2QREB

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-d-ribofuranotide (zmp)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
91
structure length
85
Chain Sequence
QYSTEIPAFLTSLQELKLPKPPSLPPHLEKCILNSNTDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 3
structure length 85
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qreB01
2QRCB 2QR1B 2QLVB 3TDHB 2OOYB 2OOXB 2QREB 3T4NB 3TE5B 2QRDB
chains in the Genus database with same CATH superfamily
3IX0A 1Y1VS 3F3PC 3CC2Z 4MD9A 1VQ8Z 2B63I 5FLXf 2NAPA 3NH4A 2KI7B 3HOUI 2R93I 2J6AA 1Y8CA 1VQLZ 4A3BI 3CCQ1 3GTLI 2YU9I 4E2WA 2K3RA 4NBBA 2IV2X 1NP6A 3S16I 2VPYA 1JWHC 3G711 3CCVZ 4RV9A 2JMOA 4NBCA 1K731 1WCMI 1Y1WI 4DK1A 1YJNZ 2HF1A 1VQ6Z 4A3EI 1VQNZ 1VQM1 4E30A 5C4XI 1PFTA 3J80f 3GTMI 1ML8A 3K7AI 1K732 2G2KA 2R7ZI 2QREB 4MH4A 1Q861 1VQO1 1W2BY 2AYDA 2RT9A 1KD11 3S1MI 1YJWZ 4NBDA 1YJ91 2H85A 3S15I 1KD12 1VQ51 1M901 5IP7I 2M6NA 1Z03A 3J7A4 2OTLZ 4RVFA 4E2YA 1SIWA 1M902 2V45A 2ZAEB 1VLAA 3CCLZ 3HOWI 5T67A 2QKDA 1TWAI 3CCRZ 3CME1 2F4OA 2OTJZ 3CCU1 4NOZA 3J81f 1Q7Y1 1M1K1 3CCJZ 3PO2I 3CMAZ 3G6E1 2EGTA 4E31A 3LUSA 3J80b 1Q812 5AN9F 1Q7Y2 1M1K2 3CC71 1S72Z 2PM9A 4NFRA 4RS4A 3CC4Z 4S1TA 4RVGA 2RHBA 1S7MA 1I50I 5D1PA 3NH5A 3VMGA 3RZOI 3I56Z 4A3GI 4BBRI 4HGZA 4BXXI 3RZDI 5C3EI 4XX2A 3I55Z 1L1OC 1K8A2 1N8R1 2Q51A 2AKLA 3ESWA 1WIIA 3EEDA 4E32A 1N8R2 2R92I 1Z01A 3CCV1 1QVFY 3H0GI 1USPA 4RVHA 4DGLA 3HOYI 1VQ61 1VQN1 1VQ91 3GTJI 3G4SZ 3J81b 2V8IA 3EERA 1RNIA 3HKZA 4NB8A 5LL6f 4E2ZA 1NUIA 2V8JA 1LQLA 2W03A 3NH8A 2QEX1 3TDHB 5T6BA 2LFUA 2YADA 1AA6A 3OW2Y 2Y0SA 1TWCI 4RVDA 1QXFA 5FLMI 4BY1I 2JA6I 1ZB8A 1YHQZ 4E33A 3CD61 2E2JI 2QA41 1VQ4Z 3I4MI 3S2HI 1YI2Z 1WZNA 1QF8A 1TFIA 2OTL1 2VF1A 3NDJA 3CCMZ 3T4NB 3FQQA 4NBEA 3GTKI 4NH1C 1WW9A 2WAQA 3MONA 2JA5I 3CCL1 3NFZA 1QVGY 3CCR1 2M48A 5FLXb 3CCEZ 3MZLB 2NVTI 3G71Z 3S14I 2VPZA 3GTMS 2OTJ1 3JAMf 2QRCB 4DQYB 1VQMZ 1VQ71 4NB9A 5IT9f 2JR6A 4NBAA 1YIJZ 4QTTA 1QVFZ 3IFUA 3CMA1 5T64A 2O4HA 2HU9A 1VQOZ 2QR1B 3VTNA 1X3WA 1VQK1 2VPXA 2IZ3A 1S721 1WJ2A 3NDIA 1Q811 3OW2Z 3D6WA 1YIT1 1KC82 2Q4ZA 3VB9A 2VUMI 2JNYA 3GTGI 2DE7A 2BJOA 3S1NI 2OOYB 5D1OB 1W2BZ 3TE5B 5C4JI 3HOZI 3IR7A 4QTUA 4A3II 2QLVB 3CC21 1VQ81 2GTIA 3CPWY 1YUKA 1ZH1A 1RO0A 1Y1VI 4MD8A 3S1QI 3CCUZ 1K8A1 4MONA 3HOXI 2E9HA 2KPIA 1VQL1 4MXUA 1RLYA 1RQFA 2JIPA 3H3VJ 3PO3I 3JAMb 1RO2A 3CXCY 3VMHA 2JIRA 1FDIA 2RPRA 1VQPZ 2V3VA 3QWUA 3CQZI 3G4S1 2RBLA 5C44I 3MZKB 2DE6A 3Q87A 1YJN1 3KIHA 2JIOA 2JA7I 3S17I 1SFOI 2E7ZA 2VUGA 4Y52I 1Q16A 3F3FC 1YHQ1 2GU2A 2OZKA 2PK7A 2PMZA 5A2Qf 1YI21 3CCSZ 1VQ41 1KQSY 4NBHA 3PO3S 2RIQA 2NVQI 3CCM1 1TWGI 1YJW1 3GTPI 1NJI1 4X6AI 4HGYA 1JJ2Y 3BG0B 4MRIA 4Y7NI 4NBFA 2JUBA 1NJI2 1RO4A 3CPWZ 3CCE1 3GTOI 3CCQZ 2E2HI 1K83I 2DE5A 3GCFA 4E2XA 1VQ9Z 4TNUA 2P28A 2NVYI 1YIJ1 3CXCZ 2QEXZ 2K5RA 4A3CI 3D9XA 1I6HI 2LIYA 1DL6A 1Q862 3D2LA 3CD6Z 2QA4Z 4A3DI 3CCJ1 1FDOA 2JA8I 2I3CA 4A93I 1N2FA 3HOVI 4BBSI 2OOXB 3GKQA 5A2Qb 4MD7A 2P3YA 2GTHA 3GTQI 1YJ9Z 4A3KI 1P9NA 1KQSZ 3CC41 1R9TI 1TWFI 2JIMA 1KC81 2NVXI 4A3LI 2O53A 2R6MA 2IZ4A 3FKII 1VQ5Z 4A3JI 3P5JB 2JS4A 2QRDB 5IP9I 5CM2M 1JJ2Z 2LEXA 1Z02A 1X0TA 3I561 4CL1A 3KIFA 1YUAA 2E2II 3U50C 2V8KA 3I551 2F4MA 2VPWA 1VQ7Z 3I4NI 3CMEZ 2JIQA 4HH4A 1VQP1 4BY7I 4EWCA 1Q821 1X3ZA 1VQKZ 1ZB9A 1QVGZ 1I3QI 3S2DI 2WB1A 1QYPA 3IF8A 4A3FI 3FQMA 1Q822 2W04A 3VMIA 4AYBA 1KRLA 3G6EZ 3BG1B 4NBGA 4A3MI 1K9M1 1YITZ 3S1RI 3M4OI 5D1OA 3I07A 1USPB 5IT9b 3M3YI 3CC7Z 3CCS1 1TWHI 1K9M2
chains in the Genus database with same CATH topology
3IX0A 1Y1VS 3F3PC 3CC2Z 4MD9A 1VQ8Z 2B63I 5FLXf 3NH4A 2KI7B 3HOUI 2R93I 2J6AA 1VQLZ 4A3BI 3CCQ1 3GTLI 2YU9I 4E2WA 2K3RA 4NBBA 1NP6A 3S16I 1JWHC 3G711 3CCVZ 4RV9A 2JMOA 4NBCA 1K731 1WCMI 1Y1WI 4DK1A 1YJNZ 2HF1A 1VQ6Z 4A3EI 1VQNZ 1VQM1 4E30A 5C4XI 1PFTA 3J80f 3GTMI 1ML8A 3K7AI 1K732 2G2KA 2R7ZI 2QREB 4MH4A 1Q861 1VQO1 1W2BY 2RT9A 1KD11 3S1MI 1YJWZ 4NBDA 1YJ91 2H85A 3S15I 1KD12 1VQ51 1M901 5IP7I 2M6NA 1Z03A 3J7A4 2OTLZ 4RVFA 4E2YA 1M902 2ZAEB 1VLAA 3CCLZ 3HOWI 5T67A 2QKDA 1TWAI 3CCRZ 3CME1 2F4OA 2OTJZ 3CCU1 4NOZA 3J81f 1Q7Y1 1M1K1 3CCJZ 3PO2I 3CMAZ 3G6E1 2EGTA 4E31A 3LUSA 3J80b 1Q812 5AN9F 1Q7Y2 1M1K2 3CC71 1S72Z 2PM9A 4NFRA 4RS4A 3CC4Z 4S1TA 4RVGA 2RHBA 1S7MA 1I50I 5D1PA 3NH5A 3VMGA 3RZOI 3I56Z 4A3GI 4BBRI 4HGZA 4BXXI 3RZDI 5C3EI 4XX2A 3I55Z 1L1OC 1K8A2 1N8R1 2Q51A 2AKLA 3ESWA 1WIIA 3EEDA 4E32A 1N8R2 2R92I 1Z01A 3CCV1 1QVFY 3H0GI 1USPA 4RVHA 4DGLA 3HOYI 1VQ61 1VQN1 1VQ91 3GTJI 3G4SZ 3J81b 2V8IA 3EERA 1RNIA 3HKZA 4NB8A 5LL6f 4E2ZA 1NUIA 2V8JA 1LQLA 2W03A 3NH8A 2QEX1 3TDHB 5T6BA 2LFUA 2YADA 3OW2Y 2Y0SA 1TWCI 4RVDA 5FLMI 4BY1I 2JA6I 1ZB8A 1YHQZ 4E33A 3CD61 2E2JI 2QA41 1VQ4Z 3I4MI 3S2HI 1YI2Z 1QF8A 1TFIA 2OTL1 2VF1A 3NDJA 3CCMZ 3T4NB 3FQQA 4NBEA 3GTKI 4NH1C 1WW9A 2WAQA 3MONA 2JA5I 3CCL1 3NFZA 1QVGY 3CCR1 2M48A 5FLXb 3CCEZ 3MZLB 2NVTI 3G71Z 3S14I 3GTMS 2OTJ1 3JAMf 2QRCB 4DQYB 1VQMZ 1VQ71 4NB9A 5IT9f 2JR6A 4NBAA 1YIJZ 4QTTA 1QVFZ 3IFUA 3CMA1 5T64A 2O4HA 2HU9A 1VQOZ 2QR1B 3VTNA 1X3WA 1VQK1 2IZ3A 1S721 3NDIA 1Q811 3OW2Z 3D6WA 1YIT1 1KC82 2Q4ZA 3VB9A 2VUMI 2JNYA 3GTGI 2DE7A 2BJOA 3S1NI 2OOYB 5D1OB 1W2BZ 3TE5B 5C4JI 3HOZI 4QTUA 4A3II 2QLVB 3CC21 1VQ81 2GTIA 3CPWY 1YUKA 1ZH1A 1RO0A 1Y1VI 4MD8A 3S1QI 3CCUZ 1K8A1 4MONA 3HOXI 2E9HA 2KPIA 1VQL1 4MXUA 1RLYA 1RQFA 3H3VJ 3PO3I 3JAMb 1RO2A 3CXCY 3VMHA 1VQPZ 2RPRA 3QWUA 3CQZI 3G4S1 2RBLA 5C44I 3MZKB 2DE6A 3Q87A 1YJN1 3KIHA 2JA7I 3S17I 1SFOI 2VUGA 4Y52I 3F3FC 1YHQ1 2GU2A 2OZKA 2PK7A 2PMZA 5A2Qf 1YI21 3CCSZ 1VQ41 1KQSY 4NBHA 3PO3S 2RIQA 2NVQI 3CCM1 1TWGI 1YJW1 3GTPI 1NJI1 4X6AI 4HGYA 1JJ2Y 3BG0B 4MRIA 4Y7NI 4NBFA 2JUBA 1NJI2 1RO4A 3CPWZ 3CCE1 3GTOI 3CCQZ 2E2HI 1K83I 2DE5A 3GCFA 4E2XA 1VQ9Z 4TNUA 2P28A 2NVYI 1YIJ1 3CXCZ 2QEXZ 2K5RA 4A3CI 3D9XA 1I6HI 2LIYA 1DL6A 1Q862 3CD6Z 2QA4Z 4A3DI 3CCJ1 2JA8I 2I3CA 4A93I 1N2FA 3HOVI 4BBSI 2OOXB 3GKQA 5A2Qb 4MD7A 2P3YA 2GTHA 3GTQI 1YJ9Z 4A3KI 1P9NA 1KQSZ 3CC41 1R9TI 1TWFI 1KC81 2NVXI 4A3LI 2O53A 2R6MA 2IZ4A 3FKII 1VQ5Z 4A3JI 3P5JB 2JS4A 2QRDB 5IP9I 5CM2M 1JJ2Z 1Z02A 1X0TA 3I561 4CL1A 3KIFA 1YUAA 2E2II 3U50C 2V8KA 3I551 2F4MA 1VQ7Z 3I4NI 3CMEZ 4HH4A 1VQP1 4BY7I 4EWCA 1Q821 1X3ZA 1VQKZ 1ZB9A 1QVGZ 1I3QI 3S2DI 2WB1A 1QYPA 3IF8A 4A3FI 3FQMA 1Q822 2W04A 3VMIA 4AYBA 1KRLA 3G6EZ 3BG1B 4NBGA 4A3MI 1K9M1 1YITZ 3S1RI 3M4OI 5D1OA 3I07A 1USPB 5IT9b 3M3YI 3CC7Z 3CCS1 1TWHI 1K9M2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRC B;  2QR1 B;  2QLV B;  3TDH B;  2OOY B;  2OOX B;  2QRE B;  3T4N B;  3TE5 B;  2QRD B; 
#chains in the Genus database with same CATH topology
 3IX0 A;  1Y1V S;  3F3P C;  3CC2 Z;  4MD9 A;  1VQ8 Z;  2B63 I;  5FLX f;  2NAP A;  3NH4 A;  2KI7 B;  3HOU I;  2R93 I;  2J6A A;  1Y8C A;  1VQL Z;  4A3B I;  3CCQ 1;  3GTL I;  2YU9 I;  4E2W A;  2K3R A;  4NBB A;  2IV2 X;  1NP6 A;  3S16 I;  2VPY A;  1JWH C;  3G71 1;  3CCV Z;  4RV9 A;  2JMO A;  4NBC A;  1K73 1;  1WCM I;  1Y1W I;  4DK1 A;  1YJN Z;  2HF1 A;  1VQ6 Z;  4A3E I;  1VQN Z;  1VQM 1;  4E30 A;  5C4X I;  1PFT A;  3J80 f;  3GTM I;  1ML8 A;  3K7A I;  1K73 2;  2G2K A;  2R7Z I;  2QRE B;  4MH4 A;  1Q86 1;  1VQO 1;  1W2B Y;  2AYD A;  2RT9 A;  1KD1 1;  3S1M I;  1YJW Z;  4NBD A;  1YJ9 1;  2H85 A;  3S15 I;  1KD1 2;  1VQ5 1;  1M90 1;  5IP7 I;  2M6N A;  1Z03 A;  3J7A 4;  2OTL Z;  4RVF A;  4E2Y A;  1SIW A;  1M90 2;  2V45 A;  2ZAE B;  1VLA A;  3CCL Z;  3HOW I;  5T67 A;  2QKD A;  1TWA I;  3CCR Z;  3CME 1;  2F4O A;  2OTJ Z;  3CCU 1;  4NOZ A;  3J81 f;  1Q7Y 1;  1M1K 1;  3CCJ Z;  3PO2 I;  3CMA Z;  3G6E 1;  2EGT A;  4E31 A;  3LUS A;  3J80 b;  1Q81 2;  5AN9 F;  1Q7Y 2;  1M1K 2;  3CC7 1;  1S72 Z;  2PM9 A;  4NFR A;  4RS4 A;  3CC4 Z;  4S1T A;  4RVG A;  2RHB A;  1S7M A;  1I50 I;  5D1P A;  3NH5 A;  3VMG A;  3RZO I;  3I56 Z;  4A3G I;  4BBR I;  4HGZ A;  4BXX I;  3RZD I;  5C3E I;  4XX2 A;  3I55 Z;  1L1O C;  1K8A 2;  1N8R 1;  2Q51 A;  2AKL A;  3ESW A;  1WII A;  3EED A;  4E32 A;  1N8R 2;  2R92 I;  1Z01 A;  3CCV 1;  1QVF Y;  3H0G I;  1USP A;  4RVH A;  4DGL A;  3HOY I;  1VQ6 1;  1VQN 1;  1VQ9 1;  3GTJ I;  3G4S Z;  3J81 b;  2V8I A;  3EER A;  1RNI A;  3HKZ A;  4NB8 A;  5LL6 f;  4E2Z A;  1NUI A;  2V8J A;  1LQL A;  2W03 A;  3NH8 A;  2QEX 1;  3TDH B;  5T6B A;  2LFU A;  2YAD A;  1AA6 A;  3OW2 Y;  2Y0S A;  1TWC I;  4RVD A;  1QXF A;  5FLM I;  4BY1 I;  2JA6 I;  1ZB8 A;  1YHQ Z;  4E33 A;  3CD6 1;  2E2J I;  2QA4 1;  1VQ4 Z;  3I4M I;  3S2H I;  1YI2 Z;  1WZN A;  1QF8 A;  1TFI A;  2OTL 1;  2VF1 A;  3NDJ A;  3CCM Z;  3T4N B;  3FQQ A;  4NBE A;  3GTK I;  4NH1 C;  1WW9 A;  2WAQ A;  3MON A;  2JA5 I;  3CCL 1;  3NFZ A;  1QVG Y;  3CCR 1;  2M48 A;  5FLX b;  3CCE Z;  3MZL B;  2NVT I;  3G71 Z;  3S14 I;  2VPZ A;  3GTM S;  2OTJ 1;  3JAM f;  2QRC B;  4DQY B;  1VQM Z;  1VQ7 1;  4NB9 A;  5IT9 f;  2JR6 A;  4NBA A;  1YIJ Z;  4QTT A;  1QVF Z;  3IFU A;  3CMA 1;  5T64 A;  2O4H A;  2HU9 A;  1VQO Z;  2QR1 B;  3VTN A;  1X3W A;  1VQK 1;  2VPX A;  2IZ3 A;  1S72 1;  1WJ2 A;  3NDI A;  1Q81 1;  3OW2 Z;  3D6W A;  1YIT 1;  1KC8 2;  2Q4Z A;  3VB9 A;  2VUM I;  2JNY A;  3GTG I;  2DE7 A;  2BJO A;  3S1N I;  2OOY B;  5D1O B;  1W2B Z;  3TE5 B;  5C4J I;  3HOZ I;  3IR7 A;  4QTU A;  4A3I I;  2QLV B;  3CC2 1;  1VQ8 1;  2GTI A;  3CPW Y;  1YUK A;  1ZH1 A;  1RO0 A;  1Y1V I;  4MD8 A;  3S1Q I;  3CCU Z;  1K8A 1;  4MON A;  3HOX I;  2E9H A;  2KPI A;  1VQL 1;  4MXU A;  1RLY A;  1RQF A;  2JIP A;  3H3V J;  3PO3 I;  3JAM b;  1RO2 A;  3CXC Y;  3VMH A;  2JIR A;  1FDI A;  2RPR A;  1VQP Z;  2V3V A;  3QWU A;  3CQZ I;  3G4S 1;  2RBL A;  5C44 I;  3MZK B;  2DE6 A;  3Q87 A;  1YJN 1;  3KIH A;  2JIO A;  2JA7 I;  3S17 I;  1SFO I;  2E7Z A;  2VUG A;  4Y52 I;  1Q16 A;  3F3F C;  1YHQ 1;  2GU2 A;  2OZK A;  2PK7 A;  2PMZ A;  5A2Q f;  1YI2 1;  3CCS Z;  1VQ4 1;  1KQS Y;  4NBH A;  3PO3 S;  2RIQ A;  2NVQ I;  3CCM 1;  1TWG I;  1YJW 1;  3GTP I;  1NJI 1;  4X6A I;  4HGY A;  1JJ2 Y;  3BG0 B;  4MRI A;  4Y7N I;  4NBF A;  2JUB A;  1NJI 2;  1RO4 A;  3CPW Z;  3CCE 1;  3GTO I;  3CCQ Z;  2E2H I;  1K83 I;  2DE5 A;  3GCF A;  4E2X A;  1VQ9 Z;  4TNU A;  2P28 A;  2NVY I;  1YIJ 1;  3CXC Z;  2QEX Z;  2K5R A;  4A3C I;  3D9X A;  1I6H I;  2LIY A;  1DL6 A;  1Q86 2;  3D2L A;  3CD6 Z;  2QA4 Z;  4A3D I;  3CCJ 1;  1FDO A;  2JA8 I;  2I3C A;  4A93 I;  1N2F A;  3HOV I;  4BBS I;  2OOX B;  3GKQ A;  5A2Q b;  4MD7 A;  2P3Y A;  2GTH A;  3GTQ I;  1YJ9 Z;  4A3K I;  1P9N A;  1KQS Z;  3CC4 1;  1R9T I;  1TWF I;  2JIM A;  1KC8 1;  2NVX I;  4A3L I;  2O53 A;  2R6M A;  2IZ4 A;  3FKI I;  1VQ5 Z;  4A3J I;  3P5J B;  2JS4 A;  2QRD B;  5IP9 I;  5CM2 M;  1JJ2 Z;  2LEX A;  1Z02 A;  1X0T A;  3I56 1;  4CL1 A;  3KIF A;  1YUA A;  2E2I I;  3U50 C;  2V8K A;  3I55 1;  2F4M A;  2VPW A;  1VQ7 Z;  3I4N I;  3CME Z;  2JIQ A;  4HH4 A;  1VQP 1;  4BY7 I;  4EWC A;  1Q82 1;  1X3Z A;  1VQK Z;  1ZB9 A;  1QVG Z;  1I3Q I;  3S2D I;  2WB1 A;  1QYP A;  3IF8 A;  4A3F I;  3FQM A;  1Q82 2;  2W04 A;  3VMI A;  4AYB A;  1KRL A;  3G6E Z;  3BG1 B;  4NBG A;  4A3M I;  1K9M 1;  1YIT Z;  3S1R I;  3M4O I;  5D1O A;  3I07 A;  1USP B;  5IT9 b;  3M3Y I;  3CC7 Z;  3CCS 1;  1TWH I;  1K9M 2; 
#chains in the Genus database with same CATH homology
 3IX0 A;  1Y1V S;  3F3P C;  3CC2 Z;  4MD9 A;  1VQ8 Z;  2B63 I;  5FLX f;  3NH4 A;  2KI7 B;  3HOU I;  2R93 I;  2J6A A;  1VQL Z;  4A3B I;  3CCQ 1;  3GTL I;  2YU9 I;  4E2W A;  2K3R A;  4NBB A;  1NP6 A;  3S16 I;  1JWH C;  3G71 1;  3CCV Z;  4RV9 A;  2JMO A;  4NBC A;  1K73 1;  1WCM I;  1Y1W I;  4DK1 A;  1YJN Z;  2HF1 A;  1VQ6 Z;  4A3E I;  1VQN Z;  1VQM 1;  4E30 A;  5C4X I;  1PFT A;  3J80 f;  3GTM I;  1ML8 A;  3K7A I;  1K73 2;  2G2K A;  2R7Z I;  2QRE B;  4MH4 A;  1Q86 1;  1VQO 1;  1W2B Y;  2RT9 A;  1KD1 1;  3S1M I;  1YJW Z;  4NBD A;  1YJ9 1;  2H85 A;  3S15 I;  1KD1 2;  1VQ5 1;  1M90 1;  5IP7 I;  2M6N A;  1Z03 A;  3J7A 4;  2OTL Z;  4RVF A;  4E2Y A;  1M90 2;  2ZAE B;  1VLA A;  3CCL Z;  3HOW I;  5T67 A;  2QKD A;  1TWA I;  3CCR Z;  3CME 1;  2F4O A;  2OTJ Z;  3CCU 1;  4NOZ A;  3J81 f;  1Q7Y 1;  1M1K 1;  3CCJ Z;  3PO2 I;  3CMA Z;  3G6E 1;  2EGT A;  4E31 A;  3LUS A;  3J80 b;  1Q81 2;  5AN9 F;  1Q7Y 2;  1M1K 2;  3CC7 1;  1S72 Z;  2PM9 A;  4NFR A;  4RS4 A;  3CC4 Z;  4S1T A;  4RVG A;  2RHB A;  1S7M A;  1I50 I;  5D1P A;  3NH5 A;  3VMG A;  3RZO I;  3I56 Z;  4A3G I;  4BBR I;  4HGZ A;  4BXX I;  3RZD I;  5C3E I;  4XX2 A;  3I55 Z;  1L1O C;  1K8A 2;  1N8R 1;  2Q51 A;  2AKL A;  3ESW A;  1WII A;  3EED A;  4E32 A;  1N8R 2;  2R92 I;  1Z01 A;  3CCV 1;  1QVF Y;  3H0G I;  1USP A;  4RVH A;  4DGL A;  3HOY I;  1VQ6 1;  1VQN 1;  1VQ9 1;  3GTJ I;  3G4S Z;  3J81 b;  2V8I A;  3EER A;  1RNI A;  3HKZ A;  4NB8 A;  5LL6 f;  4E2Z A;  1NUI A;  2V8J A;  1LQL A;  2W03 A;  3NH8 A;  2QEX 1;  3TDH B;  5T6B A;  2LFU A;  2YAD A;  3OW2 Y;  2Y0S A;  1TWC I;  4RVD A;  5FLM I;  4BY1 I;  2JA6 I;  1ZB8 A;  1YHQ Z;  4E33 A;  3CD6 1;  2E2J I;  2QA4 1;  1VQ4 Z;  3I4M I;  3S2H I;  1YI2 Z;  1QF8 A;  1TFI A;  2OTL 1;  2VF1 A;  3NDJ A;  3CCM Z;  3T4N B;  3FQQ A;  4NBE A;  3GTK I;  4NH1 C;  1WW9 A;  2WAQ A;  3MON A;  2JA5 I;  3CCL 1;  3NFZ A;  1QVG Y;  3CCR 1;  2M48 A;  5FLX b;  3CCE Z;  3MZL B;  2NVT I;  3G71 Z;  3S14 I;  3GTM S;  2OTJ 1;  3JAM f;  2QRC B;  4DQY B;  1VQM Z;  1VQ7 1;  4NB9 A;  5IT9 f;  2JR6 A;  4NBA A;  1YIJ Z;  4QTT A;  1QVF Z;  3IFU A;  3CMA 1;  5T64 A;  2O4H A;  2HU9 A;  1VQO Z;  2QR1 B;  3VTN A;  1X3W A;  1VQK 1;  2IZ3 A;  1S72 1;  3NDI A;  1Q81 1;  3OW2 Z;  3D6W A;  1YIT 1;  1KC8 2;  2Q4Z A;  3VB9 A;  2VUM I;  2JNY A;  3GTG I;  2DE7 A;  2BJO A;  3S1N I;  2OOY B;  5D1O B;  1W2B Z;  3TE5 B;  5C4J I;  3HOZ I;  4QTU A;  4A3I I;  2QLV B;  3CC2 1;  1VQ8 1;  2GTI A;  3CPW Y;  1YUK A;  1ZH1 A;  1RO0 A;  1Y1V I;  4MD8 A;  3S1Q I;  3CCU Z;  1K8A 1;  4MON A;  3HOX I;  2E9H A;  2KPI A;  1VQL 1;  4MXU A;  1RLY A;  1RQF A;  3H3V J;  3PO3 I;  3JAM b;  1RO2 A;  3CXC Y;  3VMH A;  1VQP Z;  2RPR A;  3QWU A;  3CQZ I;  3G4S 1;  2RBL A;  5C44 I;  3MZK B;  2DE6 A;  3Q87 A;  1YJN 1;  3KIH A;  2JA7 I;  3S17 I;  1SFO I;  2VUG A;  4Y52 I;  3F3F C;  1YHQ 1;  2GU2 A;  2OZK A;  2PK7 A;  2PMZ A;  5A2Q f;  1YI2 1;  3CCS Z;  1VQ4 1;  1KQS Y;  4NBH A;  3PO3 S;  2RIQ A;  2NVQ I;  3CCM 1;  1TWG I;  1YJW 1;  3GTP I;  1NJI 1;  4X6A I;  4HGY A;  1JJ2 Y;  3BG0 B;  4MRI A;  4Y7N I;  4NBF A;  2JUB A;  1NJI 2;  1RO4 A;  3CPW Z;  3CCE 1;  3GTO I;  3CCQ Z;  2E2H I;  1K83 I;  2DE5 A;  3GCF A;  4E2X A;  1VQ9 Z;  4TNU A;  2P28 A;  2NVY I;  1YIJ 1;  3CXC Z;  2QEX Z;  2K5R A;  4A3C I;  3D9X A;  1I6H I;  2LIY A;  1DL6 A;  1Q86 2;  3CD6 Z;  2QA4 Z;  4A3D I;  3CCJ 1;  2JA8 I;  2I3C A;  4A93 I;  1N2F A;  3HOV I;  4BBS I;  2OOX B;  3GKQ A;  5A2Q b;  4MD7 A;  2P3Y A;  2GTH A;  3GTQ I;  1YJ9 Z;  4A3K I;  1P9N A;  1KQS Z;  3CC4 1;  1R9T I;  1TWF I;  1KC8 1;  2NVX I;  4A3L I;  2O53 A;  2R6M A;  2IZ4 A;  3FKI I;  1VQ5 Z;  4A3J I;  3P5J B;  2JS4 A;  2QRD B;  5IP9 I;  5CM2 M;  1JJ2 Z;  1Z02 A;  1X0T A;  3I56 1;  4CL1 A;  3KIF A;  1YUA A;  2E2I I;  3U50 C;  2V8K A;  3I55 1;  2F4M A;  1VQ7 Z;  3I4N I;  3CME Z;  4HH4 A;  1VQP 1;  4BY7 I;  4EWC A;  1Q82 1;  1X3Z A;  1VQK Z;  1ZB9 A;  1QVG Z;  1I3Q I;  3S2D I;  2WB1 A;  1QYP A;  3IF8 A;  4A3F I;  3FQM A;  1Q82 2;  2W04 A;  3VMI A;  4AYB A;  1KRL A;  3G6E Z;  3BG1 B;  4NBG A;  4A3M I;  1K9M 1;  1YIT Z;  3S1R I;  3M4O I;  5D1O A;  3I07 A;  1USP B;  5IT9 b;  3M3Y I;  3CC7 Z;  3CCS 1;  1TWH I;  1K9M 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...