1VQ41

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq4100
3CCQZ 1S72Z 3CXCY 3CCLZ 3OW2Z 3CMEZ 1Q811 3CCMZ 2QEX1 1KQSY 1M902 1KD12 1VQLZ 3CCL1 3CCM1 1YJN1 3CPWZ 3CMAZ 2OTJZ 2OTLZ 3G4SZ 1Q812 1VQN1 3OW2Y 1VQM1 1Q7Y1 1VQPZ 1Q861 1VQ8Z 1NJI1 1YJ91 3I55Z 3G4S1 3CCRZ 3CCQ1 3CC7Z 3CC2Z 1S721 3CC4Z 1N8R1 1VQKZ 3CPWY 3CME1 1JJ2Y 1K9M1 3CCR1 3CCUZ 1W2BY 1KC82 3CC71 3CCVZ 1Q7Y2 3CD6Z 3CC21 1Q862 1NJI2 3CC41 1VQL1 1VQK1 1K8A1 1YIJZ 1YHQZ 3CCU1 1YI2Z 1KC81 1N8R2 3CCEZ 3CCSZ 3CMA1 3CD61 2OTJ1 2QA4Z 2OTL1 1VQ9Z 1QVGZ 1K9M2 1YITZ 1YIJ1 1VQ7Z 1K732 1M1K2 1Q821 1VQP1 3CCE1 1VQ81 1K8A2 1QVFZ 2QA41 1VQ91 2QEXZ 3I551 1YJWZ 1YIT1 1VQ5Z 1K731 1VQ4Z 3I56Z 1VQ71 1M1K1 3G6EZ 3G71Z 1VQOZ 3CXCZ 1YJNZ 1YJW1 1QVGY 3CCJZ 1VQ51 3CCV1 1Q822 3I561 1VQ41 3G6E1 1KQSZ 3G711 1VQ6Z 1VQO1 1YHQ1 1VQNZ 1M901 1QVFY 1KD11 1VQMZ 1YI21 3CCJ1 3CCS1 1JJ2Z 1YJ9Z 1VQ61 1W2BZ
chains in the Genus database with same CATH superfamily
2AYDA 3ESWA 5IP7I 1ZB8A 2K5RA 2V3VA 3CXCY 4HGYA 3OW2Z 3CMEZ 3CCMZ 2QEX1 1KQSY 1M902 1SFOI 3MZKB 4DGLA 1USPA 3CCL1 3S2HI 1YJN1 5T64A 3S1QI 4CL1A 5D1PA 1TFIA 1VQN1 4BXXI 2VPZA 2IZ4A 3T4NB 3I55Z 3CCRZ 2GTIA 1YUKA 1ZB9A 3CCQ1 1QF8A 1Y1WI 4A3EI 3CC4Z 1VQKZ 4QTTA 3FKII 4BY7I 4A3JI 2VUGA 5FLXf 3CCUZ 3U50C 4MD9A 1KC82 3CC71 3I4MI 3CD6Z 3M3YI 4DK1A 3GTQI 1K8A1 3QWUA 1WZNA 4S1TA 4A3KI 3PO3I 3CCEZ 2P28A 2OTL1 2JIOA 4A3GI 2RIQA 1YITZ 3BG0B 1YIJ1 1Z03A 2OOYB 5CM2M 2DE5A 4NBCA 4NBEA 1VQ81 3VMGA 2F4OA 3IFUA 2JA6I 2QEXZ 1VQ5Z 1K731 2RBLA 1VQ71 1M1K1 2IZ3A 3G6EZ 3G71Z 1YJNZ 3LUSA 1QVGY 3CCJZ 2QREB 1L1OC 3GTPI 2V8JA 1VQ6Z 5C4XI 1VQNZ 1Z01A 1KD11 2W03A 3CCS1 2R93I 2PM9A 3HOYI 2QRDB 3CCQZ 3IX0A 1RQFA 2JMOA 4MD8A 1FDIA 2WB1A 1Q811 2E9HA 3GTJI 4A3BI 3JAMb 2RT9A 5FLMI 3J7A4 2E2II 2K3RA 4HH4A 3VTNA 3BG1B 2EGTA 3GTMI 4E32A 3S1RI 2OTLZ 4MRIA 3PO2I 3MONA 2JA8I 1AA6A 1VQM1 1Z02A 1Q7Y1 1Q861 1VQ8Z 5C4JI 3PO3S 3D2LA 3G4S1 3J80f 3GTGI 2Y0SA 2LIYA 5A2Qf 3HKZA 1FDOA 1N8R1 2JIRA 2R6MA 4RV9A 3CPWY 3J80b 3CC21 2QRCB 4NBGA 5A2Qb 1NJI2 4RVGA 2O53A 3MZLB 2IV2X 4RVDA 3CCSZ 3CMA1 2OTJ1 2QA4Z 1VQ9Z 2JA5I 3HOXI 1K9M2 2ZAEB 1K732 3Q87A 2I3CA 1M1K2 3S1NI 5C44I 1WJ2A 3H3VJ 4BY1I 1VQ4Z 1YUAA 3NDIA 1VQOZ 3GCFA 3CXCZ 1YJW1 1WIIA 3CCV1 3I561 1Q822 3F3FC 2JNYA 1KQSZ 3S14I 3NDJA 2LEXA 3NH4A 4NBDA 1YHQ1 3GKQA 4BBSI 1M901 1QVFY 4MH4A 4EWCA 1VQMZ 1X0TA 1YI21 3NH8A 1K83I 3GTMS 4NBAA 4MXUA 5AN9F 3RZOI 2HU9A 3KIHA 3CCLZ 4A3CI 1TWFI 2J6AA 1N2FA 2HF1A 2YU9I 1TWAI 2JIQA 5T67A 4XX2A 5IP9I 3CCM1 2Q4ZA 3VB9A 2QKDA 2KPIA 3S15I 3CMAZ 2OTJZ 2E2JI 3HOWI 3S2DI 2GTHA 2QLVB 3JAMf 5C3EI 4A3FI 3OW2Y 2JUBA 3GTLI 3IR7A 2YADA 4QTUA 1YJ91 2OOXB 4X6AI 4NFRA 2BJOA 5LL6f 3HOZI 3CC7Z 2V8IA 1S721 3EERA 4HGZA 3FQQA 3TE5B 2GU2A 2KI7B 4A3DI 1RO2A 1RLYA 1TWHI 4E2XA 3CCR1 3F3PC 2VF1A 3CCVZ 4TNUA 3EEDA 4A3LI 3CQZI 3CC41 5IT9f 1X3ZA 1VQL1 1VQK1 1YIJZ 1YHQZ 2VUMI 3P5JB 3RZDI 3CCU1 1YI2Z 4E33A 5D1OB 3CD61 3S16I 1QVGZ 4E30A 3K7AI 5IT9b 1Q16A 1VQ7Z 2E2HI 2LFUA 3CCE1 1VQP1 1K8A2 2B63I 2VPYA 3NH5A 1YIT1 1ML8A 2NVQI 4NBFA 1P9NA 1QYPA 1NUIA 2RHBA 3HOVI 3S17I 1VQ51 3GTOI 1TWCI 1PFTA 1TWGI 2OZKA 3G6E1 2O4HA 4A3II 3G711 2R7ZI 3D6WA 4RVFA 2JIMA 3GTKI 1S7MA 4Y52I 1LQLA 3CCJ1 3KIFA 2QR1B 4E2ZA 1YJ9Z 4MONA 1RNIA 1VQ61 2G2KA 2Q51A 4RVHA 5T6BA 1KRLA 3VMHA 2VPXA 1S72Z 3S1MI 2V45A 3I07A 2RPRA 1KD12 1VLAA 4BBRI 1VQLZ 4RS4A 2M48A 3NFZA 4NB8A 4NBHA 4NH1C 3CPWZ 1SIWA 2V8KA 2R92I 4MD7A 3G4SZ 1Q812 2W04A 2VPWA 1JWHC 1I6HI 4A3MI 2WAQA 4NOZA 5FLXb 4E2YA 1VQPZ 1NJI1 2F4MA 3H0GI 1I50I 5D1OA 1X3WA 1USPB 1Y1VS 3M4OI 1ZH1A 3CC2Z 4AYBA 2PK7A 3CME1 1WW9A 1JJ2Y 1K9M1 4A93I 1W2BY 1RO4A 2NAPA 1Q7Y2 1Q862 4NBBA 1R9TI 3J81f 2M6NA 1KC81 1N8R2 3VMIA 2AKLA 4Y7NI 2DE7A 3J81b 2E7ZA 2PMZA 3IF8A 2JIPA 4E2WA 1Q821 1DL6A 3TDHB 2P3YA 1QVFZ 2QA41 1VQ91 2H85A 3I551 1YJWZ 4DQYB 3I56Z 1RO0A 3HOUI 2NVXI 2NVTI 2JA7I 1I3QI 3FQMA 4E31A 2DE6A 1VQ41 1Y1VI 2NVYI 4NB9A 2JR6A 1VQO1 3I4NI 3D9XA 1NP6A 1JJ2Z 1WCMI 1Y8CA 1QXFA 1W2BZ 2JS4A
chains in the Genus database with same CATH topology
3ESWA 5IP7I 1ZB8A 2K5RA 3CXCY 4HGYA 3OW2Z 3CMEZ 3CCMZ 2QEX1 1KQSY 1M902 1SFOI 3MZKB 4DGLA 1USPA 3CCL1 3S2HI 1YJN1 5T64A 3S1QI 4CL1A 5D1PA 1TFIA 1VQN1 4BXXI 2IZ4A 3T4NB 3I55Z 3CCRZ 2GTIA 1YUKA 1ZB9A 3CCQ1 1QF8A 1Y1WI 4A3EI 3CC4Z 1VQKZ 4QTTA 3FKII 4BY7I 4A3JI 2VUGA 5FLXf 3CCUZ 3U50C 4MD9A 1KC82 3CC71 3I4MI 3CD6Z 3M3YI 4DK1A 3GTQI 1K8A1 3QWUA 4S1TA 4A3KI 3PO3I 3CCEZ 2P28A 2OTL1 4A3GI 2RIQA 1YITZ 3BG0B 1YIJ1 1Z03A 2OOYB 5CM2M 2DE5A 4NBCA 4NBEA 1VQ81 3VMGA 2F4OA 3IFUA 2JA6I 2QEXZ 1VQ5Z 1K731 2RBLA 1VQ71 1M1K1 2IZ3A 3G6EZ 3G71Z 1YJNZ 3LUSA 1QVGY 3CCJZ 2QREB 1L1OC 3GTPI 2V8JA 1VQ6Z 5C4XI 1VQNZ 1Z01A 1KD11 2W03A 3CCS1 2R93I 2PM9A 3HOYI 2QRDB 3CCQZ 3IX0A 1RQFA 2JMOA 4MD8A 2WB1A 1Q811 2E9HA 3GTJI 4A3BI 3JAMb 2RT9A 5FLMI 3J7A4 2E2II 2K3RA 4HH4A 3VTNA 3BG1B 2EGTA 3GTMI 4E32A 3S1RI 2OTLZ 4MRIA 3PO2I 3MONA 2JA8I 1VQM1 1Z02A 1Q7Y1 1Q861 1VQ8Z 5C4JI 3PO3S 3G4S1 3J80f 3GTGI 2Y0SA 2LIYA 5A2Qf 3HKZA 1N8R1 2R6MA 4RV9A 3CPWY 3J80b 3CC21 2QRCB 4NBGA 5A2Qb 1NJI2 4RVGA 2O53A 3MZLB 4RVDA 3CCSZ 3CMA1 2OTJ1 2QA4Z 1VQ9Z 2JA5I 3HOXI 1K9M2 2ZAEB 1K732 3Q87A 2I3CA 1M1K2 3S1NI 5C44I 3H3VJ 4BY1I 1VQ4Z 1YUAA 3NDIA 1VQOZ 3GCFA 3CXCZ 1YJW1 1WIIA 3CCV1 3I561 1Q822 3F3FC 2JNYA 1KQSZ 3S14I 3NDJA 3NH4A 4NBDA 1YHQ1 3GKQA 4BBSI 1M901 1QVFY 4MH4A 4EWCA 1VQMZ 1X0TA 1YI21 3NH8A 1K83I 3GTMS 4NBAA 4MXUA 5AN9F 3RZOI 2HU9A 3KIHA 3CCLZ 4A3CI 1TWFI 2J6AA 1N2FA 2HF1A 2YU9I 1TWAI 5T67A 4XX2A 5IP9I 3CCM1 2Q4ZA 3VB9A 2QKDA 2KPIA 3S15I 3CMAZ 2OTJZ 2E2JI 3HOWI 3S2DI 2GTHA 2QLVB 3JAMf 5C3EI 4A3FI 3OW2Y 2JUBA 3GTLI 2YADA 4QTUA 1YJ91 2OOXB 4X6AI 4NFRA 2BJOA 5LL6f 3HOZI 3CC7Z 2V8IA 1S721 3EERA 4HGZA 3FQQA 3TE5B 2GU2A 2KI7B 4A3DI 1RO2A 1RLYA 1TWHI 4E2XA 3CCR1 3F3PC 2VF1A 3CCVZ 4TNUA 3EEDA 4A3LI 3CQZI 3CC41 5IT9f 1X3ZA 1VQL1 1VQK1 1YIJZ 1YHQZ 2VUMI 3P5JB 3RZDI 3CCU1 1YI2Z 4E33A 5D1OB 3CD61 3S16I 1QVGZ 4E30A 3K7AI 5IT9b 1VQ7Z 2E2HI 2LFUA 3CCE1 1VQP1 1K8A2 2B63I 3NH5A 1YIT1 1ML8A 2NVQI 4NBFA 1P9NA 1QYPA 1NUIA 2RHBA 3HOVI 3S17I 1VQ51 3GTOI 1TWCI 1PFTA 1TWGI 2OZKA 3G6E1 2O4HA 4A3II 3G711 2R7ZI 3D6WA 4RVFA 3GTKI 1S7MA 4Y52I 1LQLA 3CCJ1 3KIFA 2QR1B 4E2ZA 1YJ9Z 4MONA 1RNIA 1VQ61 2G2KA 2Q51A 4RVHA 5T6BA 1KRLA 3VMHA 1S72Z 3S1MI 3I07A 2RPRA 1KD12 1VLAA 4BBRI 1VQLZ 4RS4A 2M48A 3NFZA 4NB8A 4NBHA 4NH1C 3CPWZ 2V8KA 2R92I 4MD7A 3G4SZ 1Q812 2W04A 1JWHC 1I6HI 4A3MI 2WAQA 4NOZA 5FLXb 4E2YA 1VQPZ 1NJI1 2F4MA 3H0GI 1I50I 5D1OA 1X3WA 1USPB 1Y1VS 3M4OI 1ZH1A 3CC2Z 4AYBA 2PK7A 3CME1 1WW9A 1JJ2Y 1K9M1 4A93I 1W2BY 1RO4A 1Q7Y2 1Q862 4NBBA 1R9TI 3J81f 2M6NA 1KC81 1N8R2 3VMIA 2AKLA 4Y7NI 2DE7A 3IF8A 2PMZA 3J81b 4E2WA 1Q821 1DL6A 3TDHB 2P3YA 1QVFZ 2QA41 1VQ91 2H85A 3I551 1YJWZ 4DQYB 3I56Z 1RO0A 3HOUI 2NVXI 2NVTI 2JA7I 1I3QI 3FQMA 4E31A 2DE6A 1VQ41 1Y1VI 2NVYI 4NB9A 2JR6A 1VQO1 3I4NI 3D9XA 1NP6A 1JJ2Z 1WCMI 1W2BZ 2JS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ Z;  1S72 Z;  3CXC Y;  3CCL Z;  3OW2 Z;  3CME Z;  1Q81 1;  3CCM Z;  2QEX 1;  1KQS Y;  1M90 2;  1KD1 2;  1VQL Z;  3CCL 1;  3CCM 1;  1YJN 1;  3CPW Z;  3CMA Z;  2OTJ Z;  2OTL Z;  3G4S Z;  1Q81 2;  1VQN 1;  3OW2 Y;  1VQM 1;  1Q7Y 1;  1VQP Z;  1Q86 1;  1VQ8 Z;  1NJI 1;  1YJ9 1;  3I55 Z;  3G4S 1;  3CCR Z;  3CCQ 1;  3CC7 Z;  3CC2 Z;  1S72 1;  3CC4 Z;  1N8R 1;  1VQK Z;  3CPW Y;  3CME 1;  1JJ2 Y;  1K9M 1;  3CCR 1;  3CCU Z;  1W2B Y;  1KC8 2;  3CC7 1;  3CCV Z;  1Q7Y 2;  3CD6 Z;  3CC2 1;  1Q86 2;  1NJI 2;  3CC4 1;  1VQL 1;  1VQK 1;  1K8A 1;  1YIJ Z;  1YHQ Z;  3CCU 1;  1YI2 Z;  1KC8 1;  1N8R 2;  3CCE Z;  3CCS Z;  3CMA 1;  3CD6 1;  2OTJ 1;  2QA4 Z;  2OTL 1;  1VQ9 Z;  1QVG Z;  1K9M 2;  1YIT Z;  1YIJ 1;  1VQ7 Z;  1K73 2;  1M1K 2;  1Q82 1;  1VQP 1;  3CCE 1;  1VQ8 1;  1K8A 2;  1QVF Z;  2QA4 1;  1VQ9 1;  2QEX Z;  3I55 1;  1YJW Z;  1YIT 1;  1VQ5 Z;  1K73 1;  1VQ4 Z;  3I56 Z;  1VQ7 1;  1M1K 1;  3G6E Z;  3G71 Z;  1VQO Z;  3CXC Z;  1YJN Z;  1YJW 1;  1QVG Y;  3CCJ Z;  1VQ5 1;  3CCV 1;  1Q82 2;  3I56 1;  1VQ4 1;  3G6E 1;  1KQS Z;  3G71 1;  1VQ6 Z;  1VQO 1;  1YHQ 1;  1VQN Z;  1M90 1;  1QVF Y;  1KD1 1;  1VQM Z;  1YI2 1;  3CCJ 1;  3CCS 1;  1JJ2 Z;  1YJ9 Z;  1VQ6 1;  1W2B Z; 
#chains in the Genus database with same CATH topology
 2AYD A;  3ESW A;  5IP7 I;  1ZB8 A;  2K5R A;  2V3V A;  3CXC Y;  4HGY A;  3OW2 Z;  3CME Z;  3CCM Z;  2QEX 1;  1KQS Y;  1M90 2;  1SFO I;  3MZK B;  4DGL A;  1USP A;  3CCL 1;  3S2H I;  1YJN 1;  5T64 A;  3S1Q I;  4CL1 A;  5D1P A;  1TFI A;  1VQN 1;  4BXX I;  2VPZ A;  2IZ4 A;  3T4N B;  3I55 Z;  3CCR Z;  2GTI A;  1YUK A;  1ZB9 A;  3CCQ 1;  1QF8 A;  1Y1W I;  4A3E I;  3CC4 Z;  1VQK Z;  4QTT A;  3FKI I;  4BY7 I;  4A3J I;  2VUG A;  5FLX f;  3CCU Z;  3U50 C;  4MD9 A;  1KC8 2;  3CC7 1;  3I4M I;  3CD6 Z;  3M3Y I;  4DK1 A;  3GTQ I;  1K8A 1;  3QWU A;  1WZN A;  4S1T A;  4A3K I;  3PO3 I;  3CCE Z;  2P28 A;  2OTL 1;  2JIO A;  4A3G I;  2RIQ A;  1YIT Z;  3BG0 B;  1YIJ 1;  1Z03 A;  2OOY B;  5CM2 M;  2DE5 A;  4NBC A;  4NBE A;  1VQ8 1;  3VMG A;  2F4O A;  3IFU A;  2JA6 I;  2QEX Z;  1VQ5 Z;  1K73 1;  2RBL A;  1VQ7 1;  1M1K 1;  2IZ3 A;  3G6E Z;  3G71 Z;  1YJN Z;  3LUS A;  1QVG Y;  3CCJ Z;  2QRE B;  1L1O C;  3GTP I;  2V8J A;  1VQ6 Z;  5C4X I;  1VQN Z;  1Z01 A;  1KD1 1;  2W03 A;  3CCS 1;  2R93 I;  2PM9 A;  3HOY I;  2QRD B;  3CCQ Z;  3IX0 A;  1RQF A;  2JMO A;  4MD8 A;  1FDI A;  2WB1 A;  1Q81 1;  2E9H A;  3GTJ I;  4A3B I;  3JAM b;  2RT9 A;  5FLM I;  3J7A 4;  2E2I I;  2K3R A;  4HH4 A;  3VTN A;  3BG1 B;  2EGT A;  3GTM I;  4E32 A;  3S1R I;  2OTL Z;  4MRI A;  3PO2 I;  3MON A;  2JA8 I;  1AA6 A;  1VQM 1;  1Z02 A;  1Q7Y 1;  1Q86 1;  1VQ8 Z;  5C4J I;  3PO3 S;  3D2L A;  3G4S 1;  3J80 f;  3GTG I;  2Y0S A;  2LIY A;  5A2Q f;  3HKZ A;  1FDO A;  1N8R 1;  2JIR A;  2R6M A;  4RV9 A;  3CPW Y;  3J80 b;  3CC2 1;  2QRC B;  4NBG A;  5A2Q b;  1NJI 2;  4RVG A;  2O53 A;  3MZL B;  2IV2 X;  4RVD A;  3CCS Z;  3CMA 1;  2OTJ 1;  2QA4 Z;  1VQ9 Z;  2JA5 I;  3HOX I;  1K9M 2;  2ZAE B;  1K73 2;  3Q87 A;  2I3C A;  1M1K 2;  3S1N I;  5C44 I;  1WJ2 A;  3H3V J;  4BY1 I;  1VQ4 Z;  1YUA A;  3NDI A;  1VQO Z;  3GCF A;  3CXC Z;  1YJW 1;  1WII A;  3CCV 1;  3I56 1;  1Q82 2;  3F3F C;  2JNY A;  1KQS Z;  3S14 I;  3NDJ A;  2LEX A;  3NH4 A;  4NBD A;  1YHQ 1;  3GKQ A;  4BBS I;  1M90 1;  1QVF Y;  4MH4 A;  4EWC A;  1VQM Z;  1X0T A;  1YI2 1;  3NH8 A;  1K83 I;  3GTM S;  4NBA A;  4MXU A;  5AN9 F;  3RZO I;  2HU9 A;  3KIH A;  3CCL Z;  4A3C I;  1TWF I;  2J6A A;  1N2F A;  2HF1 A;  2YU9 I;  1TWA I;  2JIQ A;  5T67 A;  4XX2 A;  5IP9 I;  3CCM 1;  2Q4Z A;  3VB9 A;  2QKD A;  2KPI A;  3S15 I;  3CMA Z;  2OTJ Z;  2E2J I;  3HOW I;  3S2D I;  2GTH A;  2QLV B;  3JAM f;  5C3E I;  4A3F I;  3OW2 Y;  2JUB A;  3GTL I;  3IR7 A;  2YAD A;  4QTU A;  1YJ9 1;  2OOX B;  4X6A I;  4NFR A;  2BJO A;  5LL6 f;  3HOZ I;  3CC7 Z;  2V8I A;  1S72 1;  3EER A;  4HGZ A;  3FQQ A;  3TE5 B;  2GU2 A;  2KI7 B;  4A3D I;  1RO2 A;  1RLY A;  1TWH I;  4E2X A;  3CCR 1;  3F3P C;  2VF1 A;  3CCV Z;  4TNU A;  3EED A;  4A3L I;  3CQZ I;  3CC4 1;  5IT9 f;  1X3Z A;  1VQL 1;  1VQK 1;  1YIJ Z;  1YHQ Z;  2VUM I;  3P5J B;  3RZD I;  3CCU 1;  1YI2 Z;  4E33 A;  5D1O B;  3CD6 1;  3S16 I;  1QVG Z;  4E30 A;  3K7A I;  5IT9 b;  1Q16 A;  1VQ7 Z;  2E2H I;  2LFU A;  3CCE 1;  1VQP 1;  1K8A 2;  2B63 I;  2VPY A;  3NH5 A;  1YIT 1;  1ML8 A;  2NVQ I;  4NBF A;  1P9N A;  1QYP A;  1NUI A;  2RHB A;  3HOV I;  3S17 I;  1VQ5 1;  3GTO I;  1TWC I;  1PFT A;  1TWG I;  2OZK A;  3G6E 1;  2O4H A;  4A3I I;  3G71 1;  2R7Z I;  3D6W A;  4RVF A;  2JIM A;  3GTK I;  1S7M A;  4Y52 I;  1LQL A;  3CCJ 1;  3KIF A;  2QR1 B;  4E2Z A;  1YJ9 Z;  4MON A;  1RNI A;  1VQ6 1;  2G2K A;  2Q51 A;  4RVH A;  5T6B A;  1KRL A;  3VMH A;  2VPX A;  1S72 Z;  3S1M I;  2V45 A;  3I07 A;  2RPR A;  1KD1 2;  1VLA A;  4BBR I;  1VQL Z;  4RS4 A;  2M48 A;  3NFZ A;  4NB8 A;  4NBH A;  4NH1 C;  3CPW Z;  1SIW A;  2V8K A;  2R92 I;  4MD7 A;  3G4S Z;  1Q81 2;  2W04 A;  2VPW A;  1JWH C;  1I6H I;  4A3M I;  2WAQ A;  4NOZ A;  5FLX b;  4E2Y A;  1VQP Z;  1NJI 1;  2F4M A;  3H0G I;  1I50 I;  5D1O A;  1X3W A;  1USP B;  1Y1V S;  3M4O I;  1ZH1 A;  3CC2 Z;  4AYB A;  2PK7 A;  3CME 1;  1WW9 A;  1JJ2 Y;  1K9M 1;  4A93 I;  1W2B Y;  1RO4 A;  2NAP A;  1Q7Y 2;  1Q86 2;  4NBB A;  1R9T I;  3J81 f;  2M6N A;  1KC8 1;  1N8R 2;  3VMI A;  2AKL A;  4Y7N I;  2DE7 A;  3J81 b;  2E7Z A;  2PMZ A;  3IF8 A;  2JIP A;  4E2W A;  1Q82 1;  1DL6 A;  3TDH B;  2P3Y A;  1QVF Z;  2QA4 1;  1VQ9 1;  2H85 A;  3I55 1;  1YJW Z;  4DQY B;  3I56 Z;  1RO0 A;  3HOU I;  2NVX I;  2NVT I;  2JA7 I;  1I3Q I;  3FQM A;  4E31 A;  2DE6 A;  1VQ4 1;  1Y1V I;  2NVY I;  4NB9 A;  2JR6 A;  1VQO 1;  3I4N I;  3D9X A;  1NP6 A;  1JJ2 Z;  1WCM I;  1Y8C A;  1QXF A;  1W2B Z;  2JS4 A; 
#chains in the Genus database with same CATH homology
 3ESW A;  5IP7 I;  1ZB8 A;  2K5R A;  3CXC Y;  4HGY A;  3OW2 Z;  3CME Z;  3CCM Z;  2QEX 1;  1KQS Y;  1M90 2;  1SFO I;  3MZK B;  4DGL A;  1USP A;  3CCL 1;  3S2H I;  1YJN 1;  5T64 A;  3S1Q I;  4CL1 A;  5D1P A;  1TFI A;  1VQN 1;  4BXX I;  2IZ4 A;  3T4N B;  3I55 Z;  3CCR Z;  2GTI A;  1YUK A;  1ZB9 A;  3CCQ 1;  1QF8 A;  1Y1W I;  4A3E I;  3CC4 Z;  1VQK Z;  4QTT A;  3FKI I;  4BY7 I;  4A3J I;  2VUG A;  5FLX f;  3CCU Z;  3U50 C;  4MD9 A;  1KC8 2;  3CC7 1;  3I4M I;  3CD6 Z;  3M3Y I;  4DK1 A;  3GTQ I;  1K8A 1;  3QWU A;  4S1T A;  4A3K I;  3PO3 I;  3CCE Z;  2P28 A;  2OTL 1;  4A3G I;  2RIQ A;  1YIT Z;  3BG0 B;  1YIJ 1;  1Z03 A;  2OOY B;  5CM2 M;  2DE5 A;  4NBC A;  4NBE A;  1VQ8 1;  3VMG A;  2F4O A;  3IFU A;  2JA6 I;  2QEX Z;  1VQ5 Z;  1K73 1;  2RBL A;  1VQ7 1;  1M1K 1;  2IZ3 A;  3G6E Z;  3G71 Z;  1YJN Z;  3LUS A;  1QVG Y;  3CCJ Z;  2QRE B;  1L1O C;  3GTP I;  2V8J A;  1VQ6 Z;  5C4X I;  1VQN Z;  1Z01 A;  1KD1 1;  2W03 A;  3CCS 1;  2R93 I;  2PM9 A;  3HOY I;  2QRD B;  3CCQ Z;  3IX0 A;  1RQF A;  2JMO A;  4MD8 A;  2WB1 A;  1Q81 1;  2E9H A;  3GTJ I;  4A3B I;  3JAM b;  2RT9 A;  5FLM I;  3J7A 4;  2E2I I;  2K3R A;  4HH4 A;  3VTN A;  3BG1 B;  2EGT A;  3GTM I;  4E32 A;  3S1R I;  2OTL Z;  4MRI A;  3PO2 I;  3MON A;  2JA8 I;  1VQM 1;  1Z02 A;  1Q7Y 1;  1Q86 1;  1VQ8 Z;  5C4J I;  3PO3 S;  3G4S 1;  3J80 f;  3GTG I;  2Y0S A;  2LIY A;  5A2Q f;  3HKZ A;  1N8R 1;  2R6M A;  4RV9 A;  3CPW Y;  3J80 b;  3CC2 1;  2QRC B;  4NBG A;  5A2Q b;  1NJI 2;  4RVG A;  2O53 A;  3MZL B;  4RVD A;  3CCS Z;  3CMA 1;  2OTJ 1;  2QA4 Z;  1VQ9 Z;  2JA5 I;  3HOX I;  1K9M 2;  2ZAE B;  1K73 2;  3Q87 A;  2I3C A;  1M1K 2;  3S1N I;  5C44 I;  3H3V J;  4BY1 I;  1VQ4 Z;  1YUA A;  3NDI A;  1VQO Z;  3GCF A;  3CXC Z;  1YJW 1;  1WII A;  3CCV 1;  3I56 1;  1Q82 2;  3F3F C;  2JNY A;  1KQS Z;  3S14 I;  3NDJ A;  3NH4 A;  4NBD A;  1YHQ 1;  3GKQ A;  4BBS I;  1M90 1;  1QVF Y;  4MH4 A;  4EWC A;  1VQM Z;  1X0T A;  1YI2 1;  3NH8 A;  1K83 I;  3GTM S;  4NBA A;  4MXU A;  5AN9 F;  3RZO I;  2HU9 A;  3KIH A;  3CCL Z;  4A3C I;  1TWF I;  2J6A A;  1N2F A;  2HF1 A;  2YU9 I;  1TWA I;  5T67 A;  4XX2 A;  5IP9 I;  3CCM 1;  2Q4Z A;  3VB9 A;  2QKD A;  2KPI A;  3S15 I;  3CMA Z;  2OTJ Z;  2E2J I;  3HOW I;  3S2D I;  2GTH A;  2QLV B;  3JAM f;  5C3E I;  4A3F I;  3OW2 Y;  2JUB A;  3GTL I;  2YAD A;  4QTU A;  1YJ9 1;  2OOX B;  4X6A I;  4NFR A;  2BJO A;  5LL6 f;  3HOZ I;  3CC7 Z;  2V8I A;  1S72 1;  3EER A;  4HGZ A;  3FQQ A;  3TE5 B;  2GU2 A;  2KI7 B;  4A3D I;  1RO2 A;  1RLY A;  1TWH I;  4E2X A;  3CCR 1;  3F3P C;  2VF1 A;  3CCV Z;  4TNU A;  3EED A;  4A3L I;  3CQZ I;  3CC4 1;  5IT9 f;  1X3Z A;  1VQL 1;  1VQK 1;  1YIJ Z;  1YHQ Z;  2VUM I;  3P5J B;  3RZD I;  3CCU 1;  1YI2 Z;  4E33 A;  5D1O B;  3CD6 1;  3S16 I;  1QVG Z;  4E30 A;  3K7A I;  5IT9 b;  1VQ7 Z;  2E2H I;  2LFU A;  3CCE 1;  1VQP 1;  1K8A 2;  2B63 I;  3NH5 A;  1YIT 1;  1ML8 A;  2NVQ I;  4NBF A;  1P9N A;  1QYP A;  1NUI A;  2RHB A;  3HOV I;  3S17 I;  1VQ5 1;  3GTO I;  1TWC I;  1PFT A;  1TWG I;  2OZK A;  3G6E 1;  2O4H A;  4A3I I;  3G71 1;  2R7Z I;  3D6W A;  4RVF A;  3GTK I;  1S7M A;  4Y52 I;  1LQL A;  3CCJ 1;  3KIF A;  2QR1 B;  4E2Z A;  1YJ9 Z;  4MON A;  1RNI A;  1VQ6 1;  2G2K A;  2Q51 A;  4RVH A;  5T6B A;  1KRL A;  3VMH A;  1S72 Z;  3S1M I;  3I07 A;  2RPR A;  1KD1 2;  1VLA A;  4BBR I;  1VQL Z;  4RS4 A;  2M48 A;  3NFZ A;  4NB8 A;  4NBH A;  4NH1 C;  3CPW Z;  2V8K A;  2R92 I;  4MD7 A;  3G4S Z;  1Q81 2;  2W04 A;  1JWH C;  1I6H I;  4A3M I;  2WAQ A;  4NOZ A;  5FLX b;  4E2Y A;  1VQP Z;  1NJI 1;  2F4M A;  3H0G I;  1I50 I;  5D1O A;  1X3W A;  1USP B;  1Y1V S;  3M4O I;  1ZH1 A;  3CC2 Z;  4AYB A;  2PK7 A;  3CME 1;  1WW9 A;  1JJ2 Y;  1K9M 1;  4A93 I;  1W2B Y;  1RO4 A;  1Q7Y 2;  1Q86 2;  4NBB A;  1R9T I;  3J81 f;  2M6N A;  1KC8 1;  1N8R 2;  3VMI A;  2AKL A;  4Y7N I;  2DE7 A;  3IF8 A;  2PMZ A;  3J81 b;  4E2W A;  1Q82 1;  1DL6 A;  3TDH B;  2P3Y A;  1QVF Z;  2QA4 1;  1VQ9 1;  2H85 A;  3I55 1;  1YJW Z;  4DQY B;  3I56 Z;  1RO0 A;  3HOU I;  2NVX I;  2NVT I;  2JA7 I;  1I3Q I;  3FQM A;  4E31 A;  2DE6 A;  1VQ4 1;  1Y1V I;  2NVY I;  4NB9 A;  2JR6 A;  1VQO 1;  3I4N I;  3D9X A;  1NP6 A;  1JJ2 Z;  1WCM I;  1W2B Z;  2JS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...