 4A3BI 5C3EI 3CC4Z 2JUBA 1TWCI 2NVXI 1KD12 4RV9A 4A3DI 5IP9I 4MH4A 4A3FI 2QLVB 1TWFI 2DE7A 3CCL1 3I4NI 1DL6A 2R7ZI 5FLMI 1VQ9Z 1Q7Y2 2G2KA 2QREB 1Q7Y1 4NH1C 1YIJ1 3S17I 4NBCA 3HOVI 4BY7I 2LFUA 1ML8A 1WIIA 1VQNZ 4HGYA 3NDJA 3GTGI 1KQSY 1JWHC 4A3II 1I3QI 1VQ4Z 2AKLA 2LIYA 1PFTA 4BBSI 2K3RA 1VQP1 3CCSZ 4BBRI 1QVGY 2JA7I 3I4MI 4QTTA 2R6MA 5C4JI 5LL6f 2GTIA 3J7A4 3M3YI 3CCV1 4HGZA 1M901 3VMGA 4AYBA 2P3YA 3S14I 1Q811 1S721 4S1TA 2NVQI 2PM9A 2R92I 2KPIA 4E31A 4E2WA 3I55Z 3G6E1 3CCLZ 3I561 1KQSZ 2JMOA 3VTNA 1QF8A 2JNYA 4TNUA 1Y1WI 1VQ71 1Q861 3CCU1 1TFIA 1ZB9A 2V8KA 2VUGA 1K731 3CCM1 1KC82 1KC81 3HOZI 3FKII 1YI21 3JAMb 4NBEA 1QVGZ 2QR1B 5IP7I 3S1QI 3LUSA 3RZOI 4MRIA 3H3VJ 1X0TA 3FQQA 1VQPZ 1YJ9Z 3S1RI 1LQLA 3F3PC 1N2FA 4RVDA 2JR6A 3NDIA 3CCVZ 1K83I 4BY1I 2PK7A 3T4NB 1S72Z 3OW2Y 1KD11 5D1OA 4DK1A 4A3JI 2DE5A 2QEX1 1Q822 1R9TI 3PO3I 2QRDB 1K9M2 3G6EZ 1VQL1 3I551 3I56Z 1NJI2 1VQ7Z 2VF1A 4X6AI 1USPB 3F3FC 3CCUZ 4NBBA 2HF1A 2OOXB 3CCMZ 1YUKA 3J80b 1YI2Z 4E30A 3GTQI 3EERA 2VUMI 1NUIA 3FQMA 3J80f 4A3CI 1RNIA 5AN9F 1YHQ1 3EEDA 3OW2Z 2JA5I 1YJ91 1VQM1 3GKQA 2E2II 3BG0B 3GTMI 2NVYI 2GTHA 2RPRA 3MONA 4RVFA 3KIHA 3D6WA 3S2HI 2OOYB 2QEXZ 4MXUA 1QVFY 4NBGA 1VQLZ 4E2XA 4MD7A 4NB8A 4EWCA 3CPWY 1Y1VI 3VMIA 4NOZA 2K5RA 2H85A 1YIT1 3CXCY 4E2ZA 3CD61 4DGLA 3NH4A 4DQYB 1RO2A 1VQK1 2I3CA 3S1MI 1YJW1 1VQ61 2IZ4A 3CQZI 2E2JI 3I07A 1VQ51 3CC21 5T67A 3HOWI 2OTL1 3JAMf 2RBLA 3RZDI 2W04A 1YHQZ 2PMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOY B;  2QR1 B;  2QRC B;  3TDH B;  2QRD B;  3T4N B;  2OOX B;  3TE5 B;  2QLV B;  2QRE B; 
#chains in the Genus database with same CATH topology
 2QA4 1;  1VQM Z;  2JIP A;  2BJO A;  2Q51 A;  2JIO A;  2QKD A;  2B63 I;  1QVF Z;  4E32 A;  3VMH A;  2P28 A;  3IF8 A;  3VB9 A;  1M1K 2;  1M1K 1;  3J81 b;  4NBA A;  3PO2 I;  2RIQ A;  3K7A I;  3S2D I;  2E9H A;  3GTJ I;  1YUA A;  1K8A 2;  2Y0S A;  3CXC Z;  1K8A 1;  3P5J B;  3GTO I;  1USP A;  4NBH A;  3J81 f;  1ZH1 A;  1Q82 1;  4NBF A;  3QWU A;  1VQO 1;  1K9M 1;  2V3V A;  4NFR A;  4MON A;  3U50 C;  3GTK I;  3NH8 A;  1Q16 A;  1YIT Z;  2E2H I;  1NJI 1;  1VLA A;  3CD6 Z;  3PO3 S;  2ZAE B;  3CC7 1;  2YU9 I;  1VQK Z;  4QTU A;  3BG1 B;  2M48 A;  1YJW Z;  3CME 1;  1VQ6 Z;  1L1O C;  4RS4 A;  4A3M I;  4RVG A;  1VQ5 Z;  3CC2 Z;  3CCJ 1;  3CCE 1;  3MZK B;  3HOU I;  1WW9 A;  2OTJ 1;  1W2B Y;  1RO4 A;  2VPX A;  5CM2 M;  3HOY I;  2F4M A;  1WZN A;  2JA6 I;  5C44 I;  1I50 I;  2OTL Z;  2OZK A;  2IZ3 A;  2M6N A;  1TWA I;  5D1O B;  3D9X A;  5C4X I;  1JJ2 Y;  2QA4 Z;  3TE5 B;  5T64 A;  3G71 1;  1YJN 1;  1VQ8 1;  3TDH B;  2HU9 A;  3KIF A;  3CCQ 1;  3CCR 1;  4RVH A;  4E33 A;  4MD9 A;  3G4S 1;  3CMA 1;  3GTP I;  1TWH I;  1KRL A;  4A93 I;  2YAD A;  2F4O A;  2WAQ A;  5D1P A;  2JA8 I;  3GTM S;  1Z01 A;  4A3L I;  5A2Q b;  2VPZ A;  3S1N I;  4HH4 A;  1VQO Z;  2KI7 B;  4E2Y A;  2WB1 A;  2J6A A;  5A2Q f;  2JS4 A;  1W2B Z;  1QYP A;  4BXX I;  2VPW A;  2JIQ A;  3CC7 Z;  2NVT I;  1RQF A;  5IT9 b;  1M90 2;  5T6B A;  3CME Z;  1Q81 2;  1JJ2 Z;  3M4O I;  3CC4 1;  3H0G I;  1Y1V S;  3HKZ A;  1Y8C A;  3CCJ Z;  3CCE Z;  3NH5 A;  5IT9 f;  2OTJ Z;  2QRC B;  1X3Z A;  1Z02 A;  1RO0 A;  2R93 I;  1X3W A;  1WJ2 A;  1YJN Z;  3IX0 A;  3G71 Z;  1VQ8 Z;  3Q87 A;  2LEX A;  3CCQ Z;  3S15 I;  3CCR Z;  1Q86 2;  1Z03 A;  3G4S Z;  4A3E I;  1YIJ Z;  4NB9 A;  3CMA Z;  1VQ9 1;  3NFZ A;  4Y7N I;  1ZB8 A;  1K73 2;  2O53 A;  1I6H I;  1P9N A;  3MZL B;  4A3G I;  3ESW A;  2V8I A;  4XX2 A;  2V8J A;  4CL1 A;  1VQN 1;  2Q4Z A;  3CPW Z;  4A3K I;  2DE6 A;  3HOX I;  2RHB A;  1TWG I;  4Y52 I;  3IFU A;  5FLX b;  1RLY A;  1NP6 A;  1WCM I;  1VQ4 1;  2O4H A;  2W03 A;  3S16 I;  2RT9 A;  3GCF A;  3CCS 1;  2EGT A;  1SFO I;  4NBD A;  4MD8 A;  5FLX f;  3GTL I;  1S7M A;  1SIW A;  1N8R 2;  1N8R 1;  2GU2 A;  4A3B I;  5C3E I;  3CC4 Z;  2JUB A;  1TWC I;  2NVX I;  1KD1 2;  1FDI A;  4RV9 A;  4A3D I;  5IP9 I;  4MH4 A;  4A3F I;  2QLV B;  1TWF I;  2DE7 A;  3CCL 1;  3I4N I;  1DL6 A;  2R7Z I;  5FLM I;  1VQ9 Z;  1Q7Y 2;  2G2K A;  2QRE B;  1Q7Y 1;  4NH1 C;  1YIJ 1;  3S17 I;  4NBC A;  2AYD A;  3HOV I;  4BY7 I;  2LFU A;  1ML8 A;  1WII A;  1VQN Z;  4HGY A;  3NDJ A;  3GTG I;  1KQS Y;  1JWH C;  4A3I I;  1I3Q I;  1VQ4 Z;  2AKL A;  2LIY A;  1PFT A;  4BBS I;  2K3R A;  1VQP 1;  3CCS Z;  4BBR I;  1QVG Y;  2JA7 I;  3I4M I;  4QTT A;  2R6M A;  5C4J I;  5LL6 f;  2GTI A;  3J7A 4;  3M3Y I;  3CCV 1;  4HGZ A;  1M90 1;  3VMG A;  4AYB A;  2P3Y A;  3S14 I;  2V45 A;  1Q81 1;  1S72 1;  4S1T A;  2NVQ I;  2PM9 A;  2R92 I;  2KPI A;  4E31 A;  4E2W A;  3I55 Z;  3G6E 1;  3CCL Z;  3I56 1;  1KQS Z;  2JMO A;  3VTN A;  1QF8 A;  2JNY A;  4TNU A;  1Y1W I;  1VQ7 1;  1Q86 1;  3CCU 1;  1TFI A;  1ZB9 A;  2V8K A;  2VUG A;  1K73 1;  3CCM 1;  1KC8 2;  1KC8 1;  3HOZ I;  3FKI I;  1YI2 1;  3JAM b;  4NBE A;  1QVG Z;  2QR1 B;  5IP7 I;  3S1Q I;  3LUS A;  3RZO I;  1FDO A;  2E7Z A;  2JIM A;  4MRI A;  3H3V J;  1X0T A;  3FQQ A;  2NAP A;  1VQP Z;  1YJ9 Z;  3S1R I;  1LQL A;  3F3P C;  1N2F A;  4RVD A;  2JR6 A;  3NDI A;  3CCV Z;  1K83 I;  4BY1 I;  2PK7 A;  3T4N B;  1S72 Z;  3OW2 Y;  1KD1 1;  5D1O A;  4DK1 A;  4A3J I;  2DE5 A;  2QEX 1;  1Q82 2;  1R9T I;  3PO3 I;  2QRD B;  1K9M 2;  3G6E Z;  1VQL 1;  3I55 1;  3I56 Z;  1NJI 2;  1VQ7 Z;  2VF1 A;  4X6A I;  1USP B;  3F3F C;  3CCU Z;  4NBB A;  2HF1 A;  2OOX B;  2IV2 X;  3CCM Z;  1YUK A;  3J80 b;  1YI2 Z;  4E30 A;  3GTQ I;  3EER A;  2VUM I;  1NUI A;  3FQM A;  3J80 f;  4A3C I;  1RNI A;  5AN9 F;  1YHQ 1;  3EED A;  2JIR A;  3OW2 Z;  3IR7 A;  2JA5 I;  1YJ9 1;  1VQM 1;  3GKQ A;  2E2I I;  3BG0 B;  3GTM I;  2NVY I;  2GTH A;  2RPR A;  3MON A;  1QXF A;  4RVF A;  3KIH A;  3D6W A;  3S2H I;  3D2L A;  2OOY B;  2QEX Z;  4MXU A;  1QVF Y;  4NBG A;  1VQL Z;  4E2X A;  4MD7 A;  4NB8 A;  4EWC A;  3CPW Y;  1Y1V I;  3VMI A;  4NOZ A;  2K5R A;  2H85 A;  1YIT 1;  3CXC Y;  4E2Z A;  3CD6 1;  4DGL A;  3NH4 A;  4DQY B;  1RO2 A;  1VQK 1;  2VPY A;  2I3C A;  1AA6 A;  3S1M I;  1YJW 1;  1VQ6 1;  2IZ4 A;  3CQZ I;  2E2J I;  3I07 A;  1VQ5 1;  3CC2 1;  5T67 A;  3HOW I;  2OTL 1;  3JAM f;  2RBL A;  3RZD I;  2W04 A;  1YHQ Z;  2PMZ A; 
#chains in the Genus database with same CATH homology
 2QA4 1;  1VQM Z;  2BJO A;  2Q51 A;  2QKD A;  2B63 I;  1QVF Z;  4E32 A;  3VMH A;  2P28 A;  3IF8 A;  3VB9 A;  1M1K 2;  1M1K 1;  3J81 b;  4NBA A;  3PO2 I;  2RIQ A;  3K7A I;  3S2D I;  2E9H A;  3GTJ I;  1YUA A;  1K8A 2;  2Y0S A;  3CXC Z;  1K8A 1;  3P5J B;  3GTO I;  1USP A;  4NBH A;  3J81 f;  1ZH1 A;  1Q82 1;  4NBF A;  3QWU A;  1VQO 1;  1K9M 1;  4NFR A;  4MON A;  3U50 C;  3GTK I;  3NH8 A;  1YIT Z;  2E2H I;  1NJI 1;  1VLA A;  3CD6 Z;  3PO3 S;  2ZAE B;  3CC7 1;  2YU9 I;  1VQK Z;  4QTU A;  3BG1 B;  2M48 A;  1YJW Z;  3CME 1;  1VQ6 Z;  1L1O C;  4RS4 A;  4A3M I;  4RVG A;  1VQ5 Z;  3CC2 Z;  3CCJ 1;  3CCE 1;  3MZK B;  3HOU I;  1WW9 A;  2OTJ 1;  1W2B Y;  1RO4 A;  5CM2 M;  3HOY I;  2F4M A;  2JA6 I;  5C44 I;  1I50 I;  2OTL Z;  2OZK A;  2IZ3 A;  2M6N A;  1TWA I;  5D1O B;  3D9X A;  5C4X I;  1JJ2 Y;  2QA4 Z;  3TE5 B;  5T64 A;  3G71 1;  1YJN 1;  1VQ8 1;  3TDH B;  2HU9 A;  3KIF A;  3CCQ 1;  3CCR 1;  4RVH A;  4E33 A;  4MD9 A;  3G4S 1;  3CMA 1;  3GTP I;  1TWH I;  1KRL A;  4A93 I;  2YAD A;  2F4O A;  2WAQ A;  5D1P A;  2JA8 I;  3GTM S;  1Z01 A;  4A3L I;  5A2Q b;  3S1N I;  4HH4 A;  1VQO Z;  2KI7 B;  4E2Y A;  2WB1 A;  2J6A A;  5A2Q f;  2JS4 A;  1W2B Z;  1QYP A;  4BXX I;  3CC7 Z;  2NVT I;  1RQF A;  5IT9 b;  1M90 2;  5T6B A;  3CME Z;  1Q81 2;  1JJ2 Z;  3M4O I;  3CC4 1;  3H0G I;  1Y1V S;  3HKZ A;  3CCJ Z;  3CCE Z;  3NH5 A;  5IT9 f;  2OTJ Z;  2QRC B;  1X3Z A;  1Z02 A;  1RO0 A;  2R93 I;  1X3W A;  1YJN Z;  3IX0 A;  3G71 Z;  1VQ8 Z;  3Q87 A;  3CCQ Z;  3S15 I;  3CCR Z;  1Q86 2;  1Z03 A;  3G4S Z;  4A3E I;  1YIJ Z;  4NB9 A;  3CMA Z;  1VQ9 1;  3NFZ A;  4Y7N I;  1ZB8 A;  1K73 2;  2O53 A;  1I6H I;  1P9N A;  3MZL B;  4A3G I;  3ESW A;  2V8I A;  4XX2 A;  2V8J A;  4CL1 A;  1VQN 1;  2Q4Z A;  3CPW Z;  4A3K I;  2DE6 A;  3HOX I;  2RHB A;  1TWG I;  4Y52 I;  3IFU A;  5FLX b;  1RLY A;  1NP6 A;  1WCM I;  1VQ4 1;  2O4H A;  2W03 A;  3S16 I;  2RT9 A;  3GCF A;  3CCS 1;  2EGT A;  1SFO I;  4NBD A;  4MD8 A;  5FLX f;  3GTL I;  1S7M A;  1N8R 2;  1N8R 1;  2GU2 A;  4A3B I;  5C3E I;  3CC4 Z;  2JUB A;  1TWC I;  2NVX I;  1KD1 2;  4RV9 A;  4A3D I;  5IP9 I;  4MH4 A;  4A3F I;  2QLV B;  1TWF I;  2DE7 A;  3CCL 1;  3I4N I;  1DL6 A;  2R7Z I;  5FLM I;  1VQ9 Z;  1Q7Y 2;  2G2K A;  2QRE B;  1Q7Y 1;  4NH1 C;  1YIJ 1;  3S17 I;  4NBC A;  3HOV I;  4BY7 I;  2LFU A;  1ML8 A;  1WII A;  1VQN Z;  4HGY A;  3NDJ A;  3GTG I;  1KQS Y;  1JWH C;  4A3I I;  1I3Q I;  1VQ4 Z;  2AKL A;  2LIY A;  1PFT A;  4BBS I;  2K3R A;  1VQP 1;  3CCS Z;  4BBR I;  1QVG Y;  2JA7 I;  3I4M I;  4QTT A;  2R6M A;  5C4J I;  5LL6 f;  2GTI A;  3J7A 4;  3M3Y I;  3CCV 1;  4HGZ A;  1M90 1;  3VMG A;  4AYB A;  2P3Y A;  3S14 I;  1Q81 1;  1S72 1;  4S1T A;  2NVQ I;  2PM9 A;  2R92 I;  2KPI A;  4E31 A;  4E2W A;  3I55 Z;  3G6E 1;  3CCL Z;  3I56 1;  1KQS Z;  2JMO A;  3VTN A;  1QF8 A;  2JNY A;  4TNU A;  1Y1W I;  1VQ7 1;  1Q86 1;  3CCU 1;  1TFI A;  1ZB9 A;  2V8K A;  2VUG A;  1K73 1;  3CCM 1;  1KC8 2;  1KC8 1;  3HOZ I;  3FKI I;  1YI2 1;  3JAM b;  4NBE A;  1QVG Z;  2QR1 B;  5IP7 I;  3S1Q I;  3LUS A;  3RZO I;  4MRI A;  3H3V J;  1X0T A;  3FQQ A;  1VQP Z;  1YJ9 Z;  3S1R I;  1LQL A;  3F3P C;  1N2F A;  4RVD A;  2JR6 A;  3NDI A;  3CCV Z;  1K83 I;  4BY1 I;  2PK7 A;  3T4N B;  1S72 Z;  3OW2 Y;  1KD1 1;  5D1O A;  4DK1 A;  4A3J I;  2DE5 A;  2QEX 1;  1Q82 2;  1R9T I;  3PO3 I;  2QRD B;  1K9M 2;  3G6E Z;  1VQL 1;  3I55 1;  3I56 Z;  1NJI 2;  1VQ7 Z;  2VF1 A;  4X6A I;  1USP B;  3F3F C;  3CCU Z;  4NBB A;  2HF1 A;  2OOX B;  3CCM Z;  1YUK A;  3J80 b;  1YI2 Z;  4E30 A;  3GTQ I;  3EER A;  2VUM I;  1NUI A;  3FQM A;  3J80 f;  4A3C I;  1RNI A;  5AN9 F;  1YHQ 1;  3EED A;  3OW2 Z;  2JA5 I;  1YJ9 1;  1VQM 1;  3GKQ A;  2E2I I;  3BG0 B;  3GTM I;  2NVY I;  2GTH A;  2RPR A;  3MON A;  4RVF A;  3KIH A;  3D6W A;  3S2H I;  2OOY B;  2QEX Z;  4MXU A;  1QVF Y;  4NBG A;  1VQL Z;  4E2X A;  4MD7 A;  4NB8 A;  4EWC A;  3CPW Y;  1Y1V I;  3VMI A;  4NOZ A;  2K5R A;  2H85 A;  1YIT 1;  3CXC Y;  4E2Z A;  3CD6 1;  4DGL A;  3NH4 A;  4DQY B;  1RO2 A;  1VQK 1;  2I3C A;  3S1M I;  1YJW 1;  1VQ6 1;  2IZ4 A;  3CQZ I;  2E2J I;  3I07 A;  1VQ5 1;  3CC2 1;  5T67 A;  3HOW I;  2OTL 1;  3JAM f;  2RBL A;  3RZD I;  2W04 A;  1YHQ Z;  2PMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...