1VQ41

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq4100
1YJNZ 3I55Z 1K731 1VQ91 2QA4Z 2QEX1 3CCJ1 3CCS1 3CC7Z 3OW2Y 1Q7Y2 1QVGZ 3CD61 3G6E1 1KQSZ 3CCE1 1VQOZ 1Q861 3CMAZ 1YJW1 3CCM1 1YIJZ 1W2BZ 3CCL1 3CCU1 1VQ71 3OW2Z 1VQ51 3CC71 1JJ2Y 3CCQ1 2OTJZ 1QVFY 3CC4Z 1M902 1VQPZ 1W2BY 1K732 1VQ81 1Q862 1VQLZ 3CCQZ 2OTJ1 1VQ5Z 1JJ2Z 1Q7Y1 1QVFZ 3CCLZ 3CPWZ 3CCEZ 3G71Z 1VQMZ 1VQK1 3CME1 1Q821 3G6EZ 3CD6Z 1VQL1 1VQ8Z 1N8R1 1YJN1 3CCR1 1K8A1 2QA41 3CC41 1KQSY 3I551 3CPWY 1YI21 1YIT1 1K8A2 3CC21 1M1K2 3CCV1 1N8R2 1Q822 1YJWZ 1S721 3CMA1 1VQNZ 1VQ7Z 3I561 3CCUZ 3I56Z 1YIJ1 1VQKZ 1VQM1 1S72Z 1KC82 2OTLZ 3CXCY 1VQO1 3G711 1M1K1 1KC81 1K9M2 3G4S1 1KD12 1YITZ 1K9M1 1VQN1 1YJ91 2QEXZ 1QVGY 1VQ6Z 1VQ9Z 1YJ9Z 3G4SZ 1Q812 1YHQZ 1VQ61 1YI2Z 3CMEZ 1M901 1VQ4Z 1Q811 1VQ41 2OTL1 3CCJZ 3CCSZ 1KD11 1YHQ1 1VQP1 3CCVZ 1NJI1 3CC2Z 1NJI2 3CXCZ 3CCRZ 3CCMZ
chains in the Genus database with same CATH superfamily
3I55Z 1VQ91 2QA4Z 2QLVB 2JIOA 1QYPA 1FDOA 2Y0SA 2O53A 3CD61 3G6E1 3CMAZ 2YADA 3I4NI 5D1PA 3FQMA 2JR6A 2V8IA 2JUBA 1RQFA 3CCM1 2R92I 3CCL1 5FLXf 1AA6A 2W04A 1X3ZA 3BG1B 1W2BY 2P3YA 1K732 3RZOI 4NBFA 1Y1VI 3GTOI 2JNYA 3CCLZ 1USPB 3CPWZ 3CCEZ 3G71Z 1Y1VS 5T6BA 2GTHA 1VQK1 3CD6Z 3JAMf 1VQL1 1Z01A 2DE5A 1YJN1 2LIYA 4E32A 2QA41 3RZDI 1Q16A 2R7ZI 1K8A2 3EEDA 3Q87A 1RO0A 1WCMI 4A3CI 3J81f 2JIPA 4RS4A 2HU9A 3GTPI 5C3EI 1VQNZ 3I561 4BBRI 3J7A4 2VF1A 1VQM1 2JA7I 1SFOI 5C4XI 2EGTA 1KC81 4E30A 2ZAEB 3KIFA 1VQ9Z 1L1OC 1DL6A 3VB9A 3G4SZ 1VQ61 3GTGI 3PO3S 2NVQI 3S15I 3I07A 5AN9F 2NVYI 2OTL1 4MRIA 4NB9A 3CCJZ 2K5RA 3S1MI 3HKZA 2Q51A 1X0TA 3T4NB 2PM9A 1RLYA 3GKQA 4HGYA 1Z02A 3HOXI 2OOXB 2PK7A 4NBEA 1YJNZ 1K731 4E31A 2QEX1 1I3QI 3MZLB 3CCS1 3KIHA 3IF8A 3OW2Y 1QVGZ 4RV9A 3PO3I 2RT9A 1USPA 3CCE1 4NBBA 3I4MI 2H85A 4EWCA 1W2BZ 3NFZA 1VQ51 1TFIA 1WIIA 4NOZA 3CC4Z 3IR7A 4NBCA 3IX0A 1VQPZ 2F4OA 2LFUA 4MXUA 1VQ81 3J81b 3CCQZ 2OTJ1 3NDJA 1JJ2Z 5IT9b 1VQMZ 2E9HA 3HOWI 3TDHB 1VQ8Z 2VUMI 4MD7A 3M4OI 2HF1A 1Y1WI 1K8A1 3CC41 3HOZI 2VUGA 4DQYB 4A3GI 2IZ4A 2V8JA 1M1K2 4NBAA 3CCV1 2IZ3A 4HGZA 5CM2M 1ZH1A 1I50I 3NH4A 1QXFA 1YJWZ 2I3CA 2V3VA 2QKDA 3I56Z 1YIJ1 1KC82 2OTLZ 4E2WA 3G711 2VPZA 5IP9I 1M1K1 2DE6A 2AKLA 4RVGA 2DE7A 1TWCI 1YITZ 5IP7I 1K9M1 1N2FA 1QVGY 4A3MI 1VQ6Z 2M6NA 1YHQZ 1ML8A 1YI2Z 3VTNA 1P9NA 2E2II 4A3KI 2RPRA 1TWHI 3D2LA 2G2KA 5FLXb 4BBSI 3CC2Z 4Y7NI 4E2XA 3CXCZ 3CCRZ 3P5JB 3CCMZ 4MH4A 2KPIA 2YU9I 3CCJ1 3CC7Z 3J80b 4BY1I 2RIQA 1VQOZ 2E2JI 3F3PC 3JAMb 2QR1B 2GTIA 1JJ2Y 2J6AA 1M902 2JA8I 3HOYI 1Q862 1VQLZ 2QRCB 2M48A 5C4JI 1Q7Y1 1Y8CA 1QF8A 4DK1A 1QVFZ 2P28A 3EERA 3S14I 2OZKA 3S2HI 4RVFA 3G6EZ 4E2ZA 4A3JI 1N8R1 4QTUA 1WJ2A 3S1NI 4Y52I 3MZKB 1PFTA 1KQSY 1SIWA 1ZB8A 3I551 3GTLI 3VMIA 3CPWY 2F4MA 1YIT1 2RBLA 5T64A 2JIRA 4DGLA 1RNIA 4E2YA 1Q822 2BJOA 3CMA1 5FLMI 1S721 2JA5I 2GU2A 3PO2I 3FQQA 4MONA 1YUAA 2B63I 3VMGA 3CXCY 1NUIA 2W03A 3FKII 1VQO1 1FDIA 5D1OB 3G4S1 1KD12 3LUSA 3GTMS 1VQN1 4HH4A 2V45A 4RVHA 2RHBA 2OOYB 4A3II 3CMEZ 3S1RI 2NVXI 2JA6I 3S16I 3J80f 1M901 1VQ4Z 2VPWA 2IV2X 1Q811 1X3WA 2JS4A 4NFRA 4CL1A 1JWHC 2NAPA 1KD11 1YHQ1 1VQP1 1WZNA 4X6AI 2JIQA 4NB8A 1ZB9A 3TE5B 2VPXA 1NJI2 2E2HI 4A3LI 3H0GI 3U50C 3GTQI 5A2Qb 2R93I 4A3DI 5IT9f 1Q7Y2 1TWGI 1KQSZ 2WB1A 1Q861 2O4HA 1YJW1 5T67A 5LL6f 1LQLA 4BY7I 2VPYA 1YIJZ 3BG0B 3CCU1 3F3FC 1VQ71 3GTMI 3OW2Z 2AYDA 3CC71 3CCQ1 2OTJZ 4MD9A 3NH8A 1QVFY 4XX2A 4TNUA 3ESWA 1VQ5Z 1VLAA 2PMZA 1NP6A 2Q4ZA 4AYBA 1S7MA 3S2DI 3GCFA 3HOVI 4NBHA 3S17I 3M3YI 3CME1 1Q821 1KRLA 3IFUA 1TWAI 3CCR1 4RVDA 1RO2A 2KI7B 1YI21 3NH5A 3CC21 4A3EI 1RO4A 3GTKI 1N8R2 2R6MA 5D1OA 2LEXA 4A3BI 4QTTA 1TWFI 2QREB 1VQ7Z 2NVTI 3QWUA 3CCUZ 3D6WA 1VQKZ 1S72Z 4A3FI 2K3RA 1K9M2 1I6HI 3HOUI 3D9XA 3S1QI 1Z03A 1YJ91 2QEXZ 5C44I 2QRDB 1YJ9Z 1R9TI 1WW9A 3MONA 4NBDA 1Q812 4NBGA 2E7ZA 2V8KA 5A2Qf 4S1TA 3CQZI 1VQ41 1YUKA 2JMOA 2JIMA 4E33A 2WAQA 1K83I 3CCSZ 3K7AI 4MD8A 3CCVZ 1NJI1 4A93I 3H3VJ 3GTJI 3VMHA 3NDIA 4NH1C 4BXXI
chains in the Genus database with same CATH topology
3I55Z 1VQ91 2QA4Z 2QLVB 1QYPA 2Y0SA 2O53A 3CD61 3G6E1 3CMAZ 2YADA 3I4NI 5D1PA 3FQMA 2JR6A 2V8IA 2JUBA 1RQFA 3CCM1 2R92I 3CCL1 5FLXf 2W04A 1X3ZA 3BG1B 1W2BY 2P3YA 1K732 3RZOI 4NBFA 1Y1VI 3GTOI 2JNYA 3CCLZ 1USPB 3CPWZ 3CCEZ 3G71Z 1Y1VS 5T6BA 2GTHA 1VQK1 3CD6Z 3JAMf 1VQL1 1Z01A 2DE5A 1YJN1 2LIYA 4E32A 2QA41 3RZDI 2R7ZI 1K8A2 3EEDA 3Q87A 1RO0A 1WCMI 4A3CI 3J81f 4RS4A 2HU9A 3GTPI 5C3EI 1VQNZ 3I561 4BBRI 3J7A4 2VF1A 1VQM1 2JA7I 1SFOI 5C4XI 2EGTA 1KC81 4E30A 2ZAEB 3KIFA 1VQ9Z 1L1OC 1DL6A 3VB9A 3G4SZ 1VQ61 3GTGI 3PO3S 2NVQI 3S15I 3I07A 5AN9F 2NVYI 2OTL1 4MRIA 4NB9A 3CCJZ 2K5RA 3S1MI 3HKZA 2Q51A 1X0TA 3T4NB 2PM9A 1RLYA 3GKQA 4HGYA 1Z02A 3HOXI 2OOXB 2PK7A 4NBEA 1YJNZ 1K731 4E31A 2QEX1 1I3QI 3MZLB 3CCS1 3KIHA 3IF8A 3OW2Y 1QVGZ 4RV9A 3PO3I 2RT9A 1USPA 3CCE1 4NBBA 3I4MI 2H85A 4EWCA 1W2BZ 3NFZA 1VQ51 1TFIA 1WIIA 4NOZA 3CC4Z 4NBCA 3IX0A 1VQPZ 2F4OA 2LFUA 4MXUA 1VQ81 3J81b 3CCQZ 2OTJ1 3NDJA 1JJ2Z 5IT9b 1VQMZ 2E9HA 3HOWI 3TDHB 1VQ8Z 2VUMI 4MD7A 3M4OI 2HF1A 1Y1WI 1K8A1 3CC41 3HOZI 2VUGA 4DQYB 4A3GI 2IZ4A 2V8JA 1M1K2 4NBAA 3CCV1 2IZ3A 4HGZA 5CM2M 1ZH1A 1I50I 3NH4A 1YJWZ 2I3CA 2QKDA 3I56Z 1YIJ1 1KC82 2OTLZ 4E2WA 3G711 5IP9I 1M1K1 2DE6A 2AKLA 4RVGA 2DE7A 1TWCI 1YITZ 5IP7I 1K9M1 1N2FA 1QVGY 4A3MI 1VQ6Z 2M6NA 1YHQZ 1ML8A 1YI2Z 3VTNA 1P9NA 2E2II 4A3KI 2RPRA 1TWHI 2G2KA 5FLXb 4BBSI 3CC2Z 4Y7NI 4E2XA 3CXCZ 3CCRZ 3P5JB 3CCMZ 4MH4A 2KPIA 2YU9I 3CCJ1 3CC7Z 3J80b 4BY1I 2RIQA 1VQOZ 2E2JI 3F3PC 3JAMb 2QR1B 2GTIA 1JJ2Y 2J6AA 1M902 2JA8I 3HOYI 1Q862 1VQLZ 2QRCB 2M48A 5C4JI 1Q7Y1 1QF8A 4DK1A 1QVFZ 2P28A 3EERA 3S14I 2OZKA 3S2HI 4RVFA 3G6EZ 4E2ZA 4A3JI 1N8R1 4QTUA 3S1NI 4Y52I 3MZKB 1PFTA 1KQSY 3GTLI 1ZB8A 3I551 3VMIA 3CPWY 2F4MA 1YIT1 2RBLA 5T64A 4DGLA 1RNIA 4E2YA 1Q822 2BJOA 3CMA1 5FLMI 1S721 2JA5I 2GU2A 3PO2I 3FQQA 4MONA 1YUAA 2B63I 3VMGA 3CXCY 1NUIA 2W03A 3FKII 1VQO1 5D1OB 3G4S1 1KD12 3LUSA 3GTMS 1VQN1 4HH4A 4RVHA 2RHBA 2OOYB 4A3II 3CMEZ 3S1RI 2NVXI 2JA6I 3S16I 3J80f 1M901 1VQ4Z 1Q811 1X3WA 2JS4A 4NFRA 4CL1A 1JWHC 1KD11 1YHQ1 1VQP1 4X6AI 4NB8A 1ZB9A 3TE5B 1NJI2 2E2HI 4A3LI 3H0GI 3U50C 3GTQI 5A2Qb 2R93I 4A3DI 5IT9f 1Q7Y2 1TWGI 1KQSZ 2WB1A 1Q861 2O4HA 1YJW1 5T67A 5LL6f 1LQLA 4BY7I 1YIJZ 3BG0B 3CCU1 3F3FC 1VQ71 3GTMI 3OW2Z 3CC71 3CCQ1 2OTJZ 4MD9A 3NH8A 1QVFY 4XX2A 4TNUA 3ESWA 1VQ5Z 1VLAA 2PMZA 1NP6A 2Q4ZA 4AYBA 1S7MA 3S2DI 3GCFA 3HOVI 4NBHA 3S17I 3M3YI 3CME1 1Q821 1KRLA 3IFUA 1TWAI 3CCR1 4RVDA 1RO2A 2KI7B 1YI21 3NH5A 3CC21 4A3EI 1RO4A 3GTKI 1N8R2 2R6MA 5D1OA 4A3BI 4QTTA 1TWFI 2QREB 1VQ7Z 2NVTI 3QWUA 3CCUZ 3D6WA 1VQKZ 1S72Z 4A3FI 2K3RA 1K9M2 1I6HI 3HOUI 3D9XA 3S1QI 1Z03A 1YJ91 2QEXZ 5C44I 2QRDB 1YJ9Z 1R9TI 1WW9A 3MONA 4NBDA 1Q812 4NBGA 2V8KA 5A2Qf 4S1TA 3CQZI 1VQ41 1YUKA 2JMOA 4E33A 2WAQA 1K83I 3CCSZ 3K7AI 4MD8A 3CCVZ 1NJI1 4A93I 3H3VJ 3GTJI 3VMHA 3NDIA 4NH1C 4BXXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Z;  3I55 Z;  1K73 1;  1VQ9 1;  2QA4 Z;  2QEX 1;  3CCJ 1;  3CCS 1;  3CC7 Z;  3OW2 Y;  1Q7Y 2;  1QVG Z;  3CD6 1;  3G6E 1;  1KQS Z;  3CCE 1;  1VQO Z;  1Q86 1;  3CMA Z;  1YJW 1;  3CCM 1;  1YIJ Z;  1W2B Z;  3CCL 1;  3CCU 1;  1VQ7 1;  3OW2 Z;  1VQ5 1;  3CC7 1;  1JJ2 Y;  3CCQ 1;  2OTJ Z;  1QVF Y;  3CC4 Z;  1M90 2;  1VQP Z;  1W2B Y;  1K73 2;  1VQ8 1;  1Q86 2;  1VQL Z;  3CCQ Z;  2OTJ 1;  1VQ5 Z;  1JJ2 Z;  1Q7Y 1;  1QVF Z;  3CCL Z;  3CPW Z;  3CCE Z;  3G71 Z;  1VQM Z;  1VQK 1;  3CME 1;  1Q82 1;  3G6E Z;  3CD6 Z;  1VQL 1;  1VQ8 Z;  1N8R 1;  1YJN 1;  3CCR 1;  1K8A 1;  2QA4 1;  3CC4 1;  1KQS Y;  3I55 1;  3CPW Y;  1YI2 1;  1YIT 1;  1K8A 2;  3CC2 1;  1M1K 2;  3CCV 1;  1N8R 2;  1Q82 2;  1YJW Z;  1S72 1;  3CMA 1;  1VQN Z;  1VQ7 Z;  3I56 1;  3CCU Z;  3I56 Z;  1YIJ 1;  1VQK Z;  1VQM 1;  1S72 Z;  1KC8 2;  2OTL Z;  3CXC Y;  1VQO 1;  3G71 1;  1M1K 1;  1KC8 1;  1K9M 2;  3G4S 1;  1KD1 2;  1YIT Z;  1K9M 1;  1VQN 1;  1YJ9 1;  2QEX Z;  1QVG Y;  1VQ6 Z;  1VQ9 Z;  1YJ9 Z;  3G4S Z;  1Q81 2;  1YHQ Z;  1VQ6 1;  1YI2 Z;  3CME Z;  1M90 1;  1VQ4 Z;  1Q81 1;  1VQ4 1;  2OTL 1;  3CCJ Z;  3CCS Z;  1KD1 1;  1YHQ 1;  1VQP 1;  3CCV Z;  1NJI 1;  3CC2 Z;  1NJI 2;  3CXC Z;  3CCR Z;  3CCM Z; 
#chains in the Genus database with same CATH topology
 3I55 Z;  1VQ9 1;  2QA4 Z;  2QLV B;  2JIO A;  1QYP A;  1FDO A;  2Y0S A;  2O53 A;  3CD6 1;  3G6E 1;  3CMA Z;  2YAD A;  3I4N I;  5D1P A;  3FQM A;  2JR6 A;  2V8I A;  2JUB A;  1RQF A;  3CCM 1;  2R92 I;  3CCL 1;  5FLX f;  1AA6 A;  2W04 A;  1X3Z A;  3BG1 B;  1W2B Y;  2P3Y A;  1K73 2;  3RZO I;  4NBF A;  1Y1V I;  3GTO I;  2JNY A;  3CCL Z;  1USP B;  3CPW Z;  3CCE Z;  3G71 Z;  1Y1V S;  5T6B A;  2GTH A;  1VQK 1;  3CD6 Z;  3JAM f;  1VQL 1;  1Z01 A;  2DE5 A;  1YJN 1;  2LIY A;  4E32 A;  2QA4 1;  3RZD I;  1Q16 A;  2R7Z I;  1K8A 2;  3EED A;  3Q87 A;  1RO0 A;  1WCM I;  4A3C I;  3J81 f;  2JIP A;  4RS4 A;  2HU9 A;  3GTP I;  5C3E I;  1VQN Z;  3I56 1;  4BBR I;  3J7A 4;  2VF1 A;  1VQM 1;  2JA7 I;  1SFO I;  5C4X I;  2EGT A;  1KC8 1;  4E30 A;  2ZAE B;  3KIF A;  1VQ9 Z;  1L1O C;  1DL6 A;  3VB9 A;  3G4S Z;  1VQ6 1;  3GTG I;  3PO3 S;  2NVQ I;  3S15 I;  3I07 A;  5AN9 F;  2NVY I;  2OTL 1;  4MRI A;  4NB9 A;  3CCJ Z;  2K5R A;  3S1M I;  3HKZ A;  2Q51 A;  1X0T A;  3T4N B;  2PM9 A;  1RLY A;  3GKQ A;  4HGY A;  1Z02 A;  3HOX I;  2OOX B;  2PK7 A;  4NBE A;  1YJN Z;  1K73 1;  4E31 A;  2QEX 1;  1I3Q I;  3MZL B;  3CCS 1;  3KIH A;  3IF8 A;  3OW2 Y;  1QVG Z;  4RV9 A;  3PO3 I;  2RT9 A;  1USP A;  3CCE 1;  4NBB A;  3I4M I;  2H85 A;  4EWC A;  1W2B Z;  3NFZ A;  1VQ5 1;  1TFI A;  1WII A;  4NOZ A;  3CC4 Z;  3IR7 A;  4NBC A;  3IX0 A;  1VQP Z;  2F4O A;  2LFU A;  4MXU A;  1VQ8 1;  3J81 b;  3CCQ Z;  2OTJ 1;  3NDJ A;  1JJ2 Z;  5IT9 b;  1VQM Z;  2E9H A;  3HOW I;  3TDH B;  1VQ8 Z;  2VUM I;  4MD7 A;  3M4O I;  2HF1 A;  1Y1W I;  1K8A 1;  3CC4 1;  3HOZ I;  2VUG A;  4DQY B;  4A3G I;  2IZ4 A;  2V8J A;  1M1K 2;  4NBA A;  3CCV 1;  2IZ3 A;  4HGZ A;  5CM2 M;  1ZH1 A;  1I50 I;  3NH4 A;  1QXF A;  1YJW Z;  2I3C A;  2V3V A;  2QKD A;  3I56 Z;  1YIJ 1;  1KC8 2;  2OTL Z;  4E2W A;  3G71 1;  2VPZ A;  5IP9 I;  1M1K 1;  2DE6 A;  2AKL A;  4RVG A;  2DE7 A;  1TWC I;  1YIT Z;  5IP7 I;  1K9M 1;  1N2F A;  1QVG Y;  4A3M I;  1VQ6 Z;  2M6N A;  1YHQ Z;  1ML8 A;  1YI2 Z;  3VTN A;  1P9N A;  2E2I I;  4A3K I;  2RPR A;  1TWH I;  3D2L A;  2G2K A;  5FLX b;  4BBS I;  3CC2 Z;  4Y7N I;  4E2X A;  3CXC Z;  3CCR Z;  3P5J B;  3CCM Z;  4MH4 A;  2KPI A;  2YU9 I;  3CCJ 1;  3CC7 Z;  3J80 b;  4BY1 I;  2RIQ A;  1VQO Z;  2E2J I;  3F3P C;  3JAM b;  2QR1 B;  2GTI A;  1JJ2 Y;  2J6A A;  1M90 2;  2JA8 I;  3HOY I;  1Q86 2;  1VQL Z;  2QRC B;  2M48 A;  5C4J I;  1Q7Y 1;  1Y8C A;  1QF8 A;  4DK1 A;  1QVF Z;  2P28 A;  3EER A;  3S14 I;  2OZK A;  3S2H I;  4RVF A;  3G6E Z;  4E2Z A;  4A3J I;  1N8R 1;  4QTU A;  1WJ2 A;  3S1N I;  4Y52 I;  3MZK B;  1PFT A;  1KQS Y;  1SIW A;  1ZB8 A;  3I55 1;  3GTL I;  3VMI A;  3CPW Y;  2F4M A;  1YIT 1;  2RBL A;  5T64 A;  2JIR A;  4DGL A;  1RNI A;  4E2Y A;  1Q82 2;  2BJO A;  3CMA 1;  5FLM I;  1S72 1;  2JA5 I;  2GU2 A;  3PO2 I;  3FQQ A;  4MON A;  1YUA A;  2B63 I;  3VMG A;  3CXC Y;  1NUI A;  2W03 A;  3FKI I;  1VQO 1;  1FDI A;  5D1O B;  3G4S 1;  1KD1 2;  3LUS A;  3GTM S;  1VQN 1;  4HH4 A;  2V45 A;  4RVH A;  2RHB A;  2OOY B;  4A3I I;  3CME Z;  3S1R I;  2NVX I;  2JA6 I;  3S16 I;  3J80 f;  1M90 1;  1VQ4 Z;  2VPW A;  2IV2 X;  1Q81 1;  1X3W A;  2JS4 A;  4NFR A;  4CL1 A;  1JWH C;  2NAP A;  1KD1 1;  1YHQ 1;  1VQP 1;  1WZN A;  4X6A I;  2JIQ A;  4NB8 A;  1ZB9 A;  3TE5 B;  2VPX A;  1NJI 2;  2E2H I;  4A3L I;  3H0G I;  3U50 C;  3GTQ I;  5A2Q b;  2R93 I;  4A3D I;  5IT9 f;  1Q7Y 2;  1TWG I;  1KQS Z;  2WB1 A;  1Q86 1;  2O4H A;  1YJW 1;  5T67 A;  5LL6 f;  1LQL A;  4BY7 I;  2VPY A;  1YIJ Z;  3BG0 B;  3CCU 1;  3F3F C;  1VQ7 1;  3GTM I;  3OW2 Z;  2AYD A;  3CC7 1;  3CCQ 1;  2OTJ Z;  4MD9 A;  3NH8 A;  1QVF Y;  4XX2 A;  4TNU A;  3ESW A;  1VQ5 Z;  1VLA A;  2PMZ A;  1NP6 A;  2Q4Z A;  4AYB A;  1S7M A;  3S2D I;  3GCF A;  3HOV I;  4NBH A;  3S17 I;  3M3Y I;  3CME 1;  1Q82 1;  1KRL A;  3IFU A;  1TWA I;  3CCR 1;  4RVD A;  1RO2 A;  2KI7 B;  1YI2 1;  3NH5 A;  3CC2 1;  4A3E I;  1RO4 A;  3GTK I;  1N8R 2;  2R6M A;  5D1O A;  2LEX A;  4A3B I;  4QTT A;  1TWF I;  2QRE B;  1VQ7 Z;  2NVT I;  3QWU A;  3CCU Z;  3D6W A;  1VQK Z;  1S72 Z;  4A3F I;  2K3R A;  1K9M 2;  1I6H I;  3HOU I;  3D9X A;  3S1Q I;  1Z03 A;  1YJ9 1;  2QEX Z;  5C44 I;  2QRD B;  1YJ9 Z;  1R9T I;  1WW9 A;  3MON A;  4NBD A;  1Q81 2;  4NBG A;  2E7Z A;  2V8K A;  5A2Q f;  4S1T A;  3CQZ I;  1VQ4 1;  1YUK A;  2JMO A;  2JIM A;  4E33 A;  2WAQ A;  1K83 I;  3CCS Z;  3K7A I;  4MD8 A;  3CCV Z;  1NJI 1;  4A93 I;  3H3V J;  3GTJ I;  3VMH A;  3NDI A;  4NH1 C;  4BXX I; 
#chains in the Genus database with same CATH homology
 3I55 Z;  1VQ9 1;  2QA4 Z;  2QLV B;  1QYP A;  2Y0S A;  2O53 A;  3CD6 1;  3G6E 1;  3CMA Z;  2YAD A;  3I4N I;  5D1P A;  3FQM A;  2JR6 A;  2V8I A;  2JUB A;  1RQF A;  3CCM 1;  2R92 I;  3CCL 1;  5FLX f;  2W04 A;  1X3Z A;  3BG1 B;  1W2B Y;  2P3Y A;  1K73 2;  3RZO I;  4NBF A;  1Y1V I;  3GTO I;  2JNY A;  3CCL Z;  1USP B;  3CPW Z;  3CCE Z;  3G71 Z;  1Y1V S;  5T6B A;  2GTH A;  1VQK 1;  3CD6 Z;  3JAM f;  1VQL 1;  1Z01 A;  2DE5 A;  1YJN 1;  2LIY A;  4E32 A;  2QA4 1;  3RZD I;  2R7Z I;  1K8A 2;  3EED A;  3Q87 A;  1RO0 A;  1WCM I;  4A3C I;  3J81 f;  4RS4 A;  2HU9 A;  3GTP I;  5C3E I;  1VQN Z;  3I56 1;  4BBR I;  3J7A 4;  2VF1 A;  1VQM 1;  2JA7 I;  1SFO I;  5C4X I;  2EGT A;  1KC8 1;  4E30 A;  2ZAE B;  3KIF A;  1VQ9 Z;  1L1O C;  1DL6 A;  3VB9 A;  3G4S Z;  1VQ6 1;  3GTG I;  3PO3 S;  2NVQ I;  3S15 I;  3I07 A;  5AN9 F;  2NVY I;  2OTL 1;  4MRI A;  4NB9 A;  3CCJ Z;  2K5R A;  3S1M I;  3HKZ A;  2Q51 A;  1X0T A;  3T4N B;  2PM9 A;  1RLY A;  3GKQ A;  4HGY A;  1Z02 A;  3HOX I;  2OOX B;  2PK7 A;  4NBE A;  1YJN Z;  1K73 1;  4E31 A;  2QEX 1;  1I3Q I;  3MZL B;  3CCS 1;  3KIH A;  3IF8 A;  3OW2 Y;  1QVG Z;  4RV9 A;  3PO3 I;  2RT9 A;  1USP A;  3CCE 1;  4NBB A;  3I4M I;  2H85 A;  4EWC A;  1W2B Z;  3NFZ A;  1VQ5 1;  1TFI A;  1WII A;  4NOZ A;  3CC4 Z;  4NBC A;  3IX0 A;  1VQP Z;  2F4O A;  2LFU A;  4MXU A;  1VQ8 1;  3J81 b;  3CCQ Z;  2OTJ 1;  3NDJ A;  1JJ2 Z;  5IT9 b;  1VQM Z;  2E9H A;  3HOW I;  3TDH B;  1VQ8 Z;  2VUM I;  4MD7 A;  3M4O I;  2HF1 A;  1Y1W I;  1K8A 1;  3CC4 1;  3HOZ I;  2VUG A;  4DQY B;  4A3G I;  2IZ4 A;  2V8J A;  1M1K 2;  4NBA A;  3CCV 1;  2IZ3 A;  4HGZ A;  5CM2 M;  1ZH1 A;  1I50 I;  3NH4 A;  1YJW Z;  2I3C A;  2QKD A;  3I56 Z;  1YIJ 1;  1KC8 2;  2OTL Z;  4E2W A;  3G71 1;  5IP9 I;  1M1K 1;  2DE6 A;  2AKL A;  4RVG A;  2DE7 A;  1TWC I;  1YIT Z;  5IP7 I;  1K9M 1;  1N2F A;  1QVG Y;  4A3M I;  1VQ6 Z;  2M6N A;  1YHQ Z;  1ML8 A;  1YI2 Z;  3VTN A;  1P9N A;  2E2I I;  4A3K I;  2RPR A;  1TWH I;  2G2K A;  5FLX b;  4BBS I;  3CC2 Z;  4Y7N I;  4E2X A;  3CXC Z;  3CCR Z;  3P5J B;  3CCM Z;  4MH4 A;  2KPI A;  2YU9 I;  3CCJ 1;  3CC7 Z;  3J80 b;  4BY1 I;  2RIQ A;  1VQO Z;  2E2J I;  3F3P C;  3JAM b;  2QR1 B;  2GTI A;  1JJ2 Y;  2J6A A;  1M90 2;  2JA8 I;  3HOY I;  1Q86 2;  1VQL Z;  2QRC B;  2M48 A;  5C4J I;  1Q7Y 1;  1QF8 A;  4DK1 A;  1QVF Z;  2P28 A;  3EER A;  3S14 I;  2OZK A;  3S2H I;  4RVF A;  3G6E Z;  4E2Z A;  4A3J I;  1N8R 1;  4QTU A;  3S1N I;  4Y52 I;  3MZK B;  1PFT A;  1KQS Y;  3GTL I;  1ZB8 A;  3I55 1;  3VMI A;  3CPW Y;  2F4M A;  1YIT 1;  2RBL A;  5T64 A;  4DGL A;  1RNI A;  4E2Y A;  1Q82 2;  2BJO A;  3CMA 1;  5FLM I;  1S72 1;  2JA5 I;  2GU2 A;  3PO2 I;  3FQQ A;  4MON A;  1YUA A;  2B63 I;  3VMG A;  3CXC Y;  1NUI A;  2W03 A;  3FKI I;  1VQO 1;  5D1O B;  3G4S 1;  1KD1 2;  3LUS A;  3GTM S;  1VQN 1;  4HH4 A;  4RVH A;  2RHB A;  2OOY B;  4A3I I;  3CME Z;  3S1R I;  2NVX I;  2JA6 I;  3S16 I;  3J80 f;  1M90 1;  1VQ4 Z;  1Q81 1;  1X3W A;  2JS4 A;  4NFR A;  4CL1 A;  1JWH C;  1KD1 1;  1YHQ 1;  1VQP 1;  4X6A I;  4NB8 A;  1ZB9 A;  3TE5 B;  1NJI 2;  2E2H I;  4A3L I;  3H0G I;  3U50 C;  3GTQ I;  5A2Q b;  2R93 I;  4A3D I;  5IT9 f;  1Q7Y 2;  1TWG I;  1KQS Z;  2WB1 A;  1Q86 1;  2O4H A;  1YJW 1;  5T67 A;  5LL6 f;  1LQL A;  4BY7 I;  1YIJ Z;  3BG0 B;  3CCU 1;  3F3F C;  1VQ7 1;  3GTM I;  3OW2 Z;  3CC7 1;  3CCQ 1;  2OTJ Z;  4MD9 A;  3NH8 A;  1QVF Y;  4XX2 A;  4TNU A;  3ESW A;  1VQ5 Z;  1VLA A;  2PMZ A;  1NP6 A;  2Q4Z A;  4AYB A;  1S7M A;  3S2D I;  3GCF A;  3HOV I;  4NBH A;  3S17 I;  3M3Y I;  3CME 1;  1Q82 1;  1KRL A;  3IFU A;  1TWA I;  3CCR 1;  4RVD A;  1RO2 A;  2KI7 B;  1YI2 1;  3NH5 A;  3CC2 1;  4A3E I;  1RO4 A;  3GTK I;  1N8R 2;  2R6M A;  5D1O A;  4A3B I;  4QTT A;  1TWF I;  2QRE B;  1VQ7 Z;  2NVT I;  3QWU A;  3CCU Z;  3D6W A;  1VQK Z;  1S72 Z;  4A3F I;  2K3R A;  1K9M 2;  1I6H I;  3HOU I;  3D9X A;  3S1Q I;  1Z03 A;  1YJ9 1;  2QEX Z;  5C44 I;  2QRD B;  1YJ9 Z;  1R9T I;  1WW9 A;  3MON A;  4NBD A;  1Q81 2;  4NBG A;  2V8K A;  5A2Q f;  4S1T A;  3CQZ I;  1VQ4 1;  1YUK A;  2JMO A;  4E33 A;  2WAQ A;  1K83 I;  3CCS Z;  3K7A I;  4MD8 A;  3CCV Z;  1NJI 1;  4A93 I;  3H3V J;  3GTJ I;  3VMH A;  3NDI A;  4NH1 C;  4BXX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...