1VQ41

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq4100
3G4S1 1KC82 1K9M1 1JJ2Y 3CCSZ 1Q7Y2 3CC71 2QA41 3CD6Z 1VQK1 3CC2Z 3CXCZ 3CCQZ 1S721 3G711 3CCR1 1YHQ1 1VQN1 3CCL1 1K8A1 3CCU1 3CCEZ 3CC7Z 3CD61 1Q861 1K8A2 1N8R1 1KQSZ 3CCMZ 1VQO1 1VQ81 1S72Z 3CCVZ 1YJ91 1M1K2 1VQ5Z 1VQM1 1VQKZ 1M1K1 3I561 1VQPZ 1YIJZ 3CCRZ 1VQLZ 1VQNZ 1K732 3CCV1 1VQ91 1YI21 3OW2Z 3CMAZ 3CXCY 3G6EZ 3CMEZ 3CCE1 3CME1 1KQSY 3CCLZ 3CC4Z 1QVFY 1Q811 1YJN1 1QVGZ 3CMA1 1VQ61 1VQ6Z 1YIT1 1W2BY 1Q821 3CC41 1Q812 1Q7Y1 2OTLZ 1YJW1 1YITZ 1KD12 1M901 1K731 3OW2Y 1NJI2 1N8R2 3CCJZ 3G6E1 3CCUZ 1Q862 2QEXZ 1VQ41 3CPWY 1VQ9Z 1NJI1 1YI2Z 1KD11 1VQ8Z 1JJ2Z 1VQP1 1YJWZ 3I56Z 2QA4Z 3CCJ1 2OTJ1 2OTJZ 3CCS1 1VQMZ 1W2BZ 3G71Z 1Q822 3CCQ1 1VQ71 1VQL1 1VQ7Z 1YIJ1 1YJNZ 2OTL1 1QVFZ 1KC81 1K9M2 3G4SZ 1YHQZ 1YJ9Z 1M902 1VQ51 3CCM1 3I551 3I55Z 3CPWZ 2QEX1 3CC21 1VQ4Z 1QVGY 1VQOZ
chains in the Genus database with same CATH superfamily
1K9M1 4NH1C 1RO4A 3Q87A 3QWUA 1VQK1 3GCFA 3CC2Z 4A3LI 3NH5A 2E2II 3RZDI 3CCR1 2ZAEB 1WZNA 2E2HI 2Y0SA 4A3BI 3BG1B 3CCEZ 3CD61 2H85A 3GTLI 1Q861 2DE7A 5A2Qf 3GTMS 1S72Z 5IP9I 4HGZA 1TWFI 2I3CA 2O53A 2JIOA 1M1K1 2PK7A 3S17I 2PM9A 1Z01A 5C44I 2JUBA 1VQNZ 4NBGA 1VQ91 4NB8A 2P3YA 1YI21 3CXCY 3NDIA 1X0TA 3S1NI 1USPA 2JMOA 1Y1VS 1QVFY 1Q811 1TWGI 4NOZA 1QVGZ 3EEDA 2IZ3A 1VQ6Z 4TNUA 2V8JA 1RLYA 3CC41 1Q812 2QR1B 1Q7Y1 1NUIA 3P5JB 4NFRA 3S2HI 1KD12 1R9TI 4MD7A 2HU9A 1QXFA 4E2XA 3D6WA 1USPB 2OOXB 3JAMf 3HOVI 3CCJZ 3CPWY 2M6NA 3D2LA 4DK1A 2K5RA 5A2Qb 1VQ8Z 1RO2A 3I56Z 3MONA 4RVGA 3CCJ1 2W04A 4RV9A 2IZ4A 3S14I 1RQFA 2G2KA 4CL1A 3GKQA 1Q822 2VF1A 3CQZI 2JA6I 1VQ71 5C3EI 2RHBA 1WCMI 2JIQA 1YIJ1 2NVTI 1QVFZ 4A3II 3G4SZ 3M3YI 1YHQZ 2YU9I 1YJ9Z 3MZLB 4E2WA 2VPXA 1Z03A 1JJ2Y 4A3CI 2E7ZA 1VLAA 3S2DI 3CD6Z 3PO2I 1DL6A 2V3VA 3J80f 2IV2X 2P28A 3CCQZ 3G711 1VQN1 3CCL1 2LEXA 4A3KI 3JAMb 3M4OI 3HOUI 2QLVB 4MD9A 1VQ5Z 3GTGI 5D1OA 4NBHA 3F3PC 3I561 4NBAA 1VQLZ 3IFUA 3HOZI 3CCV1 2JIPA 3TDHB 1ZH1A 4A3JI 1KRLA 4DGLA 3GTMI 3IF8A 4A3GI 2V8IA 2QRCB 2NVQI 1W2BY 1Q821 3NH4A 3H0GI 1TWCI 1ZB8A 2J6AA 4A3MI 2NAPA 1AA6A 4E2YA 3HOXI 4RVFA 2JNYA 3GTKI 4NBBA 3K7AI 4MD8A 2R7ZI 1Y8CA 1JWHC 3TE5B 1L1OC 2VUGA 1Q862 1YI2Z 4E31A 1KD11 1TWAI 2QKDA 1PFTA 2OTJ1 2OTJZ 1TWHI 3CCS1 2QREB 2JS4A 4XX2A 2JA5I 3CCQ1 2BJOA 1VQ7Z 2KPIA 2OOYB 3IR7A 1K83I 3J81b 1K9M2 1WIIA 2V45A 1N2FA 2AYDA 1Z02A 3CC21 3I4NI 5FLXf 2JIMA 1VQOZ 2VPZA 1KC82 4EWCA 3S1QI 3HKZA 1Q7Y2 3CC71 2RIQA 3FQMA 2W03A 1RO0A 1YHQ1 3CCU1 2LFUA 3I07A 3CCMZ 1VQ81 2Q51A 3CCVZ 2Q4ZA 1VQKZ 1I3QI 5T6BA 1ML8A 1WJ2A 1P9NA 3CCRZ 3S15I 2JA7I 3GTPI 3U50C 2O4HA 1TFIA 3OW2Z 4BY1I 1SFOI 3BG0B 3G6EZ 3KIFA 5LL6f 4QTTA 4X6AI 3CME1 1KQSY 2R93I 3VB9A 4NBCA 4A3DI 2LIYA 5CM2M 3J80b 3CMA1 1I50I 3F3FC 4E33A 2RT9A 4E2ZA 1FDIA 3J7A4 2OTLZ 4RS4A 2M48A 2NVYI 5D1PA 3EERA 3OW2Y 1NJI2 5AN9F 1N8R2 3FKII 3VMGA 1RNIA 3ESWA 3CCUZ 2QEXZ 1VQ9Z 2NVXI 1X3ZA 4MXUA 4BY7I 5IT9b 1JJ2Z 3MZKB 2K3RA 2QA4Z 3S16I 4BBRI 2YADA 4DQYB 4BBSI 1VQMZ 1FDOA 1LQLA 2DE6A 3G71Z 4E30A 1VQL1 3PO3S 1YJNZ 2WAQA 2HF1A 1YUAA 3RZOI 2GTHA 3HOWI 1M902 1QYPA 4NBEA 3I551 1Q16A 1VQ4Z 4QTUA 3D9XA 1QVGY 3S1MI 3CCM1 3G4S1 3PO3I 4NBDA 5D1OB 4NB9A 2R6MA 3J81f 4RVHA 3CCSZ 2QA41 5FLXb 3CXCZ 5FLMI 1S7MA 1S721 3NDJA 1K8A1 2B63I 3HOYI 2VUMI 3CC7Z 3KIHA 2JIRA 2E2JI 1K8A2 3I4MI 1N8R1 1KQSZ 1VQO1 1X3WA 4RVDA 2EGTA 1YJ91 1M1K2 3VMIA 1VQM1 2GTIA 2JA8I 4BXXI 1NP6A 1VQPZ 3T4NB 1YIJZ 5IP7I 1K732 2F4OA 2VPWA 5T64A 3CMAZ 2OZKA 2RBLA 3CMEZ 3CCE1 4A3EI 3CCLZ 3CC4Z 2E9HA 1WW9A 1YJN1 2AKLA 1VQ61 4MRIA 1YIT1 3GTJI 1ZB9A 3GTQI 2PMZA 2JR6A 2QRDB 5C4XI 2KI7B 4AYBA 1YJW1 4Y52I 4NBFA 1YITZ 4Y7NI 1YUKA 3LUSA 1M901 1K731 4S1TA 3NFZA 3G6E1 2F4MA 1VQ41 5C4JI 3IX0A 1NJI1 1QF8A 3VMHA 1Y1WI 4A3FI 1I6HI 4HH4A 1VQP1 5T67A 2VPYA 1Y1VI 3VTNA 1YJWZ 2GU2A 1W2BZ 4A93I 3FQQA 4MH4A 4MONA 2R92I 3NH8A 2DE5A 4E32A 5IT9f 3H3VJ 2OTL1 3S1RI 1KC81 2V8KA 2RPRA 4HGYA 3GTOI 1VQ51 3I55Z 3CPWZ 2QEX1 2WB1A 1SIWA
chains in the Genus database with same CATH topology
1K9M1 4NH1C 1RO4A 3Q87A 3QWUA 1VQK1 3GCFA 3CC2Z 4A3LI 3NH5A 2E2II 3RZDI 3CCR1 2ZAEB 2E2HI 2Y0SA 4A3BI 3BG1B 3CCEZ 3CD61 2H85A 3GTLI 1Q861 2DE7A 5A2Qf 3GTMS 1S72Z 5IP9I 4HGZA 1TWFI 2I3CA 2O53A 1M1K1 2PK7A 3S17I 2PM9A 1Z01A 5C44I 2JUBA 1VQNZ 4NBGA 1VQ91 4NB8A 2P3YA 1YI21 3CXCY 3NDIA 1X0TA 3S1NI 1USPA 2JMOA 1Y1VS 1QVFY 1Q811 1TWGI 4NOZA 1QVGZ 3EEDA 2IZ3A 1VQ6Z 4TNUA 2V8JA 1RLYA 3CC41 1Q812 2QR1B 1Q7Y1 1NUIA 3P5JB 4NFRA 3S2HI 1KD12 1R9TI 4MD7A 2HU9A 4E2XA 3D6WA 1USPB 2OOXB 3JAMf 3HOVI 3CCJZ 3CPWY 2M6NA 4DK1A 2K5RA 5A2Qb 1VQ8Z 1RO2A 3I56Z 3MONA 4RVGA 3CCJ1 2W04A 4RV9A 2IZ4A 3S14I 1RQFA 2G2KA 4CL1A 3GKQA 1Q822 2VF1A 3CQZI 2JA6I 1VQ71 5C3EI 2RHBA 1WCMI 1YIJ1 2NVTI 1QVFZ 4A3II 3G4SZ 3M3YI 1YHQZ 2YU9I 1YJ9Z 3MZLB 4E2WA 1Z03A 1JJ2Y 4A3CI 1VLAA 3S2DI 3CD6Z 3PO2I 1DL6A 3J80f 2P28A 3CCQZ 3G711 1VQN1 3CCL1 4A3KI 3JAMb 3M4OI 3HOUI 2QLVB 4MD9A 1VQ5Z 3GTGI 5D1OA 4NBHA 3F3PC 3I561 4NBAA 1VQLZ 3IFUA 3HOZI 3CCV1 3TDHB 1ZH1A 4A3JI 1KRLA 4DGLA 3GTMI 3IF8A 4A3GI 2V8IA 2QRCB 2NVQI 1W2BY 1Q821 3NH4A 3H0GI 1TWCI 1ZB8A 2J6AA 4A3MI 4E2YA 3HOXI 4RVFA 2JNYA 3GTKI 4NBBA 3K7AI 4MD8A 2R7ZI 1JWHC 3TE5B 1L1OC 2VUGA 1Q862 1YI2Z 4E31A 1KD11 1TWAI 2QKDA 1PFTA 2OTJ1 2OTJZ 1TWHI 3CCS1 2QREB 2JS4A 4XX2A 2JA5I 3CCQ1 2BJOA 1VQ7Z 2KPIA 2OOYB 1K83I 3J81b 1K9M2 1WIIA 1N2FA 1Z02A 3CC21 3I4NI 5FLXf 1VQOZ 1KC82 4EWCA 3S1QI 3HKZA 1Q7Y2 3CC71 2RIQA 3FQMA 2W03A 1RO0A 1YHQ1 3CCU1 2LFUA 3I07A 3CCMZ 1VQ81 2Q51A 3CCVZ 2Q4ZA 1VQKZ 1I3QI 5T6BA 1ML8A 1P9NA 3CCRZ 3S15I 2JA7I 3GTPI 3U50C 2O4HA 1TFIA 3OW2Z 4BY1I 1SFOI 3BG0B 3G6EZ 3KIFA 5LL6f 4QTTA 4X6AI 3CME1 1KQSY 2R93I 3VB9A 4NBCA 4A3DI 2LIYA 5CM2M 3J80b 3CMA1 1I50I 3F3FC 4E33A 2RT9A 4E2ZA 3J7A4 2OTLZ 4RS4A 2M48A 2NVYI 5D1PA 3EERA 3OW2Y 1NJI2 5AN9F 1N8R2 3FKII 3VMGA 1RNIA 3ESWA 3CCUZ 2QEXZ 1VQ9Z 2NVXI 1X3ZA 4MXUA 4BY7I 5IT9b 1JJ2Z 3MZKB 2K3RA 2QA4Z 3S16I 4BBRI 2YADA 4DQYB 4BBSI 1VQMZ 1LQLA 2DE6A 3G71Z 4E30A 1VQL1 3PO3S 1YJNZ 2WAQA 2HF1A 1YUAA 3RZOI 2GTHA 3HOWI 1M902 1QYPA 4NBEA 3I551 1VQ4Z 4QTUA 1QVGY 3D9XA 3S1MI 3CCM1 3G4S1 3PO3I 4NBDA 5D1OB 4NB9A 2R6MA 3J81f 4RVHA 3CCSZ 2QA41 5FLXb 3CXCZ 5FLMI 1S7MA 1S721 3NDJA 1K8A1 2B63I 3HOYI 2VUMI 3CC7Z 3KIHA 2E2JI 1K8A2 3I4MI 1N8R1 1KQSZ 1VQO1 1X3WA 4RVDA 2EGTA 1YJ91 1M1K2 3VMIA 1VQM1 2GTIA 2JA8I 4BXXI 1NP6A 1VQPZ 3T4NB 1YIJZ 5IP7I 1K732 2F4OA 5T64A 3CMAZ 2OZKA 2RBLA 3CMEZ 3CCE1 4A3EI 3CCLZ 3CC4Z 2E9HA 1WW9A 1YJN1 2AKLA 1VQ61 4MRIA 1YIT1 3GTJI 1ZB9A 3GTQI 2PMZA 2JR6A 2QRDB 5C4XI 2KI7B 4AYBA 1YJW1 4Y52I 4NBFA 1YITZ 4Y7NI 1YUKA 3LUSA 1M901 1K731 4S1TA 3NFZA 3G6E1 2F4MA 1VQ41 5C4JI 3IX0A 1NJI1 1QF8A 3VMHA 1Y1WI 4A3FI 1I6HI 4HH4A 1VQP1 5T67A 1YJWZ 1Y1VI 3VTNA 2GU2A 1W2BZ 4A93I 3FQQA 4MH4A 4MONA 2R92I 3NH8A 2DE5A 4E32A 5IT9f 3H3VJ 2OTL1 3S1RI 1KC81 2V8KA 2RPRA 4HGYA 3GTOI 1VQ51 3I55Z 3CPWZ 2QEX1 2WB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S 1;  1KC8 2;  1K9M 1;  1JJ2 Y;  3CCS Z;  1Q7Y 2;  3CC7 1;  2QA4 1;  3CD6 Z;  1VQK 1;  3CC2 Z;  3CXC Z;  3CCQ Z;  1S72 1;  3G71 1;  3CCR 1;  1YHQ 1;  1VQN 1;  3CCL 1;  1K8A 1;  3CCU 1;  3CCE Z;  3CC7 Z;  3CD6 1;  1Q86 1;  1K8A 2;  1N8R 1;  1KQS Z;  3CCM Z;  1VQO 1;  1VQ8 1;  1S72 Z;  3CCV Z;  1YJ9 1;  1M1K 2;  1VQ5 Z;  1VQM 1;  1VQK Z;  1M1K 1;  3I56 1;  1VQP Z;  1YIJ Z;  3CCR Z;  1VQL Z;  1VQN Z;  1K73 2;  3CCV 1;  1VQ9 1;  1YI2 1;  3OW2 Z;  3CMA Z;  3CXC Y;  3G6E Z;  3CME Z;  3CCE 1;  3CME 1;  1KQS Y;  3CCL Z;  3CC4 Z;  1QVF Y;  1Q81 1;  1YJN 1;  1QVG Z;  3CMA 1;  1VQ6 1;  1VQ6 Z;  1YIT 1;  1W2B Y;  1Q82 1;  3CC4 1;  1Q81 2;  1Q7Y 1;  2OTL Z;  1YJW 1;  1YIT Z;  1KD1 2;  1M90 1;  1K73 1;  3OW2 Y;  1NJI 2;  1N8R 2;  3CCJ Z;  3G6E 1;  3CCU Z;  1Q86 2;  2QEX Z;  1VQ4 1;  3CPW Y;  1VQ9 Z;  1NJI 1;  1YI2 Z;  1KD1 1;  1VQ8 Z;  1JJ2 Z;  1VQP 1;  1YJW Z;  3I56 Z;  2QA4 Z;  3CCJ 1;  2OTJ 1;  2OTJ Z;  3CCS 1;  1VQM Z;  1W2B Z;  3G71 Z;  1Q82 2;  3CCQ 1;  1VQ7 1;  1VQL 1;  1VQ7 Z;  1YIJ 1;  1YJN Z;  2OTL 1;  1QVF Z;  1KC8 1;  1K9M 2;  3G4S Z;  1YHQ Z;  1YJ9 Z;  1M90 2;  1VQ5 1;  3CCM 1;  3I55 1;  3I55 Z;  3CPW Z;  2QEX 1;  3CC2 1;  1VQ4 Z;  1QVG Y;  1VQO Z; 
#chains in the Genus database with same CATH topology
 1K9M 1;  4NH1 C;  1RO4 A;  3Q87 A;  3QWU A;  1VQK 1;  3GCF A;  3CC2 Z;  4A3L I;  3NH5 A;  2E2I I;  3RZD I;  3CCR 1;  2ZAE B;  1WZN A;  2E2H I;  2Y0S A;  4A3B I;  3BG1 B;  3CCE Z;  3CD6 1;  2H85 A;  3GTL I;  1Q86 1;  2DE7 A;  5A2Q f;  3GTM S;  1S72 Z;  5IP9 I;  4HGZ A;  1TWF I;  2I3C A;  2O53 A;  2JIO A;  1M1K 1;  2PK7 A;  3S17 I;  2PM9 A;  1Z01 A;  5C44 I;  2JUB A;  1VQN Z;  4NBG A;  1VQ9 1;  4NB8 A;  2P3Y A;  1YI2 1;  3CXC Y;  3NDI A;  1X0T A;  3S1N I;  1USP A;  2JMO A;  1Y1V S;  1QVF Y;  1Q81 1;  1TWG I;  4NOZ A;  1QVG Z;  3EED A;  2IZ3 A;  1VQ6 Z;  4TNU A;  2V8J A;  1RLY A;  3CC4 1;  1Q81 2;  2QR1 B;  1Q7Y 1;  1NUI A;  3P5J B;  4NFR A;  3S2H I;  1KD1 2;  1R9T I;  4MD7 A;  2HU9 A;  1QXF A;  4E2X A;  3D6W A;  1USP B;  2OOX B;  3JAM f;  3HOV I;  3CCJ Z;  3CPW Y;  2M6N A;  3D2L A;  4DK1 A;  2K5R A;  5A2Q b;  1VQ8 Z;  1RO2 A;  3I56 Z;  3MON A;  4RVG A;  3CCJ 1;  2W04 A;  4RV9 A;  2IZ4 A;  3S14 I;  1RQF A;  2G2K A;  4CL1 A;  3GKQ A;  1Q82 2;  2VF1 A;  3CQZ I;  2JA6 I;  1VQ7 1;  5C3E I;  2RHB A;  1WCM I;  2JIQ A;  1YIJ 1;  2NVT I;  1QVF Z;  4A3I I;  3G4S Z;  3M3Y I;  1YHQ Z;  2YU9 I;  1YJ9 Z;  3MZL B;  4E2W A;  2VPX A;  1Z03 A;  1JJ2 Y;  4A3C I;  2E7Z A;  1VLA A;  3S2D I;  3CD6 Z;  3PO2 I;  1DL6 A;  2V3V A;  3J80 f;  2IV2 X;  2P28 A;  3CCQ Z;  3G71 1;  1VQN 1;  3CCL 1;  2LEX A;  4A3K I;  3JAM b;  3M4O I;  3HOU I;  2QLV B;  4MD9 A;  1VQ5 Z;  3GTG I;  5D1O A;  4NBH A;  3F3P C;  3I56 1;  4NBA A;  1VQL Z;  3IFU A;  3HOZ I;  3CCV 1;  2JIP A;  3TDH B;  1ZH1 A;  4A3J I;  1KRL A;  4DGL A;  3GTM I;  3IF8 A;  4A3G I;  2V8I A;  2QRC B;  2NVQ I;  1W2B Y;  1Q82 1;  3NH4 A;  3H0G I;  1TWC I;  1ZB8 A;  2J6A A;  4A3M I;  2NAP A;  1AA6 A;  4E2Y A;  3HOX I;  4RVF A;  2JNY A;  3GTK I;  4NBB A;  3K7A I;  4MD8 A;  2R7Z I;  1Y8C A;  1JWH C;  3TE5 B;  1L1O C;  2VUG A;  1Q86 2;  1YI2 Z;  4E31 A;  1KD1 1;  1TWA I;  2QKD A;  1PFT A;  2OTJ 1;  2OTJ Z;  1TWH I;  3CCS 1;  2QRE B;  2JS4 A;  4XX2 A;  2JA5 I;  3CCQ 1;  2BJO A;  1VQ7 Z;  2KPI A;  2OOY B;  3IR7 A;  1K83 I;  3J81 b;  1K9M 2;  1WII A;  2V45 A;  1N2F A;  2AYD A;  1Z02 A;  3CC2 1;  3I4N I;  5FLX f;  2JIM A;  1VQO Z;  2VPZ A;  1KC8 2;  4EWC A;  3S1Q I;  3HKZ A;  1Q7Y 2;  3CC7 1;  2RIQ A;  3FQM A;  2W03 A;  1RO0 A;  1YHQ 1;  3CCU 1;  2LFU A;  3I07 A;  3CCM Z;  1VQ8 1;  2Q51 A;  3CCV Z;  2Q4Z A;  1VQK Z;  1I3Q I;  5T6B A;  1ML8 A;  1WJ2 A;  1P9N A;  3CCR Z;  3S15 I;  2JA7 I;  3GTP I;  3U50 C;  2O4H A;  1TFI A;  3OW2 Z;  4BY1 I;  1SFO I;  3BG0 B;  3G6E Z;  3KIF A;  5LL6 f;  4QTT A;  4X6A I;  3CME 1;  1KQS Y;  2R93 I;  3VB9 A;  4NBC A;  4A3D I;  2LIY A;  5CM2 M;  3J80 b;  3CMA 1;  1I50 I;  3F3F C;  4E33 A;  2RT9 A;  4E2Z A;  1FDI A;  3J7A 4;  2OTL Z;  4RS4 A;  2M48 A;  2NVY I;  5D1P A;  3EER A;  3OW2 Y;  1NJI 2;  5AN9 F;  1N8R 2;  3FKI I;  3VMG A;  1RNI A;  3ESW A;  3CCU Z;  2QEX Z;  1VQ9 Z;  2NVX I;  1X3Z A;  4MXU A;  4BY7 I;  5IT9 b;  1JJ2 Z;  3MZK B;  2K3R A;  2QA4 Z;  3S16 I;  4BBR I;  2YAD A;  4DQY B;  4BBS I;  1VQM Z;  1FDO A;  1LQL A;  2DE6 A;  3G71 Z;  4E30 A;  1VQL 1;  3PO3 S;  1YJN Z;  2WAQ A;  2HF1 A;  1YUA A;  3RZO I;  2GTH A;  3HOW I;  1M90 2;  1QYP A;  4NBE A;  3I55 1;  1Q16 A;  1VQ4 Z;  4QTU A;  3D9X A;  1QVG Y;  3S1M I;  3CCM 1;  3G4S 1;  3PO3 I;  4NBD A;  5D1O B;  4NB9 A;  2R6M A;  3J81 f;  4RVH A;  3CCS Z;  2QA4 1;  5FLX b;  3CXC Z;  5FLM I;  1S7M A;  1S72 1;  3NDJ A;  1K8A 1;  2B63 I;  3HOY I;  2VUM I;  3CC7 Z;  3KIH A;  2JIR A;  2E2J I;  1K8A 2;  3I4M I;  1N8R 1;  1KQS Z;  1VQO 1;  1X3W A;  4RVD A;  2EGT A;  1YJ9 1;  1M1K 2;  3VMI A;  1VQM 1;  2GTI A;  2JA8 I;  4BXX I;  1NP6 A;  1VQP Z;  3T4N B;  1YIJ Z;  5IP7 I;  1K73 2;  2F4O A;  2VPW A;  5T64 A;  3CMA Z;  2OZK A;  2RBL A;  3CME Z;  3CCE 1;  4A3E I;  3CCL Z;  3CC4 Z;  2E9H A;  1WW9 A;  1YJN 1;  2AKL A;  1VQ6 1;  4MRI A;  1YIT 1;  3GTJ I;  1ZB9 A;  3GTQ I;  2PMZ A;  2JR6 A;  2QRD B;  5C4X I;  2KI7 B;  4AYB A;  1YJW 1;  4Y52 I;  4NBF A;  1YIT Z;  4Y7N I;  1YUK A;  3LUS A;  1M90 1;  1K73 1;  4S1T A;  3NFZ A;  3G6E 1;  2F4M A;  1VQ4 1;  5C4J I;  3IX0 A;  1NJI 1;  1QF8 A;  3VMH A;  1Y1W I;  4A3F I;  1I6H I;  4HH4 A;  1VQP 1;  5T67 A;  2VPY A;  1Y1V I;  3VTN A;  1YJW Z;  2GU2 A;  1W2B Z;  4A93 I;  3FQQ A;  4MH4 A;  4MON A;  2R92 I;  3NH8 A;  2DE5 A;  4E32 A;  5IT9 f;  3H3V J;  2OTL 1;  3S1R I;  1KC8 1;  2V8K A;  2RPR A;  4HGY A;  3GTO I;  1VQ5 1;  3I55 Z;  3CPW Z;  2QEX 1;  2WB1 A;  1SIW A; 
#chains in the Genus database with same CATH homology
 1K9M 1;  4NH1 C;  1RO4 A;  3Q87 A;  3QWU A;  1VQK 1;  3GCF A;  3CC2 Z;  4A3L I;  3NH5 A;  2E2I I;  3RZD I;  3CCR 1;  2ZAE B;  2E2H I;  2Y0S A;  4A3B I;  3BG1 B;  3CCE Z;  3CD6 1;  2H85 A;  3GTL I;  1Q86 1;  2DE7 A;  5A2Q f;  3GTM S;  1S72 Z;  5IP9 I;  4HGZ A;  1TWF I;  2I3C A;  2O53 A;  1M1K 1;  2PK7 A;  3S17 I;  2PM9 A;  1Z01 A;  5C44 I;  2JUB A;  1VQN Z;  4NBG A;  1VQ9 1;  4NB8 A;  2P3Y A;  1YI2 1;  3CXC Y;  3NDI A;  1X0T A;  3S1N I;  1USP A;  2JMO A;  1Y1V S;  1QVF Y;  1Q81 1;  1TWG I;  4NOZ A;  1QVG Z;  3EED A;  2IZ3 A;  1VQ6 Z;  4TNU A;  2V8J A;  1RLY A;  3CC4 1;  1Q81 2;  2QR1 B;  1Q7Y 1;  1NUI A;  3P5J B;  4NFR A;  3S2H I;  1KD1 2;  1R9T I;  4MD7 A;  2HU9 A;  4E2X A;  3D6W A;  1USP B;  2OOX B;  3JAM f;  3HOV I;  3CCJ Z;  3CPW Y;  2M6N A;  4DK1 A;  2K5R A;  5A2Q b;  1VQ8 Z;  1RO2 A;  3I56 Z;  3MON A;  4RVG A;  3CCJ 1;  2W04 A;  4RV9 A;  2IZ4 A;  3S14 I;  1RQF A;  2G2K A;  4CL1 A;  3GKQ A;  1Q82 2;  2VF1 A;  3CQZ I;  2JA6 I;  1VQ7 1;  5C3E I;  2RHB A;  1WCM I;  1YIJ 1;  2NVT I;  1QVF Z;  4A3I I;  3G4S Z;  3M3Y I;  1YHQ Z;  2YU9 I;  1YJ9 Z;  3MZL B;  4E2W A;  1Z03 A;  1JJ2 Y;  4A3C I;  1VLA A;  3S2D I;  3CD6 Z;  3PO2 I;  1DL6 A;  3J80 f;  2P28 A;  3CCQ Z;  3G71 1;  1VQN 1;  3CCL 1;  4A3K I;  3JAM b;  3M4O I;  3HOU I;  2QLV B;  4MD9 A;  1VQ5 Z;  3GTG I;  5D1O A;  4NBH A;  3F3P C;  3I56 1;  4NBA A;  1VQL Z;  3IFU A;  3HOZ I;  3CCV 1;  3TDH B;  1ZH1 A;  4A3J I;  1KRL A;  4DGL A;  3GTM I;  3IF8 A;  4A3G I;  2V8I A;  2QRC B;  2NVQ I;  1W2B Y;  1Q82 1;  3NH4 A;  3H0G I;  1TWC I;  1ZB8 A;  2J6A A;  4A3M I;  4E2Y A;  3HOX I;  4RVF A;  2JNY A;  3GTK I;  4NBB A;  3K7A I;  4MD8 A;  2R7Z I;  1JWH C;  3TE5 B;  1L1O C;  2VUG A;  1Q86 2;  1YI2 Z;  4E31 A;  1KD1 1;  1TWA I;  2QKD A;  1PFT A;  2OTJ 1;  2OTJ Z;  1TWH I;  3CCS 1;  2QRE B;  2JS4 A;  4XX2 A;  2JA5 I;  3CCQ 1;  2BJO A;  1VQ7 Z;  2KPI A;  2OOY B;  1K83 I;  3J81 b;  1K9M 2;  1WII A;  1N2F A;  1Z02 A;  3CC2 1;  3I4N I;  5FLX f;  1VQO Z;  1KC8 2;  4EWC A;  3S1Q I;  3HKZ A;  1Q7Y 2;  3CC7 1;  2RIQ A;  3FQM A;  2W03 A;  1RO0 A;  1YHQ 1;  3CCU 1;  2LFU A;  3I07 A;  3CCM Z;  1VQ8 1;  2Q51 A;  3CCV Z;  2Q4Z A;  1VQK Z;  1I3Q I;  5T6B A;  1ML8 A;  1P9N A;  3CCR Z;  3S15 I;  2JA7 I;  3GTP I;  3U50 C;  2O4H A;  1TFI A;  3OW2 Z;  4BY1 I;  1SFO I;  3BG0 B;  3G6E Z;  3KIF A;  5LL6 f;  4QTT A;  4X6A I;  3CME 1;  1KQS Y;  2R93 I;  3VB9 A;  4NBC A;  4A3D I;  2LIY A;  5CM2 M;  3J80 b;  3CMA 1;  1I50 I;  3F3F C;  4E33 A;  2RT9 A;  4E2Z A;  3J7A 4;  2OTL Z;  4RS4 A;  2M48 A;  2NVY I;  5D1P A;  3EER A;  3OW2 Y;  1NJI 2;  5AN9 F;  1N8R 2;  3FKI I;  3VMG A;  1RNI A;  3ESW A;  3CCU Z;  2QEX Z;  1VQ9 Z;  2NVX I;  1X3Z A;  4MXU A;  4BY7 I;  5IT9 b;  1JJ2 Z;  3MZK B;  2K3R A;  2QA4 Z;  3S16 I;  4BBR I;  2YAD A;  4DQY B;  4BBS I;  1VQM Z;  1LQL A;  2DE6 A;  3G71 Z;  4E30 A;  1VQL 1;  3PO3 S;  1YJN Z;  2WAQ A;  2HF1 A;  1YUA A;  3RZO I;  2GTH A;  3HOW I;  1M90 2;  1QYP A;  4NBE A;  3I55 1;  1VQ4 Z;  4QTU A;  1QVG Y;  3D9X A;  3S1M I;  3CCM 1;  3G4S 1;  3PO3 I;  4NBD A;  5D1O B;  4NB9 A;  2R6M A;  3J81 f;  4RVH A;  3CCS Z;  2QA4 1;  5FLX b;  3CXC Z;  5FLM I;  1S7M A;  1S72 1;  3NDJ A;  1K8A 1;  2B63 I;  3HOY I;  2VUM I;  3CC7 Z;  3KIH A;  2E2J I;  1K8A 2;  3I4M I;  1N8R 1;  1KQS Z;  1VQO 1;  1X3W A;  4RVD A;  2EGT A;  1YJ9 1;  1M1K 2;  3VMI A;  1VQM 1;  2GTI A;  2JA8 I;  4BXX I;  1NP6 A;  1VQP Z;  3T4N B;  1YIJ Z;  5IP7 I;  1K73 2;  2F4O A;  5T64 A;  3CMA Z;  2OZK A;  2RBL A;  3CME Z;  3CCE 1;  4A3E I;  3CCL Z;  3CC4 Z;  2E9H A;  1WW9 A;  1YJN 1;  2AKL A;  1VQ6 1;  4MRI A;  1YIT 1;  3GTJ I;  1ZB9 A;  3GTQ I;  2PMZ A;  2JR6 A;  2QRD B;  5C4X I;  2KI7 B;  4AYB A;  1YJW 1;  4Y52 I;  4NBF A;  1YIT Z;  4Y7N I;  1YUK A;  3LUS A;  1M90 1;  1K73 1;  4S1T A;  3NFZ A;  3G6E 1;  2F4M A;  1VQ4 1;  5C4J I;  3IX0 A;  1NJI 1;  1QF8 A;  3VMH A;  1Y1W I;  4A3F I;  1I6H I;  4HH4 A;  1VQP 1;  5T67 A;  1YJW Z;  1Y1V I;  3VTN A;  2GU2 A;  1W2B Z;  4A93 I;  3FQQ A;  4MH4 A;  4MON A;  2R92 I;  3NH8 A;  2DE5 A;  4E32 A;  5IT9 f;  3H3V J;  2OTL 1;  3S1R I;  1KC8 1;  2V8K A;  2RPR A;  4HGY A;  3GTO I;  1VQ5 1;  3I55 Z;  3CPW Z;  2QEX 1;  2WB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...