1ZH1A

Structure of the zinc-binding domain of hcv ns5a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
163
structure length
163
Chain Sequence
FFSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFLVGLNQYLVGSQLPCEPEPDVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords non-structural polyprotein
publication title Structure of the zinc-binding domain of an essential component of the hepatitis C virus replicase.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Metal binding protein
total genus 27
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08301 HCV_NS5a_1b Hepatitis C virus non-structural 5a domain 1b
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.210 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zh1A01
2.20.25.220 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zh1A02
3FQQA 4CL1A 1ZH1A 3FQMA
chains in the Genus database with same CATH superfamily
1TWGI 2NVXI 3VMIA 2VUMI 2V45A 2W03A 2NVQI 1VQP1 3GTLI 3CCQZ 3S1NI 1YJWZ 2JR6A 4EWCA 1VQ6Z 1WJ2A 3MZLB 5FLMI 5FLXb 3U50C 1K9M2 1VQOZ 1VQM1 3PO3S 4A3CI 3NH8A 1M901 3RZOI 1ZB9A 1VQ8Z 1JWHC 5C4JI 4RVHA 2IV2X 1VQ7Z 2JA6I 3CCVZ 1KD12 2JIOA 2JIMA 1YI21 3GTKI 4BBSI 1KRLA 1YIJ1 3CD6Z 2I3CA 5T64A 1NJI1 2OOXB 2LIYA 1Q861 4A3DI 1PFTA 2Q51A 1I3QI 3EERA 3KIHA 4E33A 1USPA 1VQN1 2H85A 4CL1A 2QRDB 3G6EZ 2JNYA 2NVYI 3GTJI 3CCEZ 2QA4Z 1TWCI 3I07A 5IT9f 1VQ41 2OTL1 1USPB 3M3YI 2OTJ1 3GTMI 3JAMf 3GTOI 3KIFA 3CCSZ 1P9NA 2JIRA 3FKII 1YJ9Z 2JMOA 1N8R1 3I56Z 5T67A 4HGYA 1VQKZ 2R7ZI 2KPIA 1KQSY 3CCQ1 3TE5B 1YJW1 1VQ61 3S16I 3CC2Z 1YITZ 1WCMI 5C44I 1VQO1 4MD9A 3I4MI 2QKDA 1DL6A 2LEXA 2V8IA 3S2HI 4NBFA 1KQSZ 5IP9I 1VQ81 3CC41 4E30A 4XX2A 3I4NI 2R93I 3CCV1 5A2Qb 1ML8A 2IZ3A 3S1RI 2RT9A 3P5JB 3G4SZ 3MZKB 1Y1VI 3CD61 1VQLZ 1QXFA 3CPWY 4RV9A 4HGZA 3BG1B 1Q811 4DQYB 2R92I 3J81b 2VPYA 3D9XA 2QEXZ 1K83I 3CMAZ 2OZKA 3CCE1 3CCJZ 1I50I 3CCL1 2QA41 3CCRZ 4A3LI 1M1K2 3Q87A 3S17I 1Z02A 4NBHA 2RIQA 2J6AA 1I6HI 3QWUA 2VF1A 3J7A4 1S72Z 3GTPI 1S7MA 4RVDA 2RBLA 1VQ51 3CCS1 1RQFA 4RS4A 1Q7Y2 1VLAA 2JIQA 1YJ91 3I561 2E9HA 3G71Z 4A3MI 1JJ2Y 1VQK1 2QLVB 4MH4A 5LL6f 3M4OI 3CC21 1NP6A 3GTGI 3H3VJ 3NDJA 2OOYB 3FQQA 2JIPA 4RVFA 2AYDA 3ESWA 1JJ2Z 1LQLA 2LFUA 1Y1WI 4NBEA 1Q822 2K3RA 5AN9F 3TDHB 3NH5A 4A3II 2E2JI 3J80f 1SIWA 1RO0A 3T4NB 3G4S1 1FDOA 1VQ9Z 2E2II 1TWFI 3GTMS 3D6WA 4E31A 3CC7Z 1VQL1 4NH1C 2GU2A 1K8A1 4MONA 2Q4ZA 3NH4A 4E2XA 1N2FA 2IZ4A 2QEX1 2VUGA 3CMA1 3BG0B 1KC81 4A3FI 3CCJ1 5IT9b 3CCR1 1YHQZ 2PM9A 4MRIA 2V8JA 4DGLA 3JAMb 5D1OA 1K9M1 1Z03A 1M902 2E7ZA 2DE6A 1YJNZ 3G711 1Y1VS 2PK7A 3F3FC 5D1OB 2JA5I 1VQ71 1X3ZA 4E32A 2HU9A 3HOYI 2M48A 2VPZA 2Y0SA 1QF8A 1KD11 3S14I 2R6MA 3CMEZ 1NJI2 1YIJZ 4BY7I 5T6BA 3I55Z 1Q862 3VMHA 4S1TA 3VB9A 1VQNZ 3G6E1 3GCFA 5D1PA 1VQ91 2V8KA 4A3KI 3CPWZ 4BXXI 2AKLA 5CM2M 3CCMZ 2O4HA 3CC71 4QTTA 3CXCY 4NBBA 2E2HI 2WB1A 1K732 5IP7I 2GTIA 1YUKA 2RPRA 1RNIA 5FLXf 2G2KA 3CXCZ 1RO2A 1SFOI 1YHQ1 2O53A 2EGTA 1N8R2 3HOUI 1QYPA 4QTUA 3OW2Y 3NDIA 3F3PC 1Z01A 4TNUA 5C3EI 3GTQI 2BJOA 1W2BY 1QVFY 1TWHI 2PMZA 1YIT1 4E2WA 2F4MA 2RHBA 1TWAI 1WIIA 2V3VA 3H0GI 3OW2Z 2K5RA 3HKZA 3HOXI 3VMGA 1YJN1 2P28A 3CC4Z 4NBGA 1W2BZ 1FDIA 3IF8A 1QVFZ 1ZB8A 2JUBA 3PO3I 2ZAEB 4DK1A 3K7AI 3HOVI 1Y8CA 3IR7A 2YU9I 2DE5A 3CME1 4MD8A 3S1QI 1NUIA 4NBAA 3I551 1L1OC 2NVTI 3D2LA 3CCUZ 1Q812 1RLYA 3J80b 4MD7A 2NAPA 5C4XI 2QR1B 4NBDA 2P3YA 1X3WA 3CCLZ 2VPWA 3CCM1 1M1K1 3S1MI 1WW9A 1S721 4Y52I 3RZDI 1VQPZ 3S2DI 4E2ZA 1Q16A 1K731 3GKQA 4MXUA 3HOWI 1WZNA 1VQ5Z 2VPXA 1R9TI 2JA8I 2B63I 2WAQA 3CQZI 1VQMZ 1Q7Y1 2W04A 4NOZA 2JA7I 1RO4A 1AA6A 4NBCA 3PO2I 4A3JI 3FQMA 4AYBA 1ZH1A 3MONA 3IX0A 4A93I 2JS4A 5A2Qf 2DE7A 1YI2Z 3S15I 2F4OA 4E2YA 4NB8A 3IFUA 4NB9A 2YADA 1Q821 4RVGA 3NFZA 3LUSA 1QVGY 3HOZI 4A3BI 4Y7NI 3J81f 2QREB 1YUAA 3EEDA 2QRCB 4BY1I 3VTNA 2HF1A 1VQ4Z 4A3GI 1K8A2 2KI7B 2OTLZ 4HH4A 1QVGZ 4NFRA 2GTHA 4A3EI 3CCU1 2OTJZ 1X0TA 1KC82 4BBRI 1TFIA 4X6AI 2M6NA
chains in the Genus database with same CATH topology
1TWGI 2NVXI 3VMIA 2VUMI 2W03A 2NVQI 1VQP1 3GTLI 3CCQZ 3S1NI 1YJWZ 2JR6A 4EWCA 1VQ6Z 3MZLB 5FLMI 5FLXb 3U50C 1K9M2 1VQOZ 1VQM1 3PO3S 4A3CI 3NH8A 1M901 3RZOI 1ZB9A 1VQ8Z 1JWHC 5C4JI 4RVHA 1VQ7Z 2JA6I 3CCVZ 1KD12 1YI21 3GTKI 4BBSI 1KRLA 1YIJ1 3CD6Z 2I3CA 5T64A 1NJI1 2OOXB 2LIYA 1Q861 4A3DI 1PFTA 2Q51A 1I3QI 3EERA 3KIHA 4E33A 1USPA 1VQN1 2H85A 4CL1A 2QRDB 3G6EZ 2JNYA 2NVYI 3GTJI 3CCEZ 2QA4Z 1TWCI 3I07A 5IT9f 1VQ41 2OTL1 1USPB 3M3YI 2OTJ1 3GTMI 3JAMf 3GTOI 3KIFA 3CCSZ 1P9NA 3FKII 1YJ9Z 2JMOA 1N8R1 3I56Z 5T67A 4HGYA 1VQKZ 2R7ZI 2KPIA 1KQSY 3CCQ1 3TE5B 1YJW1 1VQ61 3S16I 3CC2Z 1YITZ 1WCMI 5C44I 1VQO1 4MD9A 3I4MI 2QKDA 1DL6A 2V8IA 3S2HI 4NBFA 1KQSZ 5IP9I 1VQ81 3CC41 4E30A 4XX2A 3I4NI 2R93I 3CCV1 5A2Qb 1ML8A 2IZ3A 3S1RI 2RT9A 3P5JB 3G4SZ 3MZKB 1Y1VI 3CD61 1VQLZ 3CPWY 4RV9A 4HGZA 3BG1B 1Q811 4DQYB 2R92I 3J81b 3D9XA 2QEXZ 1K83I 3CMAZ 2OZKA 3CCE1 3CCJZ 1I50I 3CCL1 2QA41 3CCRZ 4A3LI 1M1K2 3Q87A 3S17I 1Z02A 4NBHA 2RIQA 2J6AA 1I6HI 3QWUA 2VF1A 3J7A4 1S72Z 3GTPI 1S7MA 4RVDA 2RBLA 1VQ51 3CCS1 1RQFA 4RS4A 1Q7Y2 1VLAA 1YJ91 3I561 2E9HA 3G71Z 4A3MI 1JJ2Y 1VQK1 2QLVB 4MH4A 5LL6f 3M4OI 3CC21 1NP6A 3GTGI 3H3VJ 3NDJA 2OOYB 3FQQA 4RVFA 3ESWA 1JJ2Z 1LQLA 2LFUA 1Y1WI 4NBEA 1Q822 2K3RA 5AN9F 3TDHB 3NH5A 4A3II 2E2JI 3J80f 1RO0A 3T4NB 3G4S1 1VQ9Z 2E2II 1TWFI 3GTMS 3D6WA 4E31A 3CC7Z 1VQL1 4NH1C 2GU2A 1K8A1 4MONA 2Q4ZA 3NH4A 4E2XA 1N2FA 2IZ4A 2QEX1 2VUGA 3CMA1 3BG0B 1KC81 4A3FI 3CCJ1 5IT9b 3CCR1 1YHQZ 2PM9A 4MRIA 2V8JA 4DGLA 3JAMb 5D1OA 1K9M1 1Z03A 1M902 2DE6A 1YJNZ 3G711 1Y1VS 2PK7A 3F3FC 5D1OB 2JA5I 1VQ71 1X3ZA 4E32A 2HU9A 3HOYI 2M48A 2Y0SA 1QF8A 1KD11 3S14I 2R6MA 3CMEZ 1NJI2 1YIJZ 4BY7I 5T6BA 3I55Z 1Q862 3VMHA 4S1TA 3VB9A 1VQNZ 3G6E1 3GCFA 5D1PA 1VQ91 2V8KA 4A3KI 3CPWZ 4BXXI 2AKLA 5CM2M 3CCMZ 2O4HA 3CC71 4QTTA 3CXCY 4NBBA 2E2HI 2WB1A 1K732 5IP7I 2GTIA 1YUKA 2RPRA 1RNIA 5FLXf 2G2KA 3CXCZ 1RO2A 1SFOI 1YHQ1 2O53A 2EGTA 1N8R2 3HOUI 1QYPA 4QTUA 3OW2Y 3NDIA 3F3PC 1Z01A 4TNUA 5C3EI 3GTQI 2BJOA 1W2BY 1QVFY 1TWHI 2PMZA 1YIT1 4E2WA 2F4MA 2RHBA 1TWAI 1WIIA 3H0GI 3OW2Z 2K5RA 3HKZA 3HOXI 3VMGA 1YJN1 2P28A 3CC4Z 4NBGA 1W2BZ 3IF8A 1QVFZ 1ZB8A 2JUBA 3PO3I 2ZAEB 4DK1A 3K7AI 3HOVI 2YU9I 2DE5A 3CME1 4MD8A 3S1QI 1NUIA 4NBAA 3I551 1L1OC 2NVTI 3CCUZ 1Q812 1RLYA 3J80b 4MD7A 5C4XI 2QR1B 4NBDA 2P3YA 1X3WA 3CCLZ 3CCM1 1M1K1 3S1MI 1WW9A 1S721 4Y52I 3RZDI 1VQPZ 3S2DI 4E2ZA 1K731 3GKQA 4MXUA 3HOWI 1VQ5Z 1R9TI 2JA8I 2B63I 2WAQA 3CQZI 1VQMZ 1Q7Y1 2W04A 4NOZA 2JA7I 1RO4A 4NBCA 3PO2I 4A3JI 3FQMA 4AYBA 1ZH1A 3MONA 3IX0A 4A93I 2JS4A 5A2Qf 2DE7A 1YI2Z 3S15I 2F4OA 4E2YA 4NB8A 3IFUA 4NB9A 2YADA 1Q821 4RVGA 3NFZA 3LUSA 1QVGY 3HOZI 4A3BI 4Y7NI 3J81f 2QREB 1YUAA 3EEDA 2QRCB 4BY1I 3VTNA 2HF1A 1VQ4Z 4A3GI 1K8A2 2KI7B 2OTLZ 4HH4A 1QVGZ 4NFRA 2GTHA 4A3EI 3CCU1 2OTJZ 1X0TA 1KC82 4BBRI 1TFIA 4X6AI 2M6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FQQ A;  4CL1 A;  1ZH1 A;  3FQM A; 
#chains in the Genus database with same CATH topology
 1TWG I;  2NVX I;  3VMI A;  2VUM I;  2V45 A;  2W03 A;  2NVQ I;  1VQP 1;  3GTL I;  3CCQ Z;  3S1N I;  1YJW Z;  2JR6 A;  4EWC A;  1VQ6 Z;  1WJ2 A;  3MZL B;  5FLM I;  5FLX b;  3U50 C;  1K9M 2;  1VQO Z;  1VQM 1;  3PO3 S;  4A3C I;  3NH8 A;  1M90 1;  3RZO I;  1ZB9 A;  1VQ8 Z;  1JWH C;  5C4J I;  4RVH A;  2IV2 X;  1VQ7 Z;  2JA6 I;  3CCV Z;  1KD1 2;  2JIO A;  2JIM A;  1YI2 1;  3GTK I;  4BBS I;  1KRL A;  1YIJ 1;  3CD6 Z;  2I3C A;  5T64 A;  1NJI 1;  2OOX B;  2LIY A;  1Q86 1;  4A3D I;  1PFT A;  2Q51 A;  1I3Q I;  3EER A;  3KIH A;  4E33 A;  1USP A;  1VQN 1;  2H85 A;  4CL1 A;  2QRD B;  3G6E Z;  2JNY A;  2NVY I;  3GTJ I;  3CCE Z;  2QA4 Z;  1TWC I;  3I07 A;  5IT9 f;  1VQ4 1;  2OTL 1;  1USP B;  3M3Y I;  2OTJ 1;  3GTM I;  3JAM f;  3GTO I;  3KIF A;  3CCS Z;  1P9N A;  2JIR A;  3FKI I;  1YJ9 Z;  2JMO A;  1N8R 1;  3I56 Z;  5T67 A;  4HGY A;  1VQK Z;  2R7Z I;  2KPI A;  1KQS Y;  3CCQ 1;  3TE5 B;  1YJW 1;  1VQ6 1;  3S16 I;  3CC2 Z;  1YIT Z;  1WCM I;  5C44 I;  1VQO 1;  4MD9 A;  3I4M I;  2QKD A;  1DL6 A;  2LEX A;  2V8I A;  3S2H I;  4NBF A;  1KQS Z;  5IP9 I;  1VQ8 1;  3CC4 1;  4E30 A;  4XX2 A;  3I4N I;  2R93 I;  3CCV 1;  5A2Q b;  1ML8 A;  2IZ3 A;  3S1R I;  2RT9 A;  3P5J B;  3G4S Z;  3MZK B;  1Y1V I;  3CD6 1;  1VQL Z;  1QXF A;  3CPW Y;  4RV9 A;  4HGZ A;  3BG1 B;  1Q81 1;  4DQY B;  2R92 I;  3J81 b;  2VPY A;  3D9X A;  2QEX Z;  1K83 I;  3CMA Z;  2OZK A;  3CCE 1;  3CCJ Z;  1I50 I;  3CCL 1;  2QA4 1;  3CCR Z;  4A3L I;  1M1K 2;  3Q87 A;  3S17 I;  1Z02 A;  4NBH A;  2RIQ A;  2J6A A;  1I6H I;  3QWU A;  2VF1 A;  3J7A 4;  1S72 Z;  3GTP I;  1S7M A;  4RVD A;  2RBL A;  1VQ5 1;  3CCS 1;  1RQF A;  4RS4 A;  1Q7Y 2;  1VLA A;  2JIQ A;  1YJ9 1;  3I56 1;  2E9H A;  3G71 Z;  4A3M I;  1JJ2 Y;  1VQK 1;  2QLV B;  4MH4 A;  5LL6 f;  3M4O I;  3CC2 1;  1NP6 A;  3GTG I;  3H3V J;  3NDJ A;  2OOY B;  3FQQ A;  2JIP A;  4RVF A;  2AYD A;  3ESW A;  1JJ2 Z;  1LQL A;  2LFU A;  1Y1W I;  4NBE A;  1Q82 2;  2K3R A;  5AN9 F;  3TDH B;  3NH5 A;  4A3I I;  2E2J I;  3J80 f;  1SIW A;  1RO0 A;  3T4N B;  3G4S 1;  1FDO A;  1VQ9 Z;  2E2I I;  1TWF I;  3GTM S;  3D6W A;  4E31 A;  3CC7 Z;  1VQL 1;  4NH1 C;  2GU2 A;  1K8A 1;  4MON A;  2Q4Z A;  3NH4 A;  4E2X A;  1N2F A;  2IZ4 A;  2QEX 1;  2VUG A;  3CMA 1;  3BG0 B;  1KC8 1;  4A3F I;  3CCJ 1;  5IT9 b;  3CCR 1;  1YHQ Z;  2PM9 A;  4MRI A;  2V8J A;  4DGL A;  3JAM b;  5D1O A;  1K9M 1;  1Z03 A;  1M90 2;  2E7Z A;  2DE6 A;  1YJN Z;  3G71 1;  1Y1V S;  2PK7 A;  3F3F C;  5D1O B;  2JA5 I;  1VQ7 1;  1X3Z A;  4E32 A;  2HU9 A;  3HOY I;  2M48 A;  2VPZ A;  2Y0S A;  1QF8 A;  1KD1 1;  3S14 I;  2R6M A;  3CME Z;  1NJI 2;  1YIJ Z;  4BY7 I;  5T6B A;  3I55 Z;  1Q86 2;  3VMH A;  4S1T A;  3VB9 A;  1VQN Z;  3G6E 1;  3GCF A;  5D1P A;  1VQ9 1;  2V8K A;  4A3K I;  3CPW Z;  4BXX I;  2AKL A;  5CM2 M;  3CCM Z;  2O4H A;  3CC7 1;  4QTT A;  3CXC Y;  4NBB A;  2E2H I;  2WB1 A;  1K73 2;  5IP7 I;  2GTI A;  1YUK A;  2RPR A;  1RNI A;  5FLX f;  2G2K A;  3CXC Z;  1RO2 A;  1SFO I;  1YHQ 1;  2O53 A;  2EGT A;  1N8R 2;  3HOU I;  1QYP A;  4QTU A;  3OW2 Y;  3NDI A;  3F3P C;  1Z01 A;  4TNU A;  5C3E I;  3GTQ I;  2BJO A;  1W2B Y;  1QVF Y;  1TWH I;  2PMZ A;  1YIT 1;  4E2W A;  2F4M A;  2RHB A;  1TWA I;  1WII A;  2V3V A;  3H0G I;  3OW2 Z;  2K5R A;  3HKZ A;  3HOX I;  3VMG A;  1YJN 1;  2P28 A;  3CC4 Z;  4NBG A;  1W2B Z;  1FDI A;  3IF8 A;  1QVF Z;  1ZB8 A;  2JUB A;  3PO3 I;  2ZAE B;  4DK1 A;  3K7A I;  3HOV I;  1Y8C A;  3IR7 A;  2YU9 I;  2DE5 A;  3CME 1;  4MD8 A;  3S1Q I;  1NUI A;  4NBA A;  3I55 1;  1L1O C;  2NVT I;  3D2L A;  3CCU Z;  1Q81 2;  1RLY A;  3J80 b;  4MD7 A;  2NAP A;  5C4X I;  2QR1 B;  4NBD A;  2P3Y A;  1X3W A;  3CCL Z;  2VPW A;  3CCM 1;  1M1K 1;  3S1M I;  1WW9 A;  1S72 1;  4Y52 I;  3RZD I;  1VQP Z;  3S2D I;  4E2Z A;  1Q16 A;  1K73 1;  3GKQ A;  4MXU A;  3HOW I;  1WZN A;  1VQ5 Z;  2VPX A;  1R9T I;  2JA8 I;  2B63 I;  2WAQ A;  3CQZ I;  1VQM Z;  1Q7Y 1;  2W04 A;  4NOZ A;  2JA7 I;  1RO4 A;  1AA6 A;  4NBC A;  3PO2 I;  4A3J I;  3FQM A;  4AYB A;  1ZH1 A;  3MON A;  3IX0 A;  4A93 I;  2JS4 A;  5A2Q f;  2DE7 A;  1YI2 Z;  3S15 I;  2F4O A;  4E2Y A;  4NB8 A;  3IFU A;  4NB9 A;  2YAD A;  1Q82 1;  4RVG A;  3NFZ A;  3LUS A;  1QVG Y;  3HOZ I;  4A3B I;  4Y7N I;  3J81 f;  2QRE B;  1YUA A;  3EED A;  2QRC B;  4BY1 I;  3VTN A;  2HF1 A;  1VQ4 Z;  4A3G I;  1K8A 2;  2KI7 B;  2OTL Z;  4HH4 A;  1QVG Z;  4NFR A;  2GTH A;  4A3E I;  3CCU 1;  2OTJ Z;  1X0T A;  1KC8 2;  4BBR I;  1TFI A;  4X6A I;  2M6N A; 
#chains in the Genus database with same CATH homology
 1TWG I;  2NVX I;  3VMI A;  2VUM I;  2W03 A;  2NVQ I;  1VQP 1;  3GTL I;  3CCQ Z;  3S1N I;  1YJW Z;  2JR6 A;  4EWC A;  1VQ6 Z;  3MZL B;  5FLM I;  5FLX b;  3U50 C;  1K9M 2;  1VQO Z;  1VQM 1;  3PO3 S;  4A3C I;  3NH8 A;  1M90 1;  3RZO I;  1ZB9 A;  1VQ8 Z;  1JWH C;  5C4J I;  4RVH A;  1VQ7 Z;  2JA6 I;  3CCV Z;  1KD1 2;  1YI2 1;  3GTK I;  4BBS I;  1KRL A;  1YIJ 1;  3CD6 Z;  2I3C A;  5T64 A;  1NJI 1;  2OOX B;  2LIY A;  1Q86 1;  4A3D I;  1PFT A;  2Q51 A;  1I3Q I;  3EER A;  3KIH A;  4E33 A;  1USP A;  1VQN 1;  2H85 A;  4CL1 A;  2QRD B;  3G6E Z;  2JNY A;  2NVY I;  3GTJ I;  3CCE Z;  2QA4 Z;  1TWC I;  3I07 A;  5IT9 f;  1VQ4 1;  2OTL 1;  1USP B;  3M3Y I;  2OTJ 1;  3GTM I;  3JAM f;  3GTO I;  3KIF A;  3CCS Z;  1P9N A;  3FKI I;  1YJ9 Z;  2JMO A;  1N8R 1;  3I56 Z;  5T67 A;  4HGY A;  1VQK Z;  2R7Z I;  2KPI A;  1KQS Y;  3CCQ 1;  3TE5 B;  1YJW 1;  1VQ6 1;  3S16 I;  3CC2 Z;  1YIT Z;  1WCM I;  5C44 I;  1VQO 1;  4MD9 A;  3I4M I;  2QKD A;  1DL6 A;  2V8I A;  3S2H I;  4NBF A;  1KQS Z;  5IP9 I;  1VQ8 1;  3CC4 1;  4E30 A;  4XX2 A;  3I4N I;  2R93 I;  3CCV 1;  5A2Q b;  1ML8 A;  2IZ3 A;  3S1R I;  2RT9 A;  3P5J B;  3G4S Z;  3MZK B;  1Y1V I;  3CD6 1;  1VQL Z;  3CPW Y;  4RV9 A;  4HGZ A;  3BG1 B;  1Q81 1;  4DQY B;  2R92 I;  3J81 b;  3D9X A;  2QEX Z;  1K83 I;  3CMA Z;  2OZK A;  3CCE 1;  3CCJ Z;  1I50 I;  3CCL 1;  2QA4 1;  3CCR Z;  4A3L I;  1M1K 2;  3Q87 A;  3S17 I;  1Z02 A;  4NBH A;  2RIQ A;  2J6A A;  1I6H I;  3QWU A;  2VF1 A;  3J7A 4;  1S72 Z;  3GTP I;  1S7M A;  4RVD A;  2RBL A;  1VQ5 1;  3CCS 1;  1RQF A;  4RS4 A;  1Q7Y 2;  1VLA A;  1YJ9 1;  3I56 1;  2E9H A;  3G71 Z;  4A3M I;  1JJ2 Y;  1VQK 1;  2QLV B;  4MH4 A;  5LL6 f;  3M4O I;  3CC2 1;  1NP6 A;  3GTG I;  3H3V J;  3NDJ A;  2OOY B;  3FQQ A;  4RVF A;  3ESW A;  1JJ2 Z;  1LQL A;  2LFU A;  1Y1W I;  4NBE A;  1Q82 2;  2K3R A;  5AN9 F;  3TDH B;  3NH5 A;  4A3I I;  2E2J I;  3J80 f;  1RO0 A;  3T4N B;  3G4S 1;  1VQ9 Z;  2E2I I;  1TWF I;  3GTM S;  3D6W A;  4E31 A;  3CC7 Z;  1VQL 1;  4NH1 C;  2GU2 A;  1K8A 1;  4MON A;  2Q4Z A;  3NH4 A;  4E2X A;  1N2F A;  2IZ4 A;  2QEX 1;  2VUG A;  3CMA 1;  3BG0 B;  1KC8 1;  4A3F I;  3CCJ 1;  5IT9 b;  3CCR 1;  1YHQ Z;  2PM9 A;  4MRI A;  2V8J A;  4DGL A;  3JAM b;  5D1O A;  1K9M 1;  1Z03 A;  1M90 2;  2DE6 A;  1YJN Z;  3G71 1;  1Y1V S;  2PK7 A;  3F3F C;  5D1O B;  2JA5 I;  1VQ7 1;  1X3Z A;  4E32 A;  2HU9 A;  3HOY I;  2M48 A;  2Y0S A;  1QF8 A;  1KD1 1;  3S14 I;  2R6M A;  3CME Z;  1NJI 2;  1YIJ Z;  4BY7 I;  5T6B A;  3I55 Z;  1Q86 2;  3VMH A;  4S1T A;  3VB9 A;  1VQN Z;  3G6E 1;  3GCF A;  5D1P A;  1VQ9 1;  2V8K A;  4A3K I;  3CPW Z;  4BXX I;  2AKL A;  5CM2 M;  3CCM Z;  2O4H A;  3CC7 1;  4QTT A;  3CXC Y;  4NBB A;  2E2H I;  2WB1 A;  1K73 2;  5IP7 I;  2GTI A;  1YUK A;  2RPR A;  1RNI A;  5FLX f;  2G2K A;  3CXC Z;  1RO2 A;  1SFO I;  1YHQ 1;  2O53 A;  2EGT A;  1N8R 2;  3HOU I;  1QYP A;  4QTU A;  3OW2 Y;  3NDI A;  3F3P C;  1Z01 A;  4TNU A;  5C3E I;  3GTQ I;  2BJO A;  1W2B Y;  1QVF Y;  1TWH I;  2PMZ A;  1YIT 1;  4E2W A;  2F4M A;  2RHB A;  1TWA I;  1WII A;  3H0G I;  3OW2 Z;  2K5R A;  3HKZ A;  3HOX I;  3VMG A;  1YJN 1;  2P28 A;  3CC4 Z;  4NBG A;  1W2B Z;  3IF8 A;  1QVF Z;  1ZB8 A;  2JUB A;  3PO3 I;  2ZAE B;  4DK1 A;  3K7A I;  3HOV I;  2YU9 I;  2DE5 A;  3CME 1;  4MD8 A;  3S1Q I;  1NUI A;  4NBA A;  3I55 1;  1L1O C;  2NVT I;  3CCU Z;  1Q81 2;  1RLY A;  3J80 b;  4MD7 A;  5C4X I;  2QR1 B;  4NBD A;  2P3Y A;  1X3W A;  3CCL Z;  3CCM 1;  1M1K 1;  3S1M I;  1WW9 A;  1S72 1;  4Y52 I;  3RZD I;  1VQP Z;  3S2D I;  4E2Z A;  1K73 1;  3GKQ A;  4MXU A;  3HOW I;  1VQ5 Z;  1R9T I;  2JA8 I;  2B63 I;  2WAQ A;  3CQZ I;  1VQM Z;  1Q7Y 1;  2W04 A;  4NOZ A;  2JA7 I;  1RO4 A;  4NBC A;  3PO2 I;  4A3J I;  3FQM A;  4AYB A;  1ZH1 A;  3MON A;  3IX0 A;  4A93 I;  2JS4 A;  5A2Q f;  2DE7 A;  1YI2 Z;  3S15 I;  2F4O A;  4E2Y A;  4NB8 A;  3IFU A;  4NB9 A;  2YAD A;  1Q82 1;  4RVG A;  3NFZ A;  3LUS A;  1QVG Y;  3HOZ I;  4A3B I;  4Y7N I;  3J81 f;  2QRE B;  1YUA A;  3EED A;  2QRC B;  4BY1 I;  3VTN A;  2HF1 A;  1VQ4 Z;  4A3G I;  1K8A 2;  2KI7 B;  2OTL Z;  4HH4 A;  1QVG Z;  4NFR A;  2GTH A;  4A3E I;  3CCU 1;  2OTJ Z;  1X0T A;  1KC8 2;  4BBR I;  1TFI A;  4X6A I;  2M6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...