1VQ41

The structure of the transition state analogue "daa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq4100
1VQ91 1VQ9Z 3CC21 2OTL1 1VQ51 3CMA1 1M1K1 1VQ5Z 1VQ4Z 2OTLZ 1M1K2 1S721 1VQO1 1S72Z 1VQOZ 1Q821 1Q822 3CCM1 1VQ71 1NJI1 2QEXZ 3CCMZ 1NJI2 1YITZ 1VQN1 2QA41 3I55Z 1Q7Y1 3CPWZ 3CCVZ 3OW2Z 1Q7Y2 1K9M1 1VQP1 1K9M2 1W2BY 1VQL1 1KD11 3I56Z 1KD12 3CMEZ 2OTJZ 1VQ41 1YHQZ 1YI21 1YI2Z 3CCRZ 1Q861 1VQKZ 1Q862 3CC41 3CC4Z 3CD6Z 3CC71 3CC7Z 2QEX1 1Q811 1Q812 1YIT1 1N8R1 3CCU1 1N8R2 3I551 3CCUZ 1QVFY 1VQM1 3CCV1 1VQMZ 3CCQ1 3CCQZ 1W2BZ 1YJNZ 1M901 1M902 3G711 1QVGY 3G71Z 3I561 3G4S1 3CME1 3G4SZ 2OTJ1 1K731 1K732 1YHQ1 3CCR1 1VQK1 3CCLZ 1VQ61 1YJ9Z 3CD61 1VQ6Z 1KQSY 3CCEZ 1K8A1 1K8A2 1KC81 3CCSZ 1KC82 1JJ2Z 3CCJZ 1QVFZ 1JJ2Y 3G6E1 1VQ8Z 3G6EZ 1YJN1 1QVGZ 3CC2Z 1YJW1 1YJWZ 3CMAZ 3CXCZ 3CXCY 3CCL1 1YJ91 1KQSZ 1YIJ1 1YIJZ 3CCE1 1VQ7Z 1VQNZ 2QA4Z 3CCS1 3CCJ1 3CPWY 3OW2Y 1VQPZ 1VQ81 1VQLZ
chains in the Genus database with same CATH superfamily
1NUIA 2P3YA 3PO3S 3T4NB 1VQ9Z 1TWFI 3S15I 1M1K2 2VF1A 3QWUA 1Z02A 2V3VA 3I07A 1S72Z 1I3QI 3BG1B 3KIHA 2GTIA 3CCM1 1YITZ 5CM2M 2QA41 1I50I 2KPIA 1TWHI 1Q7Y1 3CCVZ 1K9M2 1WCMI 1USPA 1QYPA 2E7ZA 2R93I 2JA6I 1KD12 1ZH1A 1YHQZ 2HU9A 3CCRZ 2HF1A 3CC4Z 3D2LA 1N8R2 1YUKA 4A3BI 1VQMZ 4QTUA 3CCQZ 2NVTI 1N2FA 1M902 3NDJA 3G711 3G4S1 1NP6A 2M6NA 2VPYA 4X6AI 4A3II 1K732 4A3FI 2E9HA 4TNUA 2P28A 2KI7B 4Y7NI 1RLYA 4NBDA 2JUBA 1JJ2Z 1RQFA 1JJ2Y 2OZKA 4NFRA 3J81b 1VQ8Z 4NBCA 3ESWA 2AYDA 5IT9f 1YJN1 3J7A4 1QVGZ 4E31A 4RVFA 3GTQI 3M4OI 5LL6f 4BY7I 3IFUA 3HOZI 3MZLB 3S1MI 1YJ91 3J81f 1KQSZ 4NBAA 2QA4Z 2I3CA 4NOZA 2DE6A 3CCJ1 1X3ZA 2JS4A 2RBLA 4MXUA 2VPZA 4E33A 1S7MA 4E2YA 3NH8A 3NDIA 4BBRI 3HOVI 3HOWI 1VQ51 3CMA1 4A3JI 2OTLZ 1WZNA 4NB9A 4DQYB 2QRDB 2R6MA 5D1OB 2PK7A 1VQOZ 3GTMI 1Q822 3S17I 1NJI2 1VQN1 2LFUA 5T64A 2V8JA 5FLMI 2IZ3A 2RT9A 3VMHA 5T6BA 1W2BY 4A3DI 1VQ41 1YI2Z 2G2KA 1Q861 2JR6A 2IV2X 5D1OA 2VUGA 4MD7A 3CC7Z 2DE5A 2PM9A 1Q812 5C44I 3CCU1 3GTPI 1QVFY 4NB8A 4A3LI 4MD9A 3NH5A 5C3EI 1YJNZ 5A2Qb 4MRIA 1DL6A 4RVHA 4NH1C 3CME1 2OTJ1 1Y1VI 3S1QI 2V8KA 2E2JI 1VQK1 2R92I 1YJ9Z 3CD61 4NBHA 1VQ6Z 2JMOA 1SIWA 1K8A1 4DGLA 5A2Qf 1KC81 3CCJZ 3Q87A 3G6E1 1R9TI 4A93I 3FKII 3IX0A 1YJWZ 3CMAZ 3H3VJ 4A3KI 3CXCZ 2JIPA 5IT9b 1QF8A 3CXCY 3NFZA 2YU9I 1YIJZ 3CCE1 3LUSA 4HGYA 1VQNZ 3CCS1 3HKZA 4HH4A 2NAPA 4A3MI 3I4MI 4E2ZA 3CPWY 3OW2Y 2R7ZI 2Q4ZA 3D9XA 3HOYI 1VLAA 1JWHC 2QREB 4RVGA 3MONA 1VQ91 3CC21 1M1K1 1VQ4Z 3HOUI 3EERA 2EGTA 2QRCB 4S1TA 1S721 2JA8I 1RO2A 2WB1A 3CCMZ 1X0TA 1LQLA 2Q51A 1Q7Y2 1K9M1 1TWGI 1VQL1 3D6WA 1P9NA 2RHBA 5IP9I 1ZB9A 1KD11 5IP7I 3CMEZ 2OTJZ 3F3FC 1WJ2A 2JIRA 1VQKZ 3CC41 3CD6Z 1WW9A 3VMIA 3GTLI 1Y1VS 2QEX1 5D1PA 3TE5B 3VB9A 4RV9A 1N8R1 3S1NI 2OOXB 3I551 4XX2A 1VQM1 4E2XA 3CCQ1 2IZ4A 2JNYA 1W2BZ 3IF8A 1M901 4MONA 1K83I 4BY1I 3G71Z 3I561 3G4SZ 2JIMA 3MZKB 1K731 2NVYI 4NBFA 3I4NI 5T67A 2B63I 1WIIA 2V8IA 4RVDA 2RPRA 3CCEZ 2LIYA 1YUAA 3K7AI 3GCFA 3CCSZ 1Z01A 1QVFZ 4NBGA 2K5RA 1FDIA 3U50C 3TDHB 2AKLA 2QLVB 3CC2Z 3FQMA 2VPWA 1TFIA 3S16I 1Q16A 2W04A 3CCL1 4Y52I 4CL1A 4RS4A 3JAMb 2VUMI 5FLXb 3RZOI 4E32A 3S1RI 3GTOI 2Y0SA 4A3CI 1VQLZ 2QR1B 2QKDA 4BXXI 2DE7A 1PFTA 1AA6A 2OTL1 3JAMf 1VQ5Z 1Y1WI 1SFOI 2JA7I 4E30A 3H0GI 1RO4A 5FLXf 1VQO1 5C4JI 1Q821 1RNIA 2GU2A 4MH4A 3GTGI 1VQ71 1NJI1 2QEXZ 3EEDA 1X3WA 3PO3I 4A3GI 3S14I 3I55Z 5AN9F 3CPWZ 3OW2Z 3GTMS 1VQP1 1I6HI 2H85A 3I56Z 3GTKI 1TWAI 2J6AA 2LEXA 2O4HA 1YI21 2M48A 2JIQA 3IR7A 1Q862 1ML8A 1TWCI 4MD8A 2JIOA 2ZAEB 3CC71 2F4MA 1Q811 1YIT1 3VMGA 3CCUZ 4EWCA 2VPXA 3CCV1 2GTHA 3CQZI 2RIQA 4DK1A 3VTNA 3PO2I 1QVGY 2BJOA 1KRLA 3GTJI 2W03A 3M3YI 1YHQ1 2O53A 1QXFA 2WAQA 3CCR1 2JA5I 4AYBA 3CCLZ 3RZDI 1VQ61 1KQSY 2E2II 3KIFA 3NH4A 3BG0B 3P5JB 4E2WA 1K8A2 1KC82 1RO0A 2F4OA 2E2HI 1ZB8A 1Y8CA 4BBSI 3J80b 3G6EZ 3GKQA 5C4XI 3S2HI 2PMZA 4QTTA 1YJW1 1FDOA 4A3EI 2OOYB 4NBBA 1L1OC 2NVQI 2NVXI 3HOXI 2V45A 1YIJ1 4HGZA 1VQ7Z 1Z03A 3J80f 3S2DI 1USPB 2K3RA 3F3PC 4NBEA 1VQPZ 2YADA 1VQ81 3FQQA
chains in the Genus database with same CATH topology
1NUIA 2P3YA 3PO3S 3T4NB 1VQ9Z 1TWFI 3S15I 1M1K2 2VF1A 3QWUA 1Z02A 3I07A 1S72Z 1I3QI 3BG1B 3KIHA 2GTIA 3CCM1 1YITZ 5CM2M 2QA41 1I50I 2KPIA 1TWHI 1Q7Y1 3CCVZ 1K9M2 1WCMI 1USPA 1QYPA 2R93I 2JA6I 1KD12 1ZH1A 1YHQZ 2HU9A 3CCRZ 2HF1A 3CC4Z 1N8R2 1YUKA 4A3BI 1VQMZ 4QTUA 3CCQZ 2NVTI 1N2FA 1M902 3NDJA 3G711 3G4S1 1NP6A 2M6NA 4X6AI 4A3II 1K732 4A3FI 2E9HA 4TNUA 2P28A 2KI7B 4Y7NI 1RLYA 4NBDA 2JUBA 1JJ2Z 1RQFA 1JJ2Y 2OZKA 4NFRA 3J81b 1VQ8Z 4NBCA 3ESWA 5IT9f 1YJN1 3J7A4 1QVGZ 4E31A 4RVFA 3GTQI 3M4OI 5LL6f 4BY7I 3IFUA 3HOZI 3MZLB 3S1MI 1YJ91 3J81f 1KQSZ 4NBAA 2QA4Z 2I3CA 4NOZA 2DE6A 3CCJ1 1X3ZA 2JS4A 2RBLA 4MXUA 4E33A 1S7MA 4E2YA 3NH8A 3NDIA 4BBRI 3HOVI 3HOWI 1VQ51 3CMA1 4A3JI 2OTLZ 4NB9A 4DQYB 2QRDB 2R6MA 5D1OB 2PK7A 1VQOZ 3GTMI 1Q822 3S17I 1NJI2 1VQN1 2LFUA 5T64A 2V8JA 5FLMI 2IZ3A 2RT9A 3VMHA 5T6BA 1W2BY 4A3DI 1VQ41 1YI2Z 2G2KA 1Q861 2JR6A 5D1OA 2VUGA 4MD7A 3CC7Z 2DE5A 2PM9A 1Q812 5C44I 3CCU1 3GTPI 1QVFY 4NB8A 4A3LI 4MD9A 3NH5A 5C3EI 1YJNZ 5A2Qb 4MRIA 1DL6A 4RVHA 4NH1C 3CME1 2OTJ1 1Y1VI 3S1QI 2V8KA 2E2JI 1VQK1 2R92I 1YJ9Z 3CD61 4NBHA 1VQ6Z 2JMOA 1K8A1 4DGLA 5A2Qf 1KC81 3CCJZ 3Q87A 3G6E1 1R9TI 4A93I 3FKII 3IX0A 1YJWZ 3CMAZ 3H3VJ 4A3KI 3CXCZ 5IT9b 1QF8A 3CXCY 3NFZA 2YU9I 1YIJZ 3CCE1 3LUSA 4HGYA 1VQNZ 3CCS1 3HKZA 4HH4A 3I4MI 4A3MI 4E2ZA 3CPWY 3OW2Y 2R7ZI 2Q4ZA 3D9XA 3HOYI 1VLAA 1JWHC 2QREB 4RVGA 3MONA 1VQ91 3CC21 1M1K1 1VQ4Z 3HOUI 3EERA 2EGTA 2QRCB 4S1TA 1S721 2JA8I 1RO2A 2WB1A 3CCMZ 1X0TA 1LQLA 2Q51A 1Q7Y2 1K9M1 1TWGI 1VQL1 3D6WA 1P9NA 2RHBA 5IP9I 1ZB9A 1KD11 5IP7I 3CMEZ 2OTJZ 3F3FC 1VQKZ 3CC41 3CD6Z 1WW9A 3VMIA 3GTLI 1Y1VS 2QEX1 5D1PA 3TE5B 3VB9A 4RV9A 1N8R1 3S1NI 2OOXB 3I551 4XX2A 1VQM1 4E2XA 3CCQ1 2IZ4A 2JNYA 1W2BZ 3IF8A 1M901 4MONA 1K83I 4BY1I 3G71Z 3I561 3G4SZ 1K731 3MZKB 2NVYI 4NBFA 3I4NI 5T67A 2B63I 1WIIA 2V8IA 4RVDA 2RPRA 3CCEZ 2LIYA 1YUAA 3K7AI 3GCFA 3CCSZ 1Z01A 1QVFZ 4NBGA 2K5RA 3U50C 3TDHB 2AKLA 2QLVB 3CC2Z 3FQMA 1TFIA 3S16I 2W04A 3CCL1 4Y52I 4CL1A 4RS4A 3JAMb 2VUMI 5FLXb 3RZOI 4E32A 3S1RI 3GTOI 2Y0SA 4A3CI 1VQLZ 2QR1B 2QKDA 4BXXI 2DE7A 1PFTA 2OTL1 3JAMf 1VQ5Z 1Y1WI 1SFOI 2JA7I 4E30A 3H0GI 1RO4A 5FLXf 1VQO1 5C4JI 1Q821 1RNIA 2GU2A 4MH4A 3GTGI 1VQ71 1NJI1 2QEXZ 3EEDA 1X3WA 3PO3I 4A3GI 3S14I 3I55Z 5AN9F 3CPWZ 3OW2Z 3GTMS 1VQP1 1I6HI 2H85A 3I56Z 3GTKI 1TWAI 2J6AA 2O4HA 1YI21 2M48A 1Q862 1ML8A 1TWCI 4MD8A 2ZAEB 3CC71 2F4MA 1Q811 1YIT1 3VMGA 3CCUZ 4EWCA 3CCV1 2GTHA 3CQZI 2RIQA 4DK1A 3VTNA 3PO2I 1QVGY 2BJOA 1KRLA 3GTJI 2W03A 3M3YI 1YHQ1 2O53A 2WAQA 3CCR1 2JA5I 4AYBA 3CCLZ 3RZDI 1VQ61 1KQSY 2E2II 3KIFA 3NH4A 3BG0B 3P5JB 4E2WA 1K8A2 1KC82 1RO0A 2F4OA 2E2HI 1ZB8A 4BBSI 3J80b 3G6EZ 3GKQA 5C4XI 3S2HI 2PMZA 4QTTA 1YJW1 4A3EI 2OOYB 4NBBA 1L1OC 2NVQI 2NVXI 3HOXI 1YIJ1 4HGZA 1VQ7Z 1Z03A 3J80f 3S2DI 1USPB 2K3RA 3F3PC 4NBEA 1VQPZ 2YADA 1VQ81 3FQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 1;  1VQ9 Z;  3CC2 1;  2OTL 1;  1VQ5 1;  3CMA 1;  1M1K 1;  1VQ5 Z;  1VQ4 Z;  2OTL Z;  1M1K 2;  1S72 1;  1VQO 1;  1S72 Z;  1VQO Z;  1Q82 1;  1Q82 2;  3CCM 1;  1VQ7 1;  1NJI 1;  2QEX Z;  3CCM Z;  1NJI 2;  1YIT Z;  1VQN 1;  2QA4 1;  3I55 Z;  1Q7Y 1;  3CPW Z;  3CCV Z;  3OW2 Z;  1Q7Y 2;  1K9M 1;  1VQP 1;  1K9M 2;  1W2B Y;  1VQL 1;  1KD1 1;  3I56 Z;  1KD1 2;  3CME Z;  2OTJ Z;  1VQ4 1;  1YHQ Z;  1YI2 1;  1YI2 Z;  3CCR Z;  1Q86 1;  1VQK Z;  1Q86 2;  3CC4 1;  3CC4 Z;  3CD6 Z;  3CC7 1;  3CC7 Z;  2QEX 1;  1Q81 1;  1Q81 2;  1YIT 1;  1N8R 1;  3CCU 1;  1N8R 2;  3I55 1;  3CCU Z;  1QVF Y;  1VQM 1;  3CCV 1;  1VQM Z;  3CCQ 1;  3CCQ Z;  1W2B Z;  1YJN Z;  1M90 1;  1M90 2;  3G71 1;  1QVG Y;  3G71 Z;  3I56 1;  3G4S 1;  3CME 1;  3G4S Z;  2OTJ 1;  1K73 1;  1K73 2;  1YHQ 1;  3CCR 1;  1VQK 1;  3CCL Z;  1VQ6 1;  1YJ9 Z;  3CD6 1;  1VQ6 Z;  1KQS Y;  3CCE Z;  1K8A 1;  1K8A 2;  1KC8 1;  3CCS Z;  1KC8 2;  1JJ2 Z;  3CCJ Z;  1QVF Z;  1JJ2 Y;  3G6E 1;  1VQ8 Z;  3G6E Z;  1YJN 1;  1QVG Z;  3CC2 Z;  1YJW 1;  1YJW Z;  3CMA Z;  3CXC Z;  3CXC Y;  3CCL 1;  1YJ9 1;  1KQS Z;  1YIJ 1;  1YIJ Z;  3CCE 1;  1VQ7 Z;  1VQN Z;  2QA4 Z;  3CCS 1;  3CCJ 1;  3CPW Y;  3OW2 Y;  1VQP Z;  1VQ8 1;  1VQL Z; 
#chains in the Genus database with same CATH topology
 1NUI A;  2P3Y A;  3PO3 S;  3T4N B;  1VQ9 Z;  1TWF I;  3S15 I;  1M1K 2;  2VF1 A;  3QWU A;  1Z02 A;  2V3V A;  3I07 A;  1S72 Z;  1I3Q I;  3BG1 B;  3KIH A;  2GTI A;  3CCM 1;  1YIT Z;  5CM2 M;  2QA4 1;  1I50 I;  2KPI A;  1TWH I;  1Q7Y 1;  3CCV Z;  1K9M 2;  1WCM I;  1USP A;  1QYP A;  2E7Z A;  2R93 I;  2JA6 I;  1KD1 2;  1ZH1 A;  1YHQ Z;  2HU9 A;  3CCR Z;  2HF1 A;  3CC4 Z;  3D2L A;  1N8R 2;  1YUK A;  4A3B I;  1VQM Z;  4QTU A;  3CCQ Z;  2NVT I;  1N2F A;  1M90 2;  3NDJ A;  3G71 1;  3G4S 1;  1NP6 A;  2M6N A;  2VPY A;  4X6A I;  4A3I I;  1K73 2;  4A3F I;  2E9H A;  4TNU A;  2P28 A;  2KI7 B;  4Y7N I;  1RLY A;  4NBD A;  2JUB A;  1JJ2 Z;  1RQF A;  1JJ2 Y;  2OZK A;  4NFR A;  3J81 b;  1VQ8 Z;  4NBC A;  3ESW A;  2AYD A;  5IT9 f;  1YJN 1;  3J7A 4;  1QVG Z;  4E31 A;  4RVF A;  3GTQ I;  3M4O I;  5LL6 f;  4BY7 I;  3IFU A;  3HOZ I;  3MZL B;  3S1M I;  1YJ9 1;  3J81 f;  1KQS Z;  4NBA A;  2QA4 Z;  2I3C A;  4NOZ A;  2DE6 A;  3CCJ 1;  1X3Z A;  2JS4 A;  2RBL A;  4MXU A;  2VPZ A;  4E33 A;  1S7M A;  4E2Y A;  3NH8 A;  3NDI A;  4BBR I;  3HOV I;  3HOW I;  1VQ5 1;  3CMA 1;  4A3J I;  2OTL Z;  1WZN A;  4NB9 A;  4DQY B;  2QRD B;  2R6M A;  5D1O B;  2PK7 A;  1VQO Z;  3GTM I;  1Q82 2;  3S17 I;  1NJI 2;  1VQN 1;  2LFU A;  5T64 A;  2V8J A;  5FLM I;  2IZ3 A;  2RT9 A;  3VMH A;  5T6B A;  1W2B Y;  4A3D I;  1VQ4 1;  1YI2 Z;  2G2K A;  1Q86 1;  2JR6 A;  2IV2 X;  5D1O A;  2VUG A;  4MD7 A;  3CC7 Z;  2DE5 A;  2PM9 A;  1Q81 2;  5C44 I;  3CCU 1;  3GTP I;  1QVF Y;  4NB8 A;  4A3L I;  4MD9 A;  3NH5 A;  5C3E I;  1YJN Z;  5A2Q b;  4MRI A;  1DL6 A;  4RVH A;  4NH1 C;  3CME 1;  2OTJ 1;  1Y1V I;  3S1Q I;  2V8K A;  2E2J I;  1VQK 1;  2R92 I;  1YJ9 Z;  3CD6 1;  4NBH A;  1VQ6 Z;  2JMO A;  1SIW A;  1K8A 1;  4DGL A;  5A2Q f;  1KC8 1;  3CCJ Z;  3Q87 A;  3G6E 1;  1R9T I;  4A93 I;  3FKI I;  3IX0 A;  1YJW Z;  3CMA Z;  3H3V J;  4A3K I;  3CXC Z;  2JIP A;  5IT9 b;  1QF8 A;  3CXC Y;  3NFZ A;  2YU9 I;  1YIJ Z;  3CCE 1;  3LUS A;  4HGY A;  1VQN Z;  3CCS 1;  3HKZ A;  4HH4 A;  2NAP A;  4A3M I;  3I4M I;  4E2Z A;  3CPW Y;  3OW2 Y;  2R7Z I;  2Q4Z A;  3D9X A;  3HOY I;  1VLA A;  1JWH C;  2QRE B;  4RVG A;  3MON A;  1VQ9 1;  3CC2 1;  1M1K 1;  1VQ4 Z;  3HOU I;  3EER A;  2EGT A;  2QRC B;  4S1T A;  1S72 1;  2JA8 I;  1RO2 A;  2WB1 A;  3CCM Z;  1X0T A;  1LQL A;  2Q51 A;  1Q7Y 2;  1K9M 1;  1TWG I;  1VQL 1;  3D6W A;  1P9N A;  2RHB A;  5IP9 I;  1ZB9 A;  1KD1 1;  5IP7 I;  3CME Z;  2OTJ Z;  3F3F C;  1WJ2 A;  2JIR A;  1VQK Z;  3CC4 1;  3CD6 Z;  1WW9 A;  3VMI A;  3GTL I;  1Y1V S;  2QEX 1;  5D1P A;  3TE5 B;  3VB9 A;  4RV9 A;  1N8R 1;  3S1N I;  2OOX B;  3I55 1;  4XX2 A;  1VQM 1;  4E2X A;  3CCQ 1;  2IZ4 A;  2JNY A;  1W2B Z;  3IF8 A;  1M90 1;  4MON A;  1K83 I;  4BY1 I;  3G71 Z;  3I56 1;  3G4S Z;  2JIM A;  3MZK B;  1K73 1;  2NVY I;  4NBF A;  3I4N I;  5T67 A;  2B63 I;  1WII A;  2V8I A;  4RVD A;  2RPR A;  3CCE Z;  2LIY A;  1YUA A;  3K7A I;  3GCF A;  3CCS Z;  1Z01 A;  1QVF Z;  4NBG A;  2K5R A;  1FDI A;  3U50 C;  3TDH B;  2AKL A;  2QLV B;  3CC2 Z;  3FQM A;  2VPW A;  1TFI A;  3S16 I;  1Q16 A;  2W04 A;  3CCL 1;  4Y52 I;  4CL1 A;  4RS4 A;  3JAM b;  2VUM I;  5FLX b;  3RZO I;  4E32 A;  3S1R I;  3GTO I;  2Y0S A;  4A3C I;  1VQL Z;  2QR1 B;  2QKD A;  4BXX I;  2DE7 A;  1PFT A;  1AA6 A;  2OTL 1;  3JAM f;  1VQ5 Z;  1Y1W I;  1SFO I;  2JA7 I;  4E30 A;  3H0G I;  1RO4 A;  5FLX f;  1VQO 1;  5C4J I;  1Q82 1;  1RNI A;  2GU2 A;  4MH4 A;  3GTG I;  1VQ7 1;  1NJI 1;  2QEX Z;  3EED A;  1X3W A;  3PO3 I;  4A3G I;  3S14 I;  3I55 Z;  5AN9 F;  3CPW Z;  3OW2 Z;  3GTM S;  1VQP 1;  1I6H I;  2H85 A;  3I56 Z;  3GTK I;  1TWA I;  2J6A A;  2LEX A;  2O4H A;  1YI2 1;  2M48 A;  2JIQ A;  3IR7 A;  1Q86 2;  1ML8 A;  1TWC I;  4MD8 A;  2JIO A;  2ZAE B;  3CC7 1;  2F4M A;  1Q81 1;  1YIT 1;  3VMG A;  3CCU Z;  4EWC A;  2VPX A;  3CCV 1;  2GTH A;  3CQZ I;  2RIQ A;  4DK1 A;  3VTN A;  3PO2 I;  1QVG Y;  2BJO A;  1KRL A;  3GTJ I;  2W03 A;  3M3Y I;  1YHQ 1;  2O53 A;  1QXF A;  2WAQ A;  3CCR 1;  2JA5 I;  4AYB A;  3CCL Z;  3RZD I;  1VQ6 1;  1KQS Y;  2E2I I;  3KIF A;  3NH4 A;  3BG0 B;  3P5J B;  4E2W A;  1K8A 2;  1KC8 2;  1RO0 A;  2F4O A;  2E2H I;  1ZB8 A;  1Y8C A;  4BBS I;  3J80 b;  3G6E Z;  3GKQ A;  5C4X I;  3S2H I;  2PMZ A;  4QTT A;  1YJW 1;  1FDO A;  4A3E I;  2OOY B;  4NBB A;  1L1O C;  2NVQ I;  2NVX I;  3HOX I;  2V45 A;  1YIJ 1;  4HGZ A;  1VQ7 Z;  1Z03 A;  3J80 f;  3S2D I;  1USP B;  2K3R A;  3F3P C;  4NBE A;  1VQP Z;  2YAD A;  1VQ8 1;  3FQQ A; 
#chains in the Genus database with same CATH homology
 1NUI A;  2P3Y A;  3PO3 S;  3T4N B;  1VQ9 Z;  1TWF I;  3S15 I;  1M1K 2;  2VF1 A;  3QWU A;  1Z02 A;  3I07 A;  1S72 Z;  1I3Q I;  3BG1 B;  3KIH A;  2GTI A;  3CCM 1;  1YIT Z;  5CM2 M;  2QA4 1;  1I50 I;  2KPI A;  1TWH I;  1Q7Y 1;  3CCV Z;  1K9M 2;  1WCM I;  1USP A;  1QYP A;  2R93 I;  2JA6 I;  1KD1 2;  1ZH1 A;  1YHQ Z;  2HU9 A;  3CCR Z;  2HF1 A;  3CC4 Z;  1N8R 2;  1YUK A;  4A3B I;  1VQM Z;  4QTU A;  3CCQ Z;  2NVT I;  1N2F A;  1M90 2;  3NDJ A;  3G71 1;  3G4S 1;  1NP6 A;  2M6N A;  4X6A I;  4A3I I;  1K73 2;  4A3F I;  2E9H A;  4TNU A;  2P28 A;  2KI7 B;  4Y7N I;  1RLY A;  4NBD A;  2JUB A;  1JJ2 Z;  1RQF A;  1JJ2 Y;  2OZK A;  4NFR A;  3J81 b;  1VQ8 Z;  4NBC A;  3ESW A;  5IT9 f;  1YJN 1;  3J7A 4;  1QVG Z;  4E31 A;  4RVF A;  3GTQ I;  3M4O I;  5LL6 f;  4BY7 I;  3IFU A;  3HOZ I;  3MZL B;  3S1M I;  1YJ9 1;  3J81 f;  1KQS Z;  4NBA A;  2QA4 Z;  2I3C A;  4NOZ A;  2DE6 A;  3CCJ 1;  1X3Z A;  2JS4 A;  2RBL A;  4MXU A;  4E33 A;  1S7M A;  4E2Y A;  3NH8 A;  3NDI A;  4BBR I;  3HOV I;  3HOW I;  1VQ5 1;  3CMA 1;  4A3J I;  2OTL Z;  4NB9 A;  4DQY B;  2QRD B;  2R6M A;  5D1O B;  2PK7 A;  1VQO Z;  3GTM I;  1Q82 2;  3S17 I;  1NJI 2;  1VQN 1;  2LFU A;  5T64 A;  2V8J A;  5FLM I;  2IZ3 A;  2RT9 A;  3VMH A;  5T6B A;  1W2B Y;  4A3D I;  1VQ4 1;  1YI2 Z;  2G2K A;  1Q86 1;  2JR6 A;  5D1O A;  2VUG A;  4MD7 A;  3CC7 Z;  2DE5 A;  2PM9 A;  1Q81 2;  5C44 I;  3CCU 1;  3GTP I;  1QVF Y;  4NB8 A;  4A3L I;  4MD9 A;  3NH5 A;  5C3E I;  1YJN Z;  5A2Q b;  4MRI A;  1DL6 A;  4RVH A;  4NH1 C;  3CME 1;  2OTJ 1;  1Y1V I;  3S1Q I;  2V8K A;  2E2J I;  1VQK 1;  2R92 I;  1YJ9 Z;  3CD6 1;  4NBH A;  1VQ6 Z;  2JMO A;  1K8A 1;  4DGL A;  5A2Q f;  1KC8 1;  3CCJ Z;  3Q87 A;  3G6E 1;  1R9T I;  4A93 I;  3FKI I;  3IX0 A;  1YJW Z;  3CMA Z;  3H3V J;  4A3K I;  3CXC Z;  5IT9 b;  1QF8 A;  3CXC Y;  3NFZ A;  2YU9 I;  1YIJ Z;  3CCE 1;  3LUS A;  4HGY A;  1VQN Z;  3CCS 1;  3HKZ A;  4HH4 A;  3I4M I;  4A3M I;  4E2Z A;  3CPW Y;  3OW2 Y;  2R7Z I;  2Q4Z A;  3D9X A;  3HOY I;  1VLA A;  1JWH C;  2QRE B;  4RVG A;  3MON A;  1VQ9 1;  3CC2 1;  1M1K 1;  1VQ4 Z;  3HOU I;  3EER A;  2EGT A;  2QRC B;  4S1T A;  1S72 1;  2JA8 I;  1RO2 A;  2WB1 A;  3CCM Z;  1X0T A;  1LQL A;  2Q51 A;  1Q7Y 2;  1K9M 1;  1TWG I;  1VQL 1;  3D6W A;  1P9N A;  2RHB A;  5IP9 I;  1ZB9 A;  1KD1 1;  5IP7 I;  3CME Z;  2OTJ Z;  3F3F C;  1VQK Z;  3CC4 1;  3CD6 Z;  1WW9 A;  3VMI A;  3GTL I;  1Y1V S;  2QEX 1;  5D1P A;  3TE5 B;  3VB9 A;  4RV9 A;  1N8R 1;  3S1N I;  2OOX B;  3I55 1;  4XX2 A;  1VQM 1;  4E2X A;  3CCQ 1;  2IZ4 A;  2JNY A;  1W2B Z;  3IF8 A;  1M90 1;  4MON A;  1K83 I;  4BY1 I;  3G71 Z;  3I56 1;  3G4S Z;  1K73 1;  3MZK B;  2NVY I;  4NBF A;  3I4N I;  5T67 A;  2B63 I;  1WII A;  2V8I A;  4RVD A;  2RPR A;  3CCE Z;  2LIY A;  1YUA A;  3K7A I;  3GCF A;  3CCS Z;  1Z01 A;  1QVF Z;  4NBG A;  2K5R A;  3U50 C;  3TDH B;  2AKL A;  2QLV B;  3CC2 Z;  3FQM A;  1TFI A;  3S16 I;  2W04 A;  3CCL 1;  4Y52 I;  4CL1 A;  4RS4 A;  3JAM b;  2VUM I;  5FLX b;  3RZO I;  4E32 A;  3S1R I;  3GTO I;  2Y0S A;  4A3C I;  1VQL Z;  2QR1 B;  2QKD A;  4BXX I;  2DE7 A;  1PFT A;  2OTL 1;  3JAM f;  1VQ5 Z;  1Y1W I;  1SFO I;  2JA7 I;  4E30 A;  3H0G I;  1RO4 A;  5FLX f;  1VQO 1;  5C4J I;  1Q82 1;  1RNI A;  2GU2 A;  4MH4 A;  3GTG I;  1VQ7 1;  1NJI 1;  2QEX Z;  3EED A;  1X3W A;  3PO3 I;  4A3G I;  3S14 I;  3I55 Z;  5AN9 F;  3CPW Z;  3OW2 Z;  3GTM S;  1VQP 1;  1I6H I;  2H85 A;  3I56 Z;  3GTK I;  1TWA I;  2J6A A;  2O4H A;  1YI2 1;  2M48 A;  1Q86 2;  1ML8 A;  1TWC I;  4MD8 A;  2ZAE B;  3CC7 1;  2F4M A;  1Q81 1;  1YIT 1;  3VMG A;  3CCU Z;  4EWC A;  3CCV 1;  2GTH A;  3CQZ I;  2RIQ A;  4DK1 A;  3VTN A;  3PO2 I;  1QVG Y;  2BJO A;  1KRL A;  3GTJ I;  2W03 A;  3M3Y I;  1YHQ 1;  2O53 A;  2WAQ A;  3CCR 1;  2JA5 I;  4AYB A;  3CCL Z;  3RZD I;  1VQ6 1;  1KQS Y;  2E2I I;  3KIF A;  3NH4 A;  3BG0 B;  3P5J B;  4E2W A;  1K8A 2;  1KC8 2;  1RO0 A;  2F4O A;  2E2H I;  1ZB8 A;  4BBS I;  3J80 b;  3G6E Z;  3GKQ A;  5C4X I;  3S2H I;  2PMZ A;  4QTT A;  1YJW 1;  4A3E I;  2OOY B;  4NBB A;  1L1O C;  2NVQ I;  2NVX I;  3HOX I;  1YIJ 1;  4HGZ A;  1VQ7 Z;  1Z03 A;  3J80 f;  3S2D I;  1USP B;  2K3R A;  3F3P C;  4NBE A;  1VQP Z;  2YAD A;  1VQ8 1;  3FQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...