2QREB

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-d-ribofuranotide (zmp)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
91
structure length
85
Chain Sequence
QYSTEIPAFLTSLQELKLPKPPSLPPHLEKCILNSNTDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 3
structure length 85
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qreB01
2QREB 2QLVB 2QRDB 2QRCB 2QR1B 3TDHB 3TE5B 2OOYB 2OOXB 3T4NB
chains in the Genus database with same CATH superfamily
2VPYA 4NBGA 2QKDA 1Q7Y2 4DK1A 1Q16A 1X0TA 3VMHA 3CQZI 1K9M1 1YJNZ 3CPWY 3PO3I 2RT9A 4E2YA 1DL6A 2V8JA 2F4OA 3TDHB 1VQN1 3CPWZ 1X3WA 1YI21 3CMAZ 4NBAA 2JMOA 4MONA 2NVXI 3GTGI 2HF1A 3CCJZ 3GTMS 2B63I 1KRLA 4QTTA 1VQKZ 3CXCY 1QVGY 1WCMI 3KIFA 3MZKB 3CCQ1 2K3RA 5IP9I 1AA6A 2Q51A 3S16I 3CXCZ 1QVGZ 4RS4A 2PM9A 1Q821 1VQ9Z 4MD8A 1VLAA 2KPIA 2RPRA 3GTJI 3GTKI 2AKLA 1NJI1 3CC2Z 2RHBA 4EWCA 4RVHA 2JIRA 2E2HI 3ESWA 5C3EI 2JS4A 4RVFA 1S72Z 3S2HI 1QVFY 3J80b 1YUAA 4A3LI 1VQK1 1Z01A 2ZAEB 1QVFZ 1KC82 4A3EI 3GCFA 4A3II 3GTPI 2EGTA 1VQ91 2QA4Z 1VQPZ 3J80f 2RBLA 3I4MI 2K5RA 3CD61 3CCMZ 3CC21 3NH8A 3S15I 3U50C 1S721 1RO4A 3CCEZ 2JIPA 3CC7Z 2JR6A 3H0GI 5T64A 3GTLI 4NBCA 1Y8CA 1I3QI 3HOUI 4NB8A 3J81b 3G71Z 5C4XI 4NOZA 2AYDA 4HH4A 1I6HI 5IP7I 1JWHC 4Y7NI 2JIOA 2NVTI 2YU9I 3HKZA 2QEXZ 1VQP1 1NP6A 2JIMA 1PFTA 1YUKA 5T6BA 3CCSZ 2JA7I 5A2Qb 3CCM1 3CCVZ 3VMIA 5IT9b 2VPXA 3J81f 1Q862 1KD11 3HOXI 4NBDA 3CCE1 2LIYA 3CC71 2RIQA 5D1OB 5A2Qf 1ZB8A 3RZDI 4BY7I 1K83I 5IT9f 2Q4ZA 4BBRI 3BG1B 3D2LA 4E2XA 3PO2I 2QEX1 2Y0SA 4MXUA 4DGLA 4E2ZA 4BBSI 3JAMb 1TWAI 3CCS1 4X6AI 2DE5A 3CCV1 2OZKA 2BJOA 3FKII 1VQ4Z 2NAPA 3OW2Y 3KIHA 3CCLZ 1WZNA 4NBBA 3OW2Z 3JAMf 2OTLZ 4S1TA 2QRCB 1VQ7Z 2E2JI 2H85A 1YJN1 3GTOI 3RZOI 4DQYB 1TWFI 1I50I 1TWGI 1L1OC 3IR7A 1N2FA 2JUBA 4NBEA 2JNYA 1Q812 3CMA1 3NH5A 1K8A1 3CCJ1 3BG0B 4A3MI 1K732 1VQ41 2P28A 5FLXb 1YHQZ 1SFOI 3HOYI 2V8IA 3PO3S 1FDOA 1M1K1 3CCL1 2LFUA 1Y1VI 2KI7B 2VUGA 4BXXI 2OTL1 2O4HA 3NDIA 1YJ9Z 1M901 4MH4A 1N8R2 5C44I 1VQ71 1ZH1A 2LEXA 2NVYI 3Q87A 5FLXf 1Q7Y1 3IX0A 2R93I 2QR1B 1VQ6Z 4E30A 1VQLZ 3HOZI 1Z03A 2O53A 1K9M2 4AYBA 1WIIA 2V3VA 2IZ3A 2W04A 1USPA 1RNIA 4A3JI 1Y1WI 1TWHI 1YHQ1 1RQFA 3EEDA 1VQOZ 4CL1A 2VUMI 4Y52I 1QYPA 3S1MI 4A3CI 4RVDA 4A3BI 4NFRA 1YJ91 2R92I 4XX2A 2NVQI 2V8KA 5T67A 2QA41 1LQLA 2M6NA 1VQ61 2HU9A 2WAQA 1VQL1 1Z02A 1Q822 1Y1VS 2F4MA 3GTMI 3I56Z 2JA5I 3CMEZ 3I07A 1VQNZ 1NUIA 2QRDB 2E2II 3S17I 1YI2Z 4NBFA 2IV2X 2GU2A 4NB9A 3G711 3FQQA 3I4NI 2GTHA 1KC81 1WW9A 2V45A 2W03A 3F3FC 3S1QI 1RO0A 3MZLB 3NH4A 5D1PA 4HGYA 4BY1I 3VB9A 2I3CA 1SIWA 3NDJA 2GTIA 3I561 4A3FI 3J7A4 3I55Z 2OTJZ 1ML8A 3CME1 1WJ2A 3NFZA 2IZ4A 2R6MA 2G2KA 1YIJZ 2OOXB 2QLVB 4HGZA 1RLYA 1P9NA 3S2DI 2PK7A 1VQMZ 4RV9A 1W2BY 3HOWI 1X3ZA 2E9HA 2JA6I 3K7AI 4MD7A 1YJWZ 2E7ZA 2VPZA 1W2BZ 1YITZ 3G4SZ 5LL6f 1Q861 2J6AA 3G6EZ 2M48A 3I551 2OTJ1 2QREB 2R7ZI 1KD12 3IF8A 3CD6Z 3VTNA 2PMZA 3M3YI 5FLMI 1YIJ1 1R9TI 3EERA 3F3PC 2JA8I 4TNUA 3D9XA 4A3KI 2JIQA 1VQM1 1VQ5Z 3CC4Z 4NH1C 3H3VJ 3QWUA 1VQ8Z 1S7MA 1YJW1 3P5JB 4NBHA 1YIT1 2DE6A 3G4S1 2P3YA 3GKQA 3CCUZ 3GTQI 4A3GI 3CCRZ 4A93I 3G6E1 3TE5B 1USPB 4E2WA 3HOVI 1ZB9A 2VF1A 2VPWA 3CC41 1VQ51 3D6WA 2YADA 3S1RI 3MONA 4QTUA 1JJ2Y 1VQ81 2DE7A 1FDIA 4RVGA 1Q811 4E32A 5CM2M 4MD9A 1TFIA 1NJI2 1JJ2Z 1QF8A 5AN9F 3CCU1 1VQO1 1RO2A 1K731 3CCR1 1K8A2 1QXFA 2OOYB 2WB1A 3LUSA 1KQSY 3VMGA 3T4NB 3IFUA 3S14I 3M4OI 3FQMA 5D1OA 1M1K2 4A3DI 1KQSZ 4E33A 1TWCI 1N8R1 3S1NI 4MRIA 5C4JI 1M902 3CCQZ 4E31A
chains in the Genus database with same CATH topology
4NBGA 2QKDA 1Q7Y2 4DK1A 1X0TA 3VMHA 3CQZI 1K9M1 1YJNZ 3CPWY 3PO3I 2RT9A 4E2YA 1DL6A 2V8JA 2F4OA 3TDHB 1VQN1 3CPWZ 1X3WA 1YI21 3CMAZ 4NBAA 2JMOA 4MONA 2NVXI 3GTGI 2HF1A 3CCJZ 3GTMS 2B63I 1KRLA 4QTTA 1VQKZ 3CXCY 1QVGY 1WCMI 3KIFA 3MZKB 3CCQ1 2K3RA 5IP9I 2Q51A 3S16I 3CXCZ 1QVGZ 4RS4A 2PM9A 1Q821 1VQ9Z 4MD8A 1VLAA 2KPIA 2RPRA 3GTJI 3GTKI 2AKLA 1NJI1 3CC2Z 2RHBA 4EWCA 4RVHA 2E2HI 3ESWA 5C3EI 2JS4A 4RVFA 1S72Z 3S2HI 1QVFY 3J80b 1YUAA 4A3LI 1VQK1 1Z01A 2ZAEB 1QVFZ 1KC82 4A3EI 3GCFA 4A3II 3GTPI 2EGTA 1VQ91 2QA4Z 1VQPZ 3J80f 2RBLA 3I4MI 2K5RA 3CD61 3CCMZ 3CC21 3NH8A 3S15I 3U50C 1S721 1RO4A 3CCEZ 3CC7Z 2JR6A 3H0GI 5T64A 3GTLI 4NBCA 1I3QI 3HOUI 4NB8A 3J81b 3G71Z 5C4XI 4NOZA 4HH4A 1I6HI 5IP7I 1JWHC 4Y7NI 2NVTI 2YU9I 3HKZA 2QEXZ 1VQP1 1NP6A 1PFTA 1YUKA 5T6BA 3CCSZ 2JA7I 5A2Qb 3CCM1 3CCVZ 3VMIA 5IT9b 3J81f 1Q862 1KD11 3HOXI 4NBDA 3CCE1 2LIYA 3CC71 2RIQA 5D1OB 5A2Qf 1ZB8A 3RZDI 4BY7I 1K83I 5IT9f 2Q4ZA 4BBRI 3BG1B 4E2XA 3PO2I 2QEX1 2Y0SA 4MXUA 4DGLA 4E2ZA 4BBSI 3JAMb 1TWAI 3CCS1 4X6AI 2DE5A 3CCV1 2OZKA 2BJOA 3FKII 1VQ4Z 3OW2Y 3KIHA 3CCLZ 4NBBA 3OW2Z 3JAMf 2OTLZ 4S1TA 2QRCB 1VQ7Z 2E2JI 2H85A 1YJN1 3GTOI 3RZOI 4DQYB 1TWFI 1I50I 1TWGI 1L1OC 1N2FA 2JUBA 4NBEA 2JNYA 1Q812 3CMA1 3NH5A 1K8A1 3CCJ1 3BG0B 4A3MI 1K732 1VQ41 2P28A 5FLXb 1YHQZ 1SFOI 3HOYI 2V8IA 3PO3S 1M1K1 3CCL1 2LFUA 1Y1VI 2KI7B 2VUGA 4BXXI 2OTL1 2O4HA 3NDIA 1YJ9Z 1M901 4MH4A 1N8R2 5C44I 1VQ71 1ZH1A 2NVYI 3Q87A 5FLXf 1Q7Y1 3IX0A 2R93I 2QR1B 1VQ6Z 4E30A 1VQLZ 3HOZI 1Z03A 2O53A 1K9M2 4AYBA 1WIIA 2IZ3A 2W04A 1USPA 1RNIA 4A3JI 1Y1WI 1TWHI 1YHQ1 1RQFA 3EEDA 1VQOZ 4CL1A 2VUMI 4Y52I 1QYPA 3S1MI 4A3CI 4RVDA 4A3BI 4NFRA 1YJ91 2R92I 4XX2A 2NVQI 2V8KA 5T67A 2QA41 1LQLA 2M6NA 1VQ61 2HU9A 2WAQA 1VQL1 1Z02A 1Q822 1Y1VS 2F4MA 3GTMI 3I56Z 2JA5I 3CMEZ 3I07A 1VQNZ 1NUIA 2QRDB 2E2II 3S17I 1YI2Z 4NBFA 2GU2A 4NB9A 3G711 3FQQA 3I4NI 2GTHA 1KC81 1WW9A 2W03A 3F3FC 3S1QI 1RO0A 3MZLB 3NH4A 5D1PA 4HGYA 4BY1I 3VB9A 2I3CA 3NDJA 2GTIA 3I561 4A3FI 3J7A4 3I55Z 2OTJZ 1ML8A 3CME1 3NFZA 2IZ4A 2R6MA 2G2KA 1YIJZ 2OOXB 2QLVB 4HGZA 1RLYA 1P9NA 3S2DI 2PK7A 1VQMZ 4RV9A 1W2BY 3HOWI 1X3ZA 2E9HA 2JA6I 3K7AI 4MD7A 1YJWZ 1W2BZ 1YITZ 3G4SZ 5LL6f 1Q861 2J6AA 3G6EZ 2M48A 3I551 2OTJ1 2QREB 2R7ZI 1KD12 3IF8A 3CD6Z 3VTNA 2PMZA 3M3YI 5FLMI 1YIJ1 1R9TI 3EERA 3F3PC 2JA8I 4TNUA 3D9XA 4A3KI 1VQM1 1VQ5Z 3CC4Z 4NH1C 3H3VJ 3QWUA 1VQ8Z 1S7MA 1YJW1 3P5JB 4NBHA 1YIT1 2DE6A 3G4S1 2P3YA 3GKQA 3CCUZ 3GTQI 4A3GI 3CCRZ 4A93I 3G6E1 3TE5B 1USPB 4E2WA 3HOVI 1ZB9A 2VF1A 3CC41 1VQ51 3D6WA 2YADA 3S1RI 3MONA 4QTUA 1JJ2Y 1VQ81 2DE7A 4RVGA 1Q811 4E32A 5CM2M 4MD9A 1TFIA 1NJI2 1JJ2Z 1QF8A 5AN9F 3CCU1 1VQO1 1RO2A 1K731 3CCR1 1K8A2 2OOYB 2WB1A 3LUSA 1KQSY 3VMGA 3T4NB 3IFUA 3S14I 3M4OI 3FQMA 5D1OA 1M1K2 4A3DI 1KQSZ 4E33A 1TWCI 1N8R1 3S1NI 4MRIA 5C4JI 1M902 3CCQZ 4E31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRE B;  2QLV B;  2QRD B;  2QRC B;  2QR1 B;  3TDH B;  3TE5 B;  2OOY B;  2OOX B;  3T4N B; 
#chains in the Genus database with same CATH topology
 2VPY A;  4NBG A;  2QKD A;  1Q7Y 2;  4DK1 A;  1Q16 A;  1X0T A;  3VMH A;  3CQZ I;  1K9M 1;  1YJN Z;  3CPW Y;  3PO3 I;  2RT9 A;  4E2Y A;  1DL6 A;  2V8J A;  2F4O A;  3TDH B;  1VQN 1;  3CPW Z;  1X3W A;  1YI2 1;  3CMA Z;  4NBA A;  2JMO A;  4MON A;  2NVX I;  3GTG I;  2HF1 A;  3CCJ Z;  3GTM S;  2B63 I;  1KRL A;  4QTT A;  1VQK Z;  3CXC Y;  1QVG Y;  1WCM I;  3KIF A;  3MZK B;  3CCQ 1;  2K3R A;  5IP9 I;  1AA6 A;  2Q51 A;  3S16 I;  3CXC Z;  1QVG Z;  4RS4 A;  2PM9 A;  1Q82 1;  1VQ9 Z;  4MD8 A;  1VLA A;  2KPI A;  2RPR A;  3GTJ I;  3GTK I;  2AKL A;  1NJI 1;  3CC2 Z;  2RHB A;  4EWC A;  4RVH A;  2JIR A;  2E2H I;  3ESW A;  5C3E I;  2JS4 A;  4RVF A;  1S72 Z;  3S2H I;  1QVF Y;  3J80 b;  1YUA A;  4A3L I;  1VQK 1;  1Z01 A;  2ZAE B;  1QVF Z;  1KC8 2;  4A3E I;  3GCF A;  4A3I I;  3GTP I;  2EGT A;  1VQ9 1;  2QA4 Z;  1VQP Z;  3J80 f;  2RBL A;  3I4M I;  2K5R A;  3CD6 1;  3CCM Z;  3CC2 1;  3NH8 A;  3S15 I;  3U50 C;  1S72 1;  1RO4 A;  3CCE Z;  2JIP A;  3CC7 Z;  2JR6 A;  3H0G I;  5T64 A;  3GTL I;  4NBC A;  1Y8C A;  1I3Q I;  3HOU I;  4NB8 A;  3J81 b;  3G71 Z;  5C4X I;  4NOZ A;  2AYD A;  4HH4 A;  1I6H I;  5IP7 I;  1JWH C;  4Y7N I;  2JIO A;  2NVT I;  2YU9 I;  3HKZ A;  2QEX Z;  1VQP 1;  1NP6 A;  2JIM A;  1PFT A;  1YUK A;  5T6B A;  3CCS Z;  2JA7 I;  5A2Q b;  3CCM 1;  3CCV Z;  3VMI A;  5IT9 b;  2VPX A;  3J81 f;  1Q86 2;  1KD1 1;  3HOX I;  4NBD A;  3CCE 1;  2LIY A;  3CC7 1;  2RIQ A;  5D1O B;  5A2Q f;  1ZB8 A;  3RZD I;  4BY7 I;  1K83 I;  5IT9 f;  2Q4Z A;  4BBR I;  3BG1 B;  3D2L A;  4E2X A;  3PO2 I;  2QEX 1;  2Y0S A;  4MXU A;  4DGL A;  4E2Z A;  4BBS I;  3JAM b;  1TWA I;  3CCS 1;  4X6A I;  2DE5 A;  3CCV 1;  2OZK A;  2BJO A;  3FKI I;  1VQ4 Z;  2NAP A;  3OW2 Y;  3KIH A;  3CCL Z;  1WZN A;  4NBB A;  3OW2 Z;  3JAM f;  2OTL Z;  4S1T A;  2QRC B;  1VQ7 Z;  2E2J I;  2H85 A;  1YJN 1;  3GTO I;  3RZO I;  4DQY B;  1TWF I;  1I50 I;  1TWG I;  1L1O C;  3IR7 A;  1N2F A;  2JUB A;  4NBE A;  2JNY A;  1Q81 2;  3CMA 1;  3NH5 A;  1K8A 1;  3CCJ 1;  3BG0 B;  4A3M I;  1K73 2;  1VQ4 1;  2P28 A;  5FLX b;  1YHQ Z;  1SFO I;  3HOY I;  2V8I A;  3PO3 S;  1FDO A;  1M1K 1;  3CCL 1;  2LFU A;  1Y1V I;  2KI7 B;  2VUG A;  4BXX I;  2OTL 1;  2O4H A;  3NDI A;  1YJ9 Z;  1M90 1;  4MH4 A;  1N8R 2;  5C44 I;  1VQ7 1;  1ZH1 A;  2LEX A;  2NVY I;  3Q87 A;  5FLX f;  1Q7Y 1;  3IX0 A;  2R93 I;  2QR1 B;  1VQ6 Z;  4E30 A;  1VQL Z;  3HOZ I;  1Z03 A;  2O53 A;  1K9M 2;  4AYB A;  1WII A;  2V3V A;  2IZ3 A;  2W04 A;  1USP A;  1RNI A;  4A3J I;  1Y1W I;  1TWH I;  1YHQ 1;  1RQF A;  3EED A;  1VQO Z;  4CL1 A;  2VUM I;  4Y52 I;  1QYP A;  3S1M I;  4A3C I;  4RVD A;  4A3B I;  4NFR A;  1YJ9 1;  2R92 I;  4XX2 A;  2NVQ I;  2V8K A;  5T67 A;  2QA4 1;  1LQL A;  2M6N A;  1VQ6 1;  2HU9 A;  2WAQ A;  1VQL 1;  1Z02 A;  1Q82 2;  1Y1V S;  2F4M A;  3GTM I;  3I56 Z;  2JA5 I;  3CME Z;  3I07 A;  1VQN Z;  1NUI A;  2QRD B;  2E2I I;  3S17 I;  1YI2 Z;  4NBF A;  2IV2 X;  2GU2 A;  4NB9 A;  3G71 1;  3FQQ A;  3I4N I;  2GTH A;  1KC8 1;  1WW9 A;  2V45 A;  2W03 A;  3F3F C;  3S1Q I;  1RO0 A;  3MZL B;  3NH4 A;  5D1P A;  4HGY A;  4BY1 I;  3VB9 A;  2I3C A;  1SIW A;  3NDJ A;  2GTI A;  3I56 1;  4A3F I;  3J7A 4;  3I55 Z;  2OTJ Z;  1ML8 A;  3CME 1;  1WJ2 A;  3NFZ A;  2IZ4 A;  2R6M A;  2G2K A;  1YIJ Z;  2OOX B;  2QLV B;  4HGZ A;  1RLY A;  1P9N A;  3S2D I;  2PK7 A;  1VQM Z;  4RV9 A;  1W2B Y;  3HOW I;  1X3Z A;  2E9H A;  2JA6 I;  3K7A I;  4MD7 A;  1YJW Z;  2E7Z A;  2VPZ A;  1W2B Z;  1YIT Z;  3G4S Z;  5LL6 f;  1Q86 1;  2J6A A;  3G6E Z;  2M48 A;  3I55 1;  2OTJ 1;  2QRE B;  2R7Z I;  1KD1 2;  3IF8 A;  3CD6 Z;  3VTN A;  2PMZ A;  3M3Y I;  5FLM I;  1YIJ 1;  1R9T I;  3EER A;  3F3P C;  2JA8 I;  4TNU A;  3D9X A;  4A3K I;  2JIQ A;  1VQM 1;  1VQ5 Z;  3CC4 Z;  4NH1 C;  3H3V J;  3QWU A;  1VQ8 Z;  1S7M A;  1YJW 1;  3P5J B;  4NBH A;  1YIT 1;  2DE6 A;  3G4S 1;  2P3Y A;  3GKQ A;  3CCU Z;  3GTQ I;  4A3G I;  3CCR Z;  4A93 I;  3G6E 1;  3TE5 B;  1USP B;  4E2W A;  3HOV I;  1ZB9 A;  2VF1 A;  2VPW A;  3CC4 1;  1VQ5 1;  3D6W A;  2YAD A;  3S1R I;  3MON A;  4QTU A;  1JJ2 Y;  1VQ8 1;  2DE7 A;  1FDI A;  4RVG A;  1Q81 1;  4E32 A;  5CM2 M;  4MD9 A;  1TFI A;  1NJI 2;  1JJ2 Z;  1QF8 A;  5AN9 F;  3CCU 1;  1VQO 1;  1RO2 A;  1K73 1;  3CCR 1;  1K8A 2;  1QXF A;  2OOY B;  2WB1 A;  3LUS A;  1KQS Y;  3VMG A;  3T4N B;  3IFU A;  3S14 I;  3M4O I;  3FQM A;  5D1O A;  1M1K 2;  4A3D I;  1KQS Z;  4E33 A;  1TWC I;  1N8R 1;  3S1N I;  4MRI A;  5C4J I;  1M90 2;  3CCQ Z;  4E31 A; 
#chains in the Genus database with same CATH homology
 4NBG A;  2QKD A;  1Q7Y 2;  4DK1 A;  1X0T A;  3VMH A;  3CQZ I;  1K9M 1;  1YJN Z;  3CPW Y;  3PO3 I;  2RT9 A;  4E2Y A;  1DL6 A;  2V8J A;  2F4O A;  3TDH B;  1VQN 1;  3CPW Z;  1X3W A;  1YI2 1;  3CMA Z;  4NBA A;  2JMO A;  4MON A;  2NVX I;  3GTG I;  2HF1 A;  3CCJ Z;  3GTM S;  2B63 I;  1KRL A;  4QTT A;  1VQK Z;  3CXC Y;  1QVG Y;  1WCM I;  3KIF A;  3MZK B;  3CCQ 1;  2K3R A;  5IP9 I;  2Q51 A;  3S16 I;  3CXC Z;  1QVG Z;  4RS4 A;  2PM9 A;  1Q82 1;  1VQ9 Z;  4MD8 A;  1VLA A;  2KPI A;  2RPR A;  3GTJ I;  3GTK I;  2AKL A;  1NJI 1;  3CC2 Z;  2RHB A;  4EWC A;  4RVH A;  2E2H I;  3ESW A;  5C3E I;  2JS4 A;  4RVF A;  1S72 Z;  3S2H I;  1QVF Y;  3J80 b;  1YUA A;  4A3L I;  1VQK 1;  1Z01 A;  2ZAE B;  1QVF Z;  1KC8 2;  4A3E I;  3GCF A;  4A3I I;  3GTP I;  2EGT A;  1VQ9 1;  2QA4 Z;  1VQP Z;  3J80 f;  2RBL A;  3I4M I;  2K5R A;  3CD6 1;  3CCM Z;  3CC2 1;  3NH8 A;  3S15 I;  3U50 C;  1S72 1;  1RO4 A;  3CCE Z;  3CC7 Z;  2JR6 A;  3H0G I;  5T64 A;  3GTL I;  4NBC A;  1I3Q I;  3HOU I;  4NB8 A;  3J81 b;  3G71 Z;  5C4X I;  4NOZ A;  4HH4 A;  1I6H I;  5IP7 I;  1JWH C;  4Y7N I;  2NVT I;  2YU9 I;  3HKZ A;  2QEX Z;  1VQP 1;  1NP6 A;  1PFT A;  1YUK A;  5T6B A;  3CCS Z;  2JA7 I;  5A2Q b;  3CCM 1;  3CCV Z;  3VMI A;  5IT9 b;  3J81 f;  1Q86 2;  1KD1 1;  3HOX I;  4NBD A;  3CCE 1;  2LIY A;  3CC7 1;  2RIQ A;  5D1O B;  5A2Q f;  1ZB8 A;  3RZD I;  4BY7 I;  1K83 I;  5IT9 f;  2Q4Z A;  4BBR I;  3BG1 B;  4E2X A;  3PO2 I;  2QEX 1;  2Y0S A;  4MXU A;  4DGL A;  4E2Z A;  4BBS I;  3JAM b;  1TWA I;  3CCS 1;  4X6A I;  2DE5 A;  3CCV 1;  2OZK A;  2BJO A;  3FKI I;  1VQ4 Z;  3OW2 Y;  3KIH A;  3CCL Z;  4NBB A;  3OW2 Z;  3JAM f;  2OTL Z;  4S1T A;  2QRC B;  1VQ7 Z;  2E2J I;  2H85 A;  1YJN 1;  3GTO I;  3RZO I;  4DQY B;  1TWF I;  1I50 I;  1TWG I;  1L1O C;  1N2F A;  2JUB A;  4NBE A;  2JNY A;  1Q81 2;  3CMA 1;  3NH5 A;  1K8A 1;  3CCJ 1;  3BG0 B;  4A3M I;  1K73 2;  1VQ4 1;  2P28 A;  5FLX b;  1YHQ Z;  1SFO I;  3HOY I;  2V8I A;  3PO3 S;  1M1K 1;  3CCL 1;  2LFU A;  1Y1V I;  2KI7 B;  2VUG A;  4BXX I;  2OTL 1;  2O4H A;  3NDI A;  1YJ9 Z;  1M90 1;  4MH4 A;  1N8R 2;  5C44 I;  1VQ7 1;  1ZH1 A;  2NVY I;  3Q87 A;  5FLX f;  1Q7Y 1;  3IX0 A;  2R93 I;  2QR1 B;  1VQ6 Z;  4E30 A;  1VQL Z;  3HOZ I;  1Z03 A;  2O53 A;  1K9M 2;  4AYB A;  1WII A;  2IZ3 A;  2W04 A;  1USP A;  1RNI A;  4A3J I;  1Y1W I;  1TWH I;  1YHQ 1;  1RQF A;  3EED A;  1VQO Z;  4CL1 A;  2VUM I;  4Y52 I;  1QYP A;  3S1M I;  4A3C I;  4RVD A;  4A3B I;  4NFR A;  1YJ9 1;  2R92 I;  4XX2 A;  2NVQ I;  2V8K A;  5T67 A;  2QA4 1;  1LQL A;  2M6N A;  1VQ6 1;  2HU9 A;  2WAQ A;  1VQL 1;  1Z02 A;  1Q82 2;  1Y1V S;  2F4M A;  3GTM I;  3I56 Z;  2JA5 I;  3CME Z;  3I07 A;  1VQN Z;  1NUI A;  2QRD B;  2E2I I;  3S17 I;  1YI2 Z;  4NBF A;  2GU2 A;  4NB9 A;  3G71 1;  3FQQ A;  3I4N I;  2GTH A;  1KC8 1;  1WW9 A;  2W03 A;  3F3F C;  3S1Q I;  1RO0 A;  3MZL B;  3NH4 A;  5D1P A;  4HGY A;  4BY1 I;  3VB9 A;  2I3C A;  3NDJ A;  2GTI A;  3I56 1;  4A3F I;  3J7A 4;  3I55 Z;  2OTJ Z;  1ML8 A;  3CME 1;  3NFZ A;  2IZ4 A;  2R6M A;  2G2K A;  1YIJ Z;  2OOX B;  2QLV B;  4HGZ A;  1RLY A;  1P9N A;  3S2D I;  2PK7 A;  1VQM Z;  4RV9 A;  1W2B Y;  3HOW I;  1X3Z A;  2E9H A;  2JA6 I;  3K7A I;  4MD7 A;  1YJW Z;  1W2B Z;  1YIT Z;  3G4S Z;  5LL6 f;  1Q86 1;  2J6A A;  3G6E Z;  2M48 A;  3I55 1;  2OTJ 1;  2QRE B;  2R7Z I;  1KD1 2;  3IF8 A;  3CD6 Z;  3VTN A;  2PMZ A;  3M3Y I;  5FLM I;  1YIJ 1;  1R9T I;  3EER A;  3F3P C;  2JA8 I;  4TNU A;  3D9X A;  4A3K I;  1VQM 1;  1VQ5 Z;  3CC4 Z;  4NH1 C;  3H3V J;  3QWU A;  1VQ8 Z;  1S7M A;  1YJW 1;  3P5J B;  4NBH A;  1YIT 1;  2DE6 A;  3G4S 1;  2P3Y A;  3GKQ A;  3CCU Z;  3GTQ I;  4A3G I;  3CCR Z;  4A93 I;  3G6E 1;  3TE5 B;  1USP B;  4E2W A;  3HOV I;  1ZB9 A;  2VF1 A;  3CC4 1;  1VQ5 1;  3D6W A;  2YAD A;  3S1R I;  3MON A;  4QTU A;  1JJ2 Y;  1VQ8 1;  2DE7 A;  4RVG A;  1Q81 1;  4E32 A;  5CM2 M;  4MD9 A;  1TFI A;  1NJI 2;  1JJ2 Z;  1QF8 A;  5AN9 F;  3CCU 1;  1VQO 1;  1RO2 A;  1K73 1;  3CCR 1;  1K8A 2;  2OOY B;  2WB1 A;  3LUS A;  1KQS Y;  3VMG A;  3T4N B;  3IFU A;  3S14 I;  3M4O I;  3FQM A;  5D1O A;  1M1K 2;  4A3D I;  1KQS Z;  4E33 A;  1TWC I;  1N8R 1;  3S1N I;  4MRI A;  5C4J I;  1M90 2;  3CCQ Z;  4E31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...