2QEXZ

Negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Negamycin binds to the wall of the nascent chain exit tunnel of the 50S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qexZ00
1VQ41 1QVGY 1NJI1 3CCQ1 1JJ2Y 3I551 3CCMZ 1YJN1 3OW2Z 3CC41 1YIJZ 1M1K1 1S721 1YJW1 1N8R2 1M902 1K732 1VQL1 3CCJZ 1VQN1 1Q822 3CCS1 1VQ7Z 3CMEZ 3G711 3CD61 3CCE1 3CC71 1KQSY 1YITZ 2QA41 1M901 1K731 1VQ8Z 1VQ61 1Q821 3CC2Z 3CCV1 1Q7Y2 1QVFY 1YHQZ 2QEX1 1YJ9Z 3CCL1 1KC82 2OTLZ 3G6EZ 1VQK1 3I56Z 1YI2Z 1VQPZ 3CCU1 1K9M2 1W2BZ 1YJNZ 1VQM1 1YJWZ 3OW2Y 1Q7Y1 1VQ5Z 1VQLZ 1KC81 1VQNZ 1YIJ1 1N8R1 3CCR1 3CCSZ 3CPWZ 1W2BY 1VQOZ 1KD12 1Q812 1K9M1 3CCJ1 3G71Z 3CMAZ 1K8A2 3CCEZ 1VQ91 2OTJZ 1VQ71 1VQ4Z 3G4S1 1YIT1 3CCQZ 3I55Z 1KD11 1Q811 1QVGZ 3CC4Z 1JJ2Z 1S72Z 1K8A1 1VQ81 1YHQ1 3CCM1 3G6E1 1YI21 1VQP1 3I561 1Q862 3CD6Z 3CC7Z 3CCRZ 3CXCZ 1VQ51 2QA4Z 1KQSZ 3CPWY 3CME1 1VQ6Z 3CCVZ 1NJI2 1VQ9Z 1Q861 2QEXZ 1VQO1 3CCLZ 3CXCY 1QVFZ 1M1K2 3CMA1 1VQKZ 3G4SZ 3CC21 3CCUZ 2OTJ1 1YJ91 2OTL1 1VQMZ
chains in the Genus database with same CATH superfamily
5T6BA 3JAMb 1QVGY 5IP7I 1NJI1 5D1PA 1FDOA 3IFUA 3GTLI 4E32A 3VMGA 4XX2A 3J80b 1K732 2VF1A 3NH4A 3CCJZ 5FLXb 2NVYI 2I3CA 4DK1A 3G711 2YADA 4A3GI 3VMHA 1M901 3HOXI 2E2HI 1Q821 3CC2Z 1VQ61 1Q7Y2 1QVFY 3S16I 4Y52I 2VPYA 2OTLZ 3D6WA 1KRLA 1LQLA 2VPWA 3I56Z 1YI2Z 5C4XI 2DE7A 4NB9A 3GTGI 3S2DI 3PO2I 2JA6I 1AA6A 3GCFA 4NOZA 1VQLZ 2PM9A 3CCR1 3CCSZ 4NB8A 1Y1VS 2VUMI 1K9M1 1DL6A 4E2XA 1JWHC 5A2Qf 3BG0B 4NBBA 2NAPA 3RZDI 2O53A 1VQ71 2Q51A 2RPRA 1Y8CA 2IZ3A 4A3CI 3U50C 2R6MA 1NP6A 1Z03A 1JJ2Z 1RNIA 3CQZI 1YHQ1 3HOYI 5T64A 2RIQA 4QTUA 1RO0A 1Z01A 2R92I 3RZOI 2VUGA 5FLMI 3CXCZ 3D9XA 3EEDA 2E9HA 2RT9A 3CPWY 1ZB8A 3I07A 3F3FC 4MRIA 1VQ6Z 4MD9A 1NJI2 1VQ9Z 1I6HI 1Q861 5D1OA 1YUAA 5IT9b 3G4SZ 3CC21 2OTJ1 4BBSI 4BBRI 2OTL1 3NFZA 4RVFA 2QRCB 2RBLA 4E30A 1S721 3GTMI 2JA8I 4E2YA 1USPB 1M902 1TWAI 1VQL1 3IR7A 3Q87A 1Q822 3CCS1 1SFOI 3S14I 2RHBA 1VQ7Z 2V45A 4HH4A 3CMEZ 3FQMA 3NH5A 1KQSY 2QA41 4RS4A 2V8KA 4MD7A 2HU9A 1YHQZ 1YJ9Z 2V8IA 2H85A 1ZB9A 3CCU1 3HOVI 4RV9A 5CM2M 1K9M2 1W2BZ 3NDIA 1TWFI 2R93I 2QLVB 3OW2Y 2QKDA 3S2HI 4EWCA 3GKQA 1VQNZ 3J7A4 1YIJ1 2JR6A 4MXUA 2PMZA 2QR1B 1X3ZA 3CCEZ 2PK7A 1VQ91 2W04A 3QWUA 2OTJZ 2V8JA 4E33A 3PO3I 4BY1I 2M48A 5T67A 3G4S1 4A3EI 1YIT1 1KD11 2IZ4A 1QVGZ 4NBEA 2F4OA 1S72Z 1K8A1 1VQ81 5A2Qb 4X6AI 3IX0A 3G6E1 1VQP1 1Q862 3NDJA 1YUKA 1L1OC 1ZH1A 3VTNA 3M4OI 2KI7B 1VQ51 2QA4Z 2AYDA 3HOZI 3CME1 4NFRA 1VQO1 4DGLA 2JA5I 3CXCY 1P9NA 2E7ZA 1QVFZ 2DE5A 2LIYA 2Y0SA 3CCUZ 2E2II 1YJ91 1R9TI 1ML8A 1VQ41 3CCQ1 3I551 2F4MA 3CCMZ 1YIJZ 1M1K1 1N8R2 4A3LI 2JNYA 3GTQI 2R7ZI 3FKII 1VQN1 3KIHA 3BG1B 2JIMA 3EERA 3GTOI 3I4MI 1PFTA 3CD61 3CCE1 1YITZ 3S1NI 2V3VA 4NBFA 4AYBA 1VQ8Z 2OZKA 2JUBA 2QEX1 1USPA 3KIFA 3HKZA 2NVQI 3GTKI 1TWHI 3G6EZ 4A3KI 1VQPZ 1X0TA 1NUIA 2P28A 2AKLA 3IF8A 1YJNZ 1WJ2A 2DE6A 2IV2X 1VQM1 1YJWZ 2QREB 1VQ5Z 1QF8A 1KC81 1N8R1 1W2BY 3CPWZ 3HOUI 2KPIA 1VQOZ 1Y1VI 1KD12 4A3JI 2LEXA 1K8A2 3J81f 1VQ4Z 3H3VJ 4A3II 3CCQZ 2W03A 3I55Z 4RVGA 1Q811 5LL6f 3MZLB 3GTPI 1RQFA 2LFUA 2BJOA 3VB9A 3CCM1 4A3DI 2HF1A 1X3WA 2GU2A 3H0GI 2YU9I 3S1QI 4CL1A 1QYPA 4HGYA 4NBDA 3CD6Z 1I50I 2M6NA 2EGTA 4NH1C 1KQSZ 3MZKB 2JA7I 3JAMf 2QEXZ 1M1K2 3CMA1 2Q4ZA 4NBGA 4DQYB 4HGZA 5IP9I 1WZNA 4E2ZA 2J6AA 4A3FI 3J80f 1VQMZ 5FLXf 2JMOA 1TFIA 1JJ2Y 2G2KA 2WAQA 1YJN1 3OW2Z 4Y7NI 3CC41 3S17I 3TDHB 3K7AI 3GTMS 1YJW1 1RO2A 4NBAA 3M3YI 1WW9A 1TWGI 1WIIA 1N2FA 2O4HA 4E2WA 3S1RI 4MONA 3CC71 1QXFA 4RVDA 1K731 2JIQA 4BY7I 1I3QI 2K3RA 1TWCI 3CCV1 2GTHA 3CCL1 1KC82 5AN9F 4A93I 1Z02A 2K5RA 3MONA 1VQK1 3P5JB 2NVXI 3NH8A 1RO4A 5C4JI 2E2JI 4E31A 2GTIA 3LUSA 1Q7Y1 4NBHA 2JIOA 1Q16A 2VPZA 1K83I 1WCMI 1Q812 2WB1A 4RVHA 4TNUA 3CCJ1 3G71Z 3CMAZ 2B63I 1SIWA 4MD8A 2JIPA 3I4NI 3PO3S 3HOWI 5C44I 2QRDB 3S15I 4NBCA 3CC4Z 2JIRA 3J81b 5D1OB 3D2LA 2ZAEB 3S1MI 4MH4A 1VLAA 2NVTI 3I561 1YI21 3FQQA 3T4NB 1FDIA 5IT9f 3CC7Z 3VMIA 4QTTA 1Y1WI 3CCRZ 4S1TA 2OOYB 3TE5B 2JS4A 3CCVZ 5C3EI 3F3PC 2P3YA 3CCLZ 2OOXB 1S7MA 4A3BI 2VPXA 3GTJI 1VQKZ 4BXXI 4A3MI 1RLYA 3ESWA
chains in the Genus database with same CATH topology
5T6BA 3JAMb 1QVGY 5IP7I 1NJI1 5D1PA 3IFUA 3GTLI 4E32A 3VMGA 4XX2A 3J80b 1K732 2VF1A 3NH4A 3CCJZ 5FLXb 2NVYI 2I3CA 4DK1A 3G711 2YADA 4A3GI 3VMHA 1M901 3HOXI 2E2HI 1Q821 3CC2Z 1VQ61 1Q7Y2 1QVFY 3S16I 4Y52I 2OTLZ 3D6WA 1KRLA 1LQLA 3I56Z 1YI2Z 5C4XI 2DE7A 4NB9A 3GTGI 3S2DI 3PO2I 2JA6I 3GCFA 4NOZA 1VQLZ 2PM9A 3CCR1 3CCSZ 4NB8A 1Y1VS 2VUMI 1K9M1 1DL6A 4E2XA 1JWHC 5A2Qf 3BG0B 4NBBA 1VQ71 3RZDI 2O53A 2Q51A 2RPRA 2IZ3A 4A3CI 3U50C 2R6MA 1NP6A 1Z03A 1JJ2Z 1RNIA 3CQZI 1YHQ1 3HOYI 5T64A 2RIQA 4QTUA 1RO0A 1Z01A 2R92I 3RZOI 2VUGA 5FLMI 3CXCZ 3D9XA 3EEDA 2E9HA 2RT9A 3CPWY 1ZB8A 3I07A 3F3FC 4MRIA 1VQ6Z 4MD9A 1NJI2 1VQ9Z 1I6HI 1Q861 5D1OA 1YUAA 5IT9b 3G4SZ 3CC21 2OTJ1 4BBSI 4BBRI 2OTL1 3NFZA 4RVFA 2QRCB 2RBLA 4E30A 1S721 3GTMI 2JA8I 4E2YA 1USPB 1M902 1TWAI 1VQL1 3Q87A 1Q822 3CCS1 1SFOI 3S14I 2RHBA 1VQ7Z 4HH4A 3CMEZ 3FQMA 3NH5A 1KQSY 2QA41 4RS4A 2V8KA 4MD7A 2HU9A 1YHQZ 1YJ9Z 2V8IA 2H85A 1ZB9A 3CCU1 3HOVI 4RV9A 5CM2M 1K9M2 1W2BZ 3NDIA 1TWFI 2R93I 2QLVB 3OW2Y 2QKDA 3S2HI 4EWCA 3GKQA 1VQNZ 3J7A4 1YIJ1 2JR6A 4MXUA 2PMZA 2QR1B 1X3ZA 3CCEZ 2PK7A 1VQ91 2W04A 3QWUA 2OTJZ 2V8JA 4E33A 3PO3I 4BY1I 2M48A 5T67A 3G4S1 4A3EI 1YIT1 1KD11 2IZ4A 1QVGZ 4NBEA 2F4OA 1S72Z 1K8A1 1VQ81 5A2Qb 4X6AI 3IX0A 3G6E1 1VQP1 1Q862 3NDJA 1YUKA 1L1OC 1ZH1A 3VTNA 3M4OI 2KI7B 1VQ51 2QA4Z 3HOZI 3CME1 4NFRA 1VQO1 4DGLA 2JA5I 3CXCY 1P9NA 1QVFZ 2DE5A 2LIYA 2Y0SA 3CCUZ 2E2II 1YJ91 1R9TI 1ML8A 1VQ41 3CCQ1 3I551 2F4MA 3CCMZ 1YIJZ 1M1K1 1N8R2 4A3LI 2JNYA 3GTQI 2R7ZI 3FKII 1VQN1 3KIHA 3BG1B 3EERA 3GTOI 3I4MI 1PFTA 3CD61 3CCE1 1YITZ 3S1NI 4NBFA 4AYBA 1VQ8Z 2OZKA 2JUBA 2QEX1 1USPA 3KIFA 3HKZA 2NVQI 3GTKI 1TWHI 3G6EZ 4A3KI 1VQPZ 1X0TA 1NUIA 2P28A 2AKLA 3IF8A 1YJNZ 2DE6A 1VQM1 1YJWZ 2QREB 1VQ5Z 1QF8A 1KC81 1N8R1 1W2BY 3CPWZ 3HOUI 2KPIA 1VQOZ 1Y1VI 1KD12 4A3JI 1K8A2 3J81f 1VQ4Z 3H3VJ 4A3II 3CCQZ 2W03A 3I55Z 4RVGA 1Q811 5LL6f 3MZLB 3GTPI 1RQFA 2LFUA 2BJOA 3VB9A 3CCM1 4A3DI 2HF1A 1X3WA 2GU2A 3H0GI 2YU9I 3S1QI 4CL1A 1QYPA 4HGYA 4NBDA 3CD6Z 1I50I 2M6NA 2EGTA 4NH1C 1KQSZ 3MZKB 2JA7I 3JAMf 2QEXZ 1M1K2 3CMA1 2Q4ZA 4NBGA 4DQYB 4HGZA 5IP9I 4A3FI 4E2ZA 2J6AA 3J80f 1VQMZ 5FLXf 2JMOA 1TFIA 1JJ2Y 2G2KA 2WAQA 1YJN1 3OW2Z 4Y7NI 3CC41 3S17I 3TDHB 3K7AI 3GTMS 1YJW1 1RO2A 4NBAA 3M3YI 1WW9A 1TWGI 1WIIA 1N2FA 2O4HA 4E2WA 3S1RI 4MONA 3CC71 4RVDA 1K731 4BY7I 1I3QI 2K3RA 1TWCI 3CCV1 2GTHA 3CCL1 1KC82 5AN9F 4A93I 1Z02A 2K5RA 3MONA 1VQK1 3P5JB 2NVXI 3NH8A 1RO4A 5C4JI 2E2JI 4E31A 2GTIA 3LUSA 1Q7Y1 4NBHA 1K83I 1WCMI 1Q812 2WB1A 4RVHA 4TNUA 3CCJ1 3G71Z 3CMAZ 2B63I 4MD8A 3I4NI 3PO3S 3HOWI 5C44I 2QRDB 3S15I 4NBCA 3CC4Z 3J81b 5D1OB 2ZAEB 3S1MI 4MH4A 1VLAA 2NVTI 3I561 1YI21 3FQQA 3T4NB 5IT9f 3CC7Z 3VMIA 4QTTA 1Y1WI 3CCRZ 4S1TA 2OOYB 3TE5B 2JS4A 3CCVZ 5C3EI 3F3PC 2P3YA 3CCLZ 2OOXB 1S7MA 4A3BI 3GTJI 1VQKZ 4BXXI 4A3MI 1RLYA 3ESWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 1;  1QVG Y;  1NJI 1;  3CCQ 1;  1JJ2 Y;  3I55 1;  3CCM Z;  1YJN 1;  3OW2 Z;  3CC4 1;  1YIJ Z;  1M1K 1;  1S72 1;  1YJW 1;  1N8R 2;  1M90 2;  1K73 2;  1VQL 1;  3CCJ Z;  1VQN 1;  1Q82 2;  3CCS 1;  1VQ7 Z;  3CME Z;  3G71 1;  3CD6 1;  3CCE 1;  3CC7 1;  1KQS Y;  1YIT Z;  2QA4 1;  1M90 1;  1K73 1;  1VQ8 Z;  1VQ6 1;  1Q82 1;  3CC2 Z;  3CCV 1;  1Q7Y 2;  1QVF Y;  1YHQ Z;  2QEX 1;  1YJ9 Z;  3CCL 1;  1KC8 2;  2OTL Z;  3G6E Z;  1VQK 1;  3I56 Z;  1YI2 Z;  1VQP Z;  3CCU 1;  1K9M 2;  1W2B Z;  1YJN Z;  1VQM 1;  1YJW Z;  3OW2 Y;  1Q7Y 1;  1VQ5 Z;  1VQL Z;  1KC8 1;  1VQN Z;  1YIJ 1;  1N8R 1;  3CCR 1;  3CCS Z;  3CPW Z;  1W2B Y;  1VQO Z;  1KD1 2;  1Q81 2;  1K9M 1;  3CCJ 1;  3G71 Z;  3CMA Z;  1K8A 2;  3CCE Z;  1VQ9 1;  2OTJ Z;  1VQ7 1;  1VQ4 Z;  3G4S 1;  1YIT 1;  3CCQ Z;  3I55 Z;  1KD1 1;  1Q81 1;  1QVG Z;  3CC4 Z;  1JJ2 Z;  1S72 Z;  1K8A 1;  1VQ8 1;  1YHQ 1;  3CCM 1;  3G6E 1;  1YI2 1;  1VQP 1;  3I56 1;  1Q86 2;  3CD6 Z;  3CC7 Z;  3CCR Z;  3CXC Z;  1VQ5 1;  2QA4 Z;  1KQS Z;  3CPW Y;  3CME 1;  1VQ6 Z;  3CCV Z;  1NJI 2;  1VQ9 Z;  1Q86 1;  2QEX Z;  1VQO 1;  3CCL Z;  3CXC Y;  1QVF Z;  1M1K 2;  3CMA 1;  1VQK Z;  3G4S Z;  3CC2 1;  3CCU Z;  2OTJ 1;  1YJ9 1;  2OTL 1;  1VQM Z; 
#chains in the Genus database with same CATH topology
 5T6B A;  3JAM b;  1QVG Y;  5IP7 I;  1NJI 1;  5D1P A;  1FDO A;  3IFU A;  3GTL I;  4E32 A;  3VMG A;  4XX2 A;  3J80 b;  1K73 2;  2VF1 A;  3NH4 A;  3CCJ Z;  5FLX b;  2NVY I;  2I3C A;  4DK1 A;  3G71 1;  2YAD A;  4A3G I;  3VMH A;  1M90 1;  3HOX I;  2E2H I;  1Q82 1;  3CC2 Z;  1VQ6 1;  1Q7Y 2;  1QVF Y;  3S16 I;  4Y52 I;  2VPY A;  2OTL Z;  3D6W A;  1KRL A;  1LQL A;  2VPW A;  3I56 Z;  1YI2 Z;  5C4X I;  2DE7 A;  4NB9 A;  3GTG I;  3S2D I;  3PO2 I;  2JA6 I;  1AA6 A;  3GCF A;  4NOZ A;  1VQL Z;  2PM9 A;  3CCR 1;  3CCS Z;  4NB8 A;  1Y1V S;  2VUM I;  1K9M 1;  1DL6 A;  4E2X A;  1JWH C;  5A2Q f;  3BG0 B;  4NBB A;  2NAP A;  3RZD I;  2O53 A;  1VQ7 1;  2Q51 A;  2RPR A;  1Y8C A;  2IZ3 A;  4A3C I;  3U50 C;  2R6M A;  1NP6 A;  1Z03 A;  1JJ2 Z;  1RNI A;  3CQZ I;  1YHQ 1;  3HOY I;  5T64 A;  2RIQ A;  4QTU A;  1RO0 A;  1Z01 A;  2R92 I;  3RZO I;  2VUG A;  5FLM I;  3CXC Z;  3D9X A;  3EED A;  2E9H A;  2RT9 A;  3CPW Y;  1ZB8 A;  3I07 A;  3F3F C;  4MRI A;  1VQ6 Z;  4MD9 A;  1NJI 2;  1VQ9 Z;  1I6H I;  1Q86 1;  5D1O A;  1YUA A;  5IT9 b;  3G4S Z;  3CC2 1;  2OTJ 1;  4BBS I;  4BBR I;  2OTL 1;  3NFZ A;  4RVF A;  2QRC B;  2RBL A;  4E30 A;  1S72 1;  3GTM I;  2JA8 I;  4E2Y A;  1USP B;  1M90 2;  1TWA I;  1VQL 1;  3IR7 A;  3Q87 A;  1Q82 2;  3CCS 1;  1SFO I;  3S14 I;  2RHB A;  1VQ7 Z;  2V45 A;  4HH4 A;  3CME Z;  3FQM A;  3NH5 A;  1KQS Y;  2QA4 1;  4RS4 A;  2V8K A;  4MD7 A;  2HU9 A;  1YHQ Z;  1YJ9 Z;  2V8I A;  2H85 A;  1ZB9 A;  3CCU 1;  3HOV I;  4RV9 A;  5CM2 M;  1K9M 2;  1W2B Z;  3NDI A;  1TWF I;  2R93 I;  2QLV B;  3OW2 Y;  2QKD A;  3S2H I;  4EWC A;  3GKQ A;  1VQN Z;  3J7A 4;  1YIJ 1;  2JR6 A;  4MXU A;  2PMZ A;  2QR1 B;  1X3Z A;  3CCE Z;  2PK7 A;  1VQ9 1;  2W04 A;  3QWU A;  2OTJ Z;  2V8J A;  4E33 A;  3PO3 I;  4BY1 I;  2M48 A;  5T67 A;  3G4S 1;  4A3E I;  1YIT 1;  1KD1 1;  2IZ4 A;  1QVG Z;  4NBE A;  2F4O A;  1S72 Z;  1K8A 1;  1VQ8 1;  5A2Q b;  4X6A I;  3IX0 A;  3G6E 1;  1VQP 1;  1Q86 2;  3NDJ A;  1YUK A;  1L1O C;  1ZH1 A;  3VTN A;  3M4O I;  2KI7 B;  1VQ5 1;  2QA4 Z;  2AYD A;  3HOZ I;  3CME 1;  4NFR A;  1VQO 1;  4DGL A;  2JA5 I;  3CXC Y;  1P9N A;  2E7Z A;  1QVF Z;  2DE5 A;  2LIY A;  2Y0S A;  3CCU Z;  2E2I I;  1YJ9 1;  1R9T I;  1ML8 A;  1VQ4 1;  3CCQ 1;  3I55 1;  2F4M A;  3CCM Z;  1YIJ Z;  1M1K 1;  1N8R 2;  4A3L I;  2JNY A;  3GTQ I;  2R7Z I;  3FKI I;  1VQN 1;  3KIH A;  3BG1 B;  2JIM A;  3EER A;  3GTO I;  3I4M I;  1PFT A;  3CD6 1;  3CCE 1;  1YIT Z;  3S1N I;  2V3V A;  4NBF A;  4AYB A;  1VQ8 Z;  2OZK A;  2JUB A;  2QEX 1;  1USP A;  3KIF A;  3HKZ A;  2NVQ I;  3GTK I;  1TWH I;  3G6E Z;  4A3K I;  1VQP Z;  1X0T A;  1NUI A;  2P28 A;  2AKL A;  3IF8 A;  1YJN Z;  1WJ2 A;  2DE6 A;  2IV2 X;  1VQM 1;  1YJW Z;  2QRE B;  1VQ5 Z;  1QF8 A;  1KC8 1;  1N8R 1;  1W2B Y;  3CPW Z;  3HOU I;  2KPI A;  1VQO Z;  1Y1V I;  1KD1 2;  4A3J I;  2LEX A;  1K8A 2;  3J81 f;  1VQ4 Z;  3H3V J;  4A3I I;  3CCQ Z;  2W03 A;  3I55 Z;  4RVG A;  1Q81 1;  5LL6 f;  3MZL B;  3GTP I;  1RQF A;  2LFU A;  2BJO A;  3VB9 A;  3CCM 1;  4A3D I;  2HF1 A;  1X3W A;  2GU2 A;  3H0G I;  2YU9 I;  3S1Q I;  4CL1 A;  1QYP A;  4HGY A;  4NBD A;  3CD6 Z;  1I50 I;  2M6N A;  2EGT A;  4NH1 C;  1KQS Z;  3MZK B;  2JA7 I;  3JAM f;  2QEX Z;  1M1K 2;  3CMA 1;  2Q4Z A;  4NBG A;  4DQY B;  4HGZ A;  5IP9 I;  1WZN A;  4E2Z A;  2J6A A;  4A3F I;  3J80 f;  1VQM Z;  5FLX f;  2JMO A;  1TFI A;  1JJ2 Y;  2G2K A;  2WAQ A;  1YJN 1;  3OW2 Z;  4Y7N I;  3CC4 1;  3S17 I;  3TDH B;  3K7A I;  3GTM S;  1YJW 1;  1RO2 A;  4NBA A;  3M3Y I;  1WW9 A;  1TWG I;  1WII A;  1N2F A;  2O4H A;  4E2W A;  3S1R I;  4MON A;  3CC7 1;  1QXF A;  4RVD A;  1K73 1;  2JIQ A;  4BY7 I;  1I3Q I;  2K3R A;  1TWC I;  3CCV 1;  2GTH A;  3CCL 1;  1KC8 2;  5AN9 F;  4A93 I;  1Z02 A;  2K5R A;  3MON A;  1VQK 1;  3P5J B;  2NVX I;  3NH8 A;  1RO4 A;  5C4J I;  2E2J I;  4E31 A;  2GTI A;  3LUS A;  1Q7Y 1;  4NBH A;  2JIO A;  1Q16 A;  2VPZ A;  1K83 I;  1WCM I;  1Q81 2;  2WB1 A;  4RVH A;  4TNU A;  3CCJ 1;  3G71 Z;  3CMA Z;  2B63 I;  1SIW A;  4MD8 A;  2JIP A;  3I4N I;  3PO3 S;  3HOW I;  5C44 I;  2QRD B;  3S15 I;  4NBC A;  3CC4 Z;  2JIR A;  3J81 b;  5D1O B;  3D2L A;  2ZAE B;  3S1M I;  4MH4 A;  1VLA A;  2NVT I;  3I56 1;  1YI2 1;  3FQQ A;  3T4N B;  1FDI A;  5IT9 f;  3CC7 Z;  3VMI A;  4QTT A;  1Y1W I;  3CCR Z;  4S1T A;  2OOY B;  3TE5 B;  2JS4 A;  3CCV Z;  5C3E I;  3F3P C;  2P3Y A;  3CCL Z;  2OOX B;  1S7M A;  4A3B I;  2VPX A;  3GTJ I;  1VQK Z;  4BXX I;  4A3M I;  1RLY A;  3ESW A; 
#chains in the Genus database with same CATH homology
 5T6B A;  3JAM b;  1QVG Y;  5IP7 I;  1NJI 1;  5D1P A;  3IFU A;  3GTL I;  4E32 A;  3VMG A;  4XX2 A;  3J80 b;  1K73 2;  2VF1 A;  3NH4 A;  3CCJ Z;  5FLX b;  2NVY I;  2I3C A;  4DK1 A;  3G71 1;  2YAD A;  4A3G I;  3VMH A;  1M90 1;  3HOX I;  2E2H I;  1Q82 1;  3CC2 Z;  1VQ6 1;  1Q7Y 2;  1QVF Y;  3S16 I;  4Y52 I;  2OTL Z;  3D6W A;  1KRL A;  1LQL A;  3I56 Z;  1YI2 Z;  5C4X I;  2DE7 A;  4NB9 A;  3GTG I;  3S2D I;  3PO2 I;  2JA6 I;  3GCF A;  4NOZ A;  1VQL Z;  2PM9 A;  3CCR 1;  3CCS Z;  4NB8 A;  1Y1V S;  2VUM I;  1K9M 1;  1DL6 A;  4E2X A;  1JWH C;  5A2Q f;  3BG0 B;  4NBB A;  1VQ7 1;  3RZD I;  2O53 A;  2Q51 A;  2RPR A;  2IZ3 A;  4A3C I;  3U50 C;  2R6M A;  1NP6 A;  1Z03 A;  1JJ2 Z;  1RNI A;  3CQZ I;  1YHQ 1;  3HOY I;  5T64 A;  2RIQ A;  4QTU A;  1RO0 A;  1Z01 A;  2R92 I;  3RZO I;  2VUG A;  5FLM I;  3CXC Z;  3D9X A;  3EED A;  2E9H A;  2RT9 A;  3CPW Y;  1ZB8 A;  3I07 A;  3F3F C;  4MRI A;  1VQ6 Z;  4MD9 A;  1NJI 2;  1VQ9 Z;  1I6H I;  1Q86 1;  5D1O A;  1YUA A;  5IT9 b;  3G4S Z;  3CC2 1;  2OTJ 1;  4BBS I;  4BBR I;  2OTL 1;  3NFZ A;  4RVF A;  2QRC B;  2RBL A;  4E30 A;  1S72 1;  3GTM I;  2JA8 I;  4E2Y A;  1USP B;  1M90 2;  1TWA I;  1VQL 1;  3Q87 A;  1Q82 2;  3CCS 1;  1SFO I;  3S14 I;  2RHB A;  1VQ7 Z;  4HH4 A;  3CME Z;  3FQM A;  3NH5 A;  1KQS Y;  2QA4 1;  4RS4 A;  2V8K A;  4MD7 A;  2HU9 A;  1YHQ Z;  1YJ9 Z;  2V8I A;  2H85 A;  1ZB9 A;  3CCU 1;  3HOV I;  4RV9 A;  5CM2 M;  1K9M 2;  1W2B Z;  3NDI A;  1TWF I;  2R93 I;  2QLV B;  3OW2 Y;  2QKD A;  3S2H I;  4EWC A;  3GKQ A;  1VQN Z;  3J7A 4;  1YIJ 1;  2JR6 A;  4MXU A;  2PMZ A;  2QR1 B;  1X3Z A;  3CCE Z;  2PK7 A;  1VQ9 1;  2W04 A;  3QWU A;  2OTJ Z;  2V8J A;  4E33 A;  3PO3 I;  4BY1 I;  2M48 A;  5T67 A;  3G4S 1;  4A3E I;  1YIT 1;  1KD1 1;  2IZ4 A;  1QVG Z;  4NBE A;  2F4O A;  1S72 Z;  1K8A 1;  1VQ8 1;  5A2Q b;  4X6A I;  3IX0 A;  3G6E 1;  1VQP 1;  1Q86 2;  3NDJ A;  1YUK A;  1L1O C;  1ZH1 A;  3VTN A;  3M4O I;  2KI7 B;  1VQ5 1;  2QA4 Z;  3HOZ I;  3CME 1;  4NFR A;  1VQO 1;  4DGL A;  2JA5 I;  3CXC Y;  1P9N A;  1QVF Z;  2DE5 A;  2LIY A;  2Y0S A;  3CCU Z;  2E2I I;  1YJ9 1;  1R9T I;  1ML8 A;  1VQ4 1;  3CCQ 1;  3I55 1;  2F4M A;  3CCM Z;  1YIJ Z;  1M1K 1;  1N8R 2;  4A3L I;  2JNY A;  3GTQ I;  2R7Z I;  3FKI I;  1VQN 1;  3KIH A;  3BG1 B;  3EER A;  3GTO I;  3I4M I;  1PFT A;  3CD6 1;  3CCE 1;  1YIT Z;  3S1N I;  4NBF A;  4AYB A;  1VQ8 Z;  2OZK A;  2JUB A;  2QEX 1;  1USP A;  3KIF A;  3HKZ A;  2NVQ I;  3GTK I;  1TWH I;  3G6E Z;  4A3K I;  1VQP Z;  1X0T A;  1NUI A;  2P28 A;  2AKL A;  3IF8 A;  1YJN Z;  2DE6 A;  1VQM 1;  1YJW Z;  2QRE B;  1VQ5 Z;  1QF8 A;  1KC8 1;  1N8R 1;  1W2B Y;  3CPW Z;  3HOU I;  2KPI A;  1VQO Z;  1Y1V I;  1KD1 2;  4A3J I;  1K8A 2;  3J81 f;  1VQ4 Z;  3H3V J;  4A3I I;  3CCQ Z;  2W03 A;  3I55 Z;  4RVG A;  1Q81 1;  5LL6 f;  3MZL B;  3GTP I;  1RQF A;  2LFU A;  2BJO A;  3VB9 A;  3CCM 1;  4A3D I;  2HF1 A;  1X3W A;  2GU2 A;  3H0G I;  2YU9 I;  3S1Q I;  4CL1 A;  1QYP A;  4HGY A;  4NBD A;  3CD6 Z;  1I50 I;  2M6N A;  2EGT A;  4NH1 C;  1KQS Z;  3MZK B;  2JA7 I;  3JAM f;  2QEX Z;  1M1K 2;  3CMA 1;  2Q4Z A;  4NBG A;  4DQY B;  4HGZ A;  5IP9 I;  4A3F I;  4E2Z A;  2J6A A;  3J80 f;  1VQM Z;  5FLX f;  2JMO A;  1TFI A;  1JJ2 Y;  2G2K A;  2WAQ A;  1YJN 1;  3OW2 Z;  4Y7N I;  3CC4 1;  3S17 I;  3TDH B;  3K7A I;  3GTM S;  1YJW 1;  1RO2 A;  4NBA A;  3M3Y I;  1WW9 A;  1TWG I;  1WII A;  1N2F A;  2O4H A;  4E2W A;  3S1R I;  4MON A;  3CC7 1;  4RVD A;  1K73 1;  4BY7 I;  1I3Q I;  2K3R A;  1TWC I;  3CCV 1;  2GTH A;  3CCL 1;  1KC8 2;  5AN9 F;  4A93 I;  1Z02 A;  2K5R A;  3MON A;  1VQK 1;  3P5J B;  2NVX I;  3NH8 A;  1RO4 A;  5C4J I;  2E2J I;  4E31 A;  2GTI A;  3LUS A;  1Q7Y 1;  4NBH A;  1K83 I;  1WCM I;  1Q81 2;  2WB1 A;  4RVH A;  4TNU A;  3CCJ 1;  3G71 Z;  3CMA Z;  2B63 I;  4MD8 A;  3I4N I;  3PO3 S;  3HOW I;  5C44 I;  2QRD B;  3S15 I;  4NBC A;  3CC4 Z;  3J81 b;  5D1O B;  2ZAE B;  3S1M I;  4MH4 A;  1VLA A;  2NVT I;  3I56 1;  1YI2 1;  3FQQ A;  3T4N B;  5IT9 f;  3CC7 Z;  3VMI A;  4QTT A;  1Y1W I;  3CCR Z;  4S1T A;  2OOY B;  3TE5 B;  2JS4 A;  3CCV Z;  5C3E I;  3F3P C;  2P3Y A;  3CCL Z;  2OOX B;  1S7M A;  4A3B I;  3GTJ I;  1VQK Z;  4BXX I;  4A3M I;  1RLY A;  3ESW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...