2RT9A

Solution structure of a regulatory domain of meiosis inhibitor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
TDEALKPCPRCQSPAKYQPHKKRGLCSRLACGFDFCVLCLCAYHGSEDCRRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords F-box only protein 43
publication title The zinc-binding region (ZBR) fragment of Emi2 can inhibit APC/C by targeting its association with the coactivator Cdc20 and UBE2C-mediated ubiquitylation
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rt9A00
4DGLA 2RT9A 4MD8A 3EEDA 2JMOA 2M48A 1JWHC 1QF8A 2M6NA 4MD7A 2R6MA 4NH1C 4MD9A 1RQFA
chains in the Genus database with same CATH superfamily
4DK1A 4NBBA 2OTL1 2GTIA 4HGYA 1TWAI 2HU9A 1KC82 3S1MI 3CCSZ 3VTNA 1K83I 3NH4A 2G2KA 3HOXI 1VQOZ 3VMHA 1NP6A 3HOZI 2VPZA 3GKQA 2WAQA 2F4MA 3S2DI 4MD9A 2QA41 3CCM1 4BY1I 2QKDA 3CCU1 1VQKZ 2LFUA 1N8R1 1VQ5Z 1KRLA 1PFTA 3VB9A 1YI21 1KQSY 3HOYI 1NJI2 2O53A 3G711 1Q861 4A3CI 2E2II 1YITZ 2V3VA 2IZ4A 3CCL1 1VQ6Z 5T64A 1RO0A 1JWHC 1YJWZ 3D6WA 3CCE1 3OW2Y 5C3EI 2R93I 2RPRA 1QVGZ 2JIPA 1I6HI 4A93I 2J6AA 2YADA 1KD12 2NVYI 4RVFA 4HGZA 3CCLZ 1YJ9Z 4A3DI 2Y0SA 4E2YA 3MZLB 1M902 2E2HI 2JA5I 2H85A 4QTTA 5T6BA 1K9M2 3RZDI 5C4JI 2E9HA 1TWHI 1WJ2A 4A3II 4BY7I 3QWUA 2F4OA 3GTMI 1VQL1 3CME1 2JS4A 4XX2A 3S1NI 2JIMA 4NB9A 1VQP1 2KPIA 3J81b 4E2ZA 4NBFA 1LQLA 2QLVB 3D9XA 3CMEZ 1TWGI 2PMZA 1Q821 4RVHA 2NAPA 1M1K1 3M3YI 1SIWA 1QVFY 2VF1A 3J80b 3J7A4 4NBHA 3Q87A 3CC71 1TFIA 1S721 3I561 3D2LA 5IT9b 4E32A 4RV9A 2V45A 1ML8A 2BJOA 1VQ71 1YUKA 3CXCY 3P5JB 3CC7Z 3J80f 3HOVI 3CMAZ 3CC4Z 3FQMA 3CC21 1I50I 1RO2A 2GU2A 2OTJ1 1Y1WI 1DL6A 3NFZA 2JIQA 3TDHB 1ZH1A 1WW9A 4HH4A 1YJNZ 3F3FC 3KIHA 2DE7A 2QEX1 2QREB 1YUAA 1VQ8Z 5FLXf 1Z01A 4BBRI 2OTLZ 1VLAA 3CD61 2JA6I 2RBLA 3VMIA 3CCQ1 4NOZA 4E2XA 3KIFA 1N8R2 1RQFA 3G4S1 1VQN1 2QA4Z 3CCMZ 3CCQZ 1YIJ1 2RT9A 3CCUZ 1Y1VI 1Q862 1K8A2 1VQ91 1QVGY 2M48A 3PO3I 2M6NA 1YI2Z 3FKII 3G71Z 1VQNZ 2VUGA 5C44I 3IR7A 1Z03A 3H0GI 1Q812 1NJI1 3HKZA 1QXFA 1I3QI 3CCR1 3S1RI 2JA7I 5D1PA 3CCEZ 3T4NB 4Y52I 2JR6A 3GTMS 1FDIA 3I4MI 1W2BZ 3S1QI 2DE6A 3S16I 3CCRZ 2RIQA 3K7AI 2V8KA 3M4OI 2JNYA 3GTLI 1Q7Y2 1RO4A 1KD11 3U50C 4AYBA 2JMOA 5T67A 5C4XI 3GTPI 2O4HA 2VPXA 4E31A 5A2Qb 2IZ3A 1ZB9A 3CPWZ 1M901 3GTOI 3NH8A 4A3MI 1TWFI 3I07A 1YHQ1 2NVXI 1VQLZ 3S14I 1TWCI 1Q822 1RLYA 1K731 2V8IA 3GTKI 1VQPZ 3G6E1 3I4NI 1M1K2 5A2Qf 4NBAA 2B63I 2PK7A 2K3RA 2W03A 3EEDA 4Y7NI 2JA8I 3HOUI 1RNIA 2AYDA 3GTQI 3GTGI 2R6MA 1S72Z 3I56Z 3S17I 4NFRA 2VPWA 3RZOI 1VQ7Z 1X0TA 1USPB 4QTUA 1VQ41 2EGTA 3NDIA 5FLXb 4BBSI 4NBEA 5D1OA 2JIRA 1QYPA 3CC2Z 3CCV1 1VQM1 2R92I 1JJ2Z 2WB1A 1WZNA 2OTJZ 3I551 4MD7A 2VUMI 2I3CA 3F3PC 3S2HI 4A3GI 1WIIA 3I55Z 3CCS1 4NBDA 3GTJI 2NVQI 2QEXZ 1Y1VS 1P9NA 1VQO1 3PO3S 4NBGA 1L1OC 2JIOA 4A3EI 3BG1B 3CD6Z 1KC81 4A3KI 2LIYA 4X6AI 1X3WA 4EWCA 2VPYA 3JAMb 4RVGA 4RS4A 3HOWI 4NB8A 1VQK1 2JUBA 1VQ51 2PM9A 3IX0A 3G4SZ 4MXUA 4E2WA 4MH4A 1YIJZ 1FDOA 5D1OB 1VQ9Z 2V8JA 4A3JI 1YIT1 2HF1A 3CCJ1 1SFOI 3JAMf 1AA6A 1W2BY 3ESWA 2Q4ZA 1VQ61 4TNUA 1YJW1 2K5RA 1K8A1 3NDJA 2QR1B 3LUSA 3CCJZ 3MZKB 2E2JI 3S15I 1KQSZ 4E30A 4A3LI 1YJ91 1Y8CA 4NBCA 3CPWY 3IF8A 5IP7I 1QF8A 1Q811 1NUIA 2W04A 4E33A 2E7ZA 2QRCB 4A3BI 1USPA 5LL6f 3OW2Z 4RVDA 2P28A 2AKLA 1K9M1 3FQQA 1Q7Y1 1K732 2RHBA 1Z02A 3GCFA 1YHQZ 2OZKA 2ZAEB 4MD8A 2KI7B 3G6EZ 3IFUA 2DE5A 4A3FI 3NH5A 3BG0B 3VMGA 1WCMI 3PO2I 3H3VJ 1S7MA 4DGLA 2NVTI 3EERA 1R9TI 1N2FA 4NH1C 1JJ2Y 3J81f 3MONA 5AN9F 3CMA1 3CC41 2OOYB 4S1TA 1X3ZA 2YU9I 4MRIA 1QVFZ 2OOXB 5FLMI 1VQ4Z 4BXXI 1ZB8A 2QRDB 2P3YA 4CL1A 5CM2M 3CCVZ 1VQMZ 3CQZI 5IT9f 4MONA 2Q51A 5IP9I 3CXCZ 2R7ZI 1YJN1 1Q16A 2GTHA 2LEXA 1VQ81 3TE5B 4DQYB 2IV2X
chains in the Genus database with same CATH topology
4DK1A 4NBBA 2OTL1 2GTIA 4HGYA 1TWAI 2HU9A 1KC82 3S1MI 3CCSZ 3VTNA 1K83I 3NH4A 2G2KA 3HOXI 1VQOZ 3VMHA 1NP6A 3HOZI 3GKQA 2WAQA 2F4MA 3S2DI 4MD9A 2QA41 3CCM1 4BY1I 2QKDA 3CCU1 1VQKZ 2LFUA 1N8R1 1VQ5Z 1KRLA 1PFTA 3VB9A 1YI21 1KQSY 3HOYI 1NJI2 2O53A 3G711 1Q861 4A3CI 2E2II 1YITZ 2IZ4A 3CCL1 1VQ6Z 5T64A 1RO0A 1JWHC 1YJWZ 3D6WA 3CCE1 3OW2Y 5C3EI 2R93I 2RPRA 1QVGZ 1I6HI 4A93I 2J6AA 2YADA 1KD12 2NVYI 4RVFA 4HGZA 3CCLZ 1YJ9Z 4A3DI 2Y0SA 4E2YA 3MZLB 1M902 2E2HI 2JA5I 2H85A 4QTTA 5T6BA 1K9M2 3RZDI 5C4JI 2E9HA 1TWHI 4A3II 4BY7I 3QWUA 2F4OA 3GTMI 1VQL1 3CME1 2JS4A 4XX2A 3S1NI 4NB9A 1VQP1 2KPIA 3J81b 4E2ZA 4NBFA 1LQLA 2QLVB 3D9XA 3CMEZ 1TWGI 2PMZA 1Q821 4RVHA 1M1K1 3M3YI 1QVFY 2VF1A 3J80b 3J7A4 4NBHA 3Q87A 3CC71 1TFIA 1S721 3I561 5IT9b 4E32A 4RV9A 1ML8A 2BJOA 1VQ71 1YUKA 3CXCY 3P5JB 3CC7Z 3J80f 3HOVI 3CMAZ 3CC4Z 3FQMA 3CC21 1I50I 1RO2A 2GU2A 2OTJ1 1Y1WI 1DL6A 3NFZA 3TDHB 1ZH1A 1WW9A 4HH4A 1YJNZ 3F3FC 3KIHA 2DE7A 2QEX1 2QREB 1YUAA 1VQ8Z 5FLXf 1Z01A 4BBRI 2OTLZ 1VLAA 3CD61 2JA6I 2RBLA 3VMIA 3CCQ1 4NOZA 4E2XA 3KIFA 1N8R2 1RQFA 3G4S1 1VQN1 2QA4Z 3CCMZ 3CCQZ 1YIJ1 2RT9A 3CCUZ 1Y1VI 1Q862 1K8A2 1VQ91 1QVGY 2M48A 3PO3I 2M6NA 1YI2Z 3FKII 3G71Z 1VQNZ 2VUGA 5C44I 1Z03A 3H0GI 1Q812 1NJI1 3HKZA 1I3QI 3CCR1 3S1RI 2JA7I 5D1PA 3CCEZ 3T4NB 4Y52I 2JR6A 3GTMS 3I4MI 1W2BZ 3S1QI 2DE6A 3S16I 3CCRZ 2RIQA 3K7AI 2V8KA 3M4OI 2JNYA 3GTLI 1Q7Y2 1RO4A 1KD11 3U50C 4AYBA 2JMOA 5T67A 5C4XI 3GTPI 2O4HA 4E31A 5A2Qb 2IZ3A 1ZB9A 3CPWZ 1M901 3GTOI 3NH8A 4A3MI 1TWFI 3I07A 1YHQ1 2NVXI 1VQLZ 3S14I 1TWCI 1Q822 1RLYA 1K731 2V8IA 3GTKI 1VQPZ 3G6E1 3I4NI 1M1K2 5A2Qf 4NBAA 2B63I 2PK7A 2K3RA 2W03A 3EEDA 4Y7NI 2JA8I 3HOUI 1RNIA 3GTQI 3GTGI 2R6MA 1S72Z 3I56Z 3S17I 4NFRA 3RZOI 1VQ7Z 1X0TA 1USPB 4QTUA 1VQ41 2EGTA 3NDIA 5FLXb 4BBSI 4NBEA 5D1OA 1QYPA 3CC2Z 3CCV1 1VQM1 2R92I 1JJ2Z 2WB1A 2OTJZ 3I551 4MD7A 2VUMI 2I3CA 3F3PC 3S2HI 4A3GI 1WIIA 3I55Z 3CCS1 4NBDA 3GTJI 2NVQI 2QEXZ 1Y1VS 1P9NA 1VQO1 3PO3S 4NBGA 1L1OC 4A3EI 3BG1B 3CD6Z 1KC81 4A3KI 2LIYA 4X6AI 1X3WA 4EWCA 3JAMb 4RVGA 4RS4A 3HOWI 4NB8A 1VQK1 2JUBA 1VQ51 2PM9A 3IX0A 3G4SZ 4MXUA 4E2WA 4MH4A 1YIJZ 5D1OB 1VQ9Z 4A3JI 2V8JA 1YIT1 2HF1A 3CCJ1 1SFOI 3JAMf 1W2BY 3ESWA 2Q4ZA 1VQ61 4TNUA 1YJW1 2K5RA 1K8A1 3NDJA 2QR1B 3LUSA 3CCJZ 3MZKB 2E2JI 3S15I 1KQSZ 4E30A 4A3LI 1YJ91 3CPWY 4NBCA 3IF8A 5IP7I 1QF8A 1Q811 1NUIA 2W04A 4E33A 2QRCB 4A3BI 1USPA 5LL6f 3OW2Z 4RVDA 2P28A 2AKLA 1K9M1 3FQQA 1Q7Y1 1K732 2RHBA 1Z02A 3GCFA 1YHQZ 2OZKA 2ZAEB 4MD8A 2KI7B 3G6EZ 3IFUA 2DE5A 4A3FI 3NH5A 3BG0B 3VMGA 1WCMI 3PO2I 3H3VJ 1S7MA 4DGLA 2NVTI 3EERA 1R9TI 1N2FA 4NH1C 1JJ2Y 3J81f 3MONA 5AN9F 3CMA1 3CC41 2OOYB 4S1TA 1X3ZA 2YU9I 4MRIA 1QVFZ 2OOXB 5FLMI 1VQ4Z 4BXXI 1ZB8A 2QRDB 2P3YA 4CL1A 5CM2M 3CCVZ 1VQMZ 3CQZI 5IT9f 4MONA 2Q51A 5IP9I 3CXCZ 2R7ZI 1YJN1 2GTHA 1VQ81 3TE5B 4DQYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGL A;  2RT9 A;  4MD8 A;  3EED A;  2JMO A;  2M48 A;  1JWH C;  1QF8 A;  2M6N A;  4MD7 A;  2R6M A;  4NH1 C;  4MD9 A;  1RQF A; 
#chains in the Genus database with same CATH topology
 4DK1 A;  4NBB A;  2OTL 1;  2GTI A;  4HGY A;  1TWA I;  2HU9 A;  1KC8 2;  3S1M I;  3CCS Z;  3VTN A;  1K83 I;  3NH4 A;  2G2K A;  3HOX I;  1VQO Z;  3VMH A;  1NP6 A;  3HOZ I;  2VPZ A;  3GKQ A;  2WAQ A;  2F4M A;  3S2D I;  4MD9 A;  2QA4 1;  3CCM 1;  4BY1 I;  2QKD A;  3CCU 1;  1VQK Z;  2LFU A;  1N8R 1;  1VQ5 Z;  1KRL A;  1PFT A;  3VB9 A;  1YI2 1;  1KQS Y;  3HOY I;  1NJI 2;  2O53 A;  3G71 1;  1Q86 1;  4A3C I;  2E2I I;  1YIT Z;  2V3V A;  2IZ4 A;  3CCL 1;  1VQ6 Z;  5T64 A;  1RO0 A;  1JWH C;  1YJW Z;  3D6W A;  3CCE 1;  3OW2 Y;  5C3E I;  2R93 I;  2RPR A;  1QVG Z;  2JIP A;  1I6H I;  4A93 I;  2J6A A;  2YAD A;  1KD1 2;  2NVY I;  4RVF A;  4HGZ A;  3CCL Z;  1YJ9 Z;  4A3D I;  2Y0S A;  4E2Y A;  3MZL B;  1M90 2;  2E2H I;  2JA5 I;  2H85 A;  4QTT A;  5T6B A;  1K9M 2;  3RZD I;  5C4J I;  2E9H A;  1TWH I;  1WJ2 A;  4A3I I;  4BY7 I;  3QWU A;  2F4O A;  3GTM I;  1VQL 1;  3CME 1;  2JS4 A;  4XX2 A;  3S1N I;  2JIM A;  4NB9 A;  1VQP 1;  2KPI A;  3J81 b;  4E2Z A;  4NBF A;  1LQL A;  2QLV B;  3D9X A;  3CME Z;  1TWG I;  2PMZ A;  1Q82 1;  4RVH A;  2NAP A;  1M1K 1;  3M3Y I;  1SIW A;  1QVF Y;  2VF1 A;  3J80 b;  3J7A 4;  4NBH A;  3Q87 A;  3CC7 1;  1TFI A;  1S72 1;  3I56 1;  3D2L A;  5IT9 b;  4E32 A;  4RV9 A;  2V45 A;  1ML8 A;  2BJO A;  1VQ7 1;  1YUK A;  3CXC Y;  3P5J B;  3CC7 Z;  3J80 f;  3HOV I;  3CMA Z;  3CC4 Z;  3FQM A;  3CC2 1;  1I50 I;  1RO2 A;  2GU2 A;  2OTJ 1;  1Y1W I;  1DL6 A;  3NFZ A;  2JIQ A;  3TDH B;  1ZH1 A;  1WW9 A;  4HH4 A;  1YJN Z;  3F3F C;  3KIH A;  2DE7 A;  2QEX 1;  2QRE B;  1YUA A;  1VQ8 Z;  5FLX f;  1Z01 A;  4BBR I;  2OTL Z;  1VLA A;  3CD6 1;  2JA6 I;  2RBL A;  3VMI A;  3CCQ 1;  4NOZ A;  4E2X A;  3KIF A;  1N8R 2;  1RQF A;  3G4S 1;  1VQN 1;  2QA4 Z;  3CCM Z;  3CCQ Z;  1YIJ 1;  2RT9 A;  3CCU Z;  1Y1V I;  1Q86 2;  1K8A 2;  1VQ9 1;  1QVG Y;  2M48 A;  3PO3 I;  2M6N A;  1YI2 Z;  3FKI I;  3G71 Z;  1VQN Z;  2VUG A;  5C44 I;  3IR7 A;  1Z03 A;  3H0G I;  1Q81 2;  1NJI 1;  3HKZ A;  1QXF A;  1I3Q I;  3CCR 1;  3S1R I;  2JA7 I;  5D1P A;  3CCE Z;  3T4N B;  4Y52 I;  2JR6 A;  3GTM S;  1FDI A;  3I4M I;  1W2B Z;  3S1Q I;  2DE6 A;  3S16 I;  3CCR Z;  2RIQ A;  3K7A I;  2V8K A;  3M4O I;  2JNY A;  3GTL I;  1Q7Y 2;  1RO4 A;  1KD1 1;  3U50 C;  4AYB A;  2JMO A;  5T67 A;  5C4X I;  3GTP I;  2O4H A;  2VPX A;  4E31 A;  5A2Q b;  2IZ3 A;  1ZB9 A;  3CPW Z;  1M90 1;  3GTO I;  3NH8 A;  4A3M I;  1TWF I;  3I07 A;  1YHQ 1;  2NVX I;  1VQL Z;  3S14 I;  1TWC I;  1Q82 2;  1RLY A;  1K73 1;  2V8I A;  3GTK I;  1VQP Z;  3G6E 1;  3I4N I;  1M1K 2;  5A2Q f;  4NBA A;  2B63 I;  2PK7 A;  2K3R A;  2W03 A;  3EED A;  4Y7N I;  2JA8 I;  3HOU I;  1RNI A;  2AYD A;  3GTQ I;  3GTG I;  2R6M A;  1S72 Z;  3I56 Z;  3S17 I;  4NFR A;  2VPW A;  3RZO I;  1VQ7 Z;  1X0T A;  1USP B;  4QTU A;  1VQ4 1;  2EGT A;  3NDI A;  5FLX b;  4BBS I;  4NBE A;  5D1O A;  2JIR A;  1QYP A;  3CC2 Z;  3CCV 1;  1VQM 1;  2R92 I;  1JJ2 Z;  2WB1 A;  1WZN A;  2OTJ Z;  3I55 1;  4MD7 A;  2VUM I;  2I3C A;  3F3P C;  3S2H I;  4A3G I;  1WII A;  3I55 Z;  3CCS 1;  4NBD A;  3GTJ I;  2NVQ I;  2QEX Z;  1Y1V S;  1P9N A;  1VQO 1;  3PO3 S;  4NBG A;  1L1O C;  2JIO A;  4A3E I;  3BG1 B;  3CD6 Z;  1KC8 1;  4A3K I;  2LIY A;  4X6A I;  1X3W A;  4EWC A;  2VPY A;  3JAM b;  4RVG A;  4RS4 A;  3HOW I;  4NB8 A;  1VQK 1;  2JUB A;  1VQ5 1;  2PM9 A;  3IX0 A;  3G4S Z;  4MXU A;  4E2W A;  4MH4 A;  1YIJ Z;  1FDO A;  5D1O B;  1VQ9 Z;  2V8J A;  4A3J I;  1YIT 1;  2HF1 A;  3CCJ 1;  1SFO I;  3JAM f;  1AA6 A;  1W2B Y;  3ESW A;  2Q4Z A;  1VQ6 1;  4TNU A;  1YJW 1;  2K5R A;  1K8A 1;  3NDJ A;  2QR1 B;  3LUS A;  3CCJ Z;  3MZK B;  2E2J I;  3S15 I;  1KQS Z;  4E30 A;  4A3L I;  1YJ9 1;  1Y8C A;  4NBC A;  3CPW Y;  3IF8 A;  5IP7 I;  1QF8 A;  1Q81 1;  1NUI A;  2W04 A;  4E33 A;  2E7Z A;  2QRC B;  4A3B I;  1USP A;  5LL6 f;  3OW2 Z;  4RVD A;  2P28 A;  2AKL A;  1K9M 1;  3FQQ A;  1Q7Y 1;  1K73 2;  2RHB A;  1Z02 A;  3GCF A;  1YHQ Z;  2OZK A;  2ZAE B;  4MD8 A;  2KI7 B;  3G6E Z;  3IFU A;  2DE5 A;  4A3F I;  3NH5 A;  3BG0 B;  3VMG A;  1WCM I;  3PO2 I;  3H3V J;  1S7M A;  4DGL A;  2NVT I;  3EER A;  1R9T I;  1N2F A;  4NH1 C;  1JJ2 Y;  3J81 f;  3MON A;  5AN9 F;  3CMA 1;  3CC4 1;  2OOY B;  4S1T A;  1X3Z A;  2YU9 I;  4MRI A;  1QVF Z;  2OOX B;  5FLM I;  1VQ4 Z;  4BXX I;  1ZB8 A;  2QRD B;  2P3Y A;  4CL1 A;  5CM2 M;  3CCV Z;  1VQM Z;  3CQZ I;  5IT9 f;  4MON A;  2Q51 A;  5IP9 I;  3CXC Z;  2R7Z I;  1YJN 1;  1Q16 A;  2GTH A;  2LEX A;  1VQ8 1;  3TE5 B;  4DQY B;  2IV2 X; 
#chains in the Genus database with same CATH homology
 4DK1 A;  4NBB A;  2OTL 1;  2GTI A;  4HGY A;  1TWA I;  2HU9 A;  1KC8 2;  3S1M I;  3CCS Z;  3VTN A;  1K83 I;  3NH4 A;  2G2K A;  3HOX I;  1VQO Z;  3VMH A;  1NP6 A;  3HOZ I;  3GKQ A;  2WAQ A;  2F4M A;  3S2D I;  4MD9 A;  2QA4 1;  3CCM 1;  4BY1 I;  2QKD A;  3CCU 1;  1VQK Z;  2LFU A;  1N8R 1;  1VQ5 Z;  1KRL A;  1PFT A;  3VB9 A;  1YI2 1;  1KQS Y;  3HOY I;  1NJI 2;  2O53 A;  3G71 1;  1Q86 1;  4A3C I;  2E2I I;  1YIT Z;  2IZ4 A;  3CCL 1;  1VQ6 Z;  5T64 A;  1RO0 A;  1JWH C;  1YJW Z;  3D6W A;  3CCE 1;  3OW2 Y;  5C3E I;  2R93 I;  2RPR A;  1QVG Z;  1I6H I;  4A93 I;  2J6A A;  2YAD A;  1KD1 2;  2NVY I;  4RVF A;  4HGZ A;  3CCL Z;  1YJ9 Z;  4A3D I;  2Y0S A;  4E2Y A;  3MZL B;  1M90 2;  2E2H I;  2JA5 I;  2H85 A;  4QTT A;  5T6B A;  1K9M 2;  3RZD I;  5C4J I;  2E9H A;  1TWH I;  4A3I I;  4BY7 I;  3QWU A;  2F4O A;  3GTM I;  1VQL 1;  3CME 1;  2JS4 A;  4XX2 A;  3S1N I;  4NB9 A;  1VQP 1;  2KPI A;  3J81 b;  4E2Z A;  4NBF A;  1LQL A;  2QLV B;  3D9X A;  3CME Z;  1TWG I;  2PMZ A;  1Q82 1;  4RVH A;  1M1K 1;  3M3Y I;  1QVF Y;  2VF1 A;  3J80 b;  3J7A 4;  4NBH A;  3Q87 A;  3CC7 1;  1TFI A;  1S72 1;  3I56 1;  5IT9 b;  4E32 A;  4RV9 A;  1ML8 A;  2BJO A;  1VQ7 1;  1YUK A;  3CXC Y;  3P5J B;  3CC7 Z;  3J80 f;  3HOV I;  3CMA Z;  3CC4 Z;  3FQM A;  3CC2 1;  1I50 I;  1RO2 A;  2GU2 A;  2OTJ 1;  1Y1W I;  1DL6 A;  3NFZ A;  3TDH B;  1ZH1 A;  1WW9 A;  4HH4 A;  1YJN Z;  3F3F C;  3KIH A;  2DE7 A;  2QEX 1;  2QRE B;  1YUA A;  1VQ8 Z;  5FLX f;  1Z01 A;  4BBR I;  2OTL Z;  1VLA A;  3CD6 1;  2JA6 I;  2RBL A;  3VMI A;  3CCQ 1;  4NOZ A;  4E2X A;  3KIF A;  1N8R 2;  1RQF A;  3G4S 1;  1VQN 1;  2QA4 Z;  3CCM Z;  3CCQ Z;  1YIJ 1;  2RT9 A;  3CCU Z;  1Y1V I;  1Q86 2;  1K8A 2;  1VQ9 1;  1QVG Y;  2M48 A;  3PO3 I;  2M6N A;  1YI2 Z;  3FKI I;  3G71 Z;  1VQN Z;  2VUG A;  5C44 I;  1Z03 A;  3H0G I;  1Q81 2;  1NJI 1;  3HKZ A;  1I3Q I;  3CCR 1;  3S1R I;  2JA7 I;  5D1P A;  3CCE Z;  3T4N B;  4Y52 I;  2JR6 A;  3GTM S;  3I4M I;  1W2B Z;  3S1Q I;  2DE6 A;  3S16 I;  3CCR Z;  2RIQ A;  3K7A I;  2V8K A;  3M4O I;  2JNY A;  3GTL I;  1Q7Y 2;  1RO4 A;  1KD1 1;  3U50 C;  4AYB A;  2JMO A;  5T67 A;  5C4X I;  3GTP I;  2O4H A;  4E31 A;  5A2Q b;  2IZ3 A;  1ZB9 A;  3CPW Z;  1M90 1;  3GTO I;  3NH8 A;  4A3M I;  1TWF I;  3I07 A;  1YHQ 1;  2NVX I;  1VQL Z;  3S14 I;  1TWC I;  1Q82 2;  1RLY A;  1K73 1;  2V8I A;  3GTK I;  1VQP Z;  3G6E 1;  3I4N I;  1M1K 2;  5A2Q f;  4NBA A;  2B63 I;  2PK7 A;  2K3R A;  2W03 A;  3EED A;  4Y7N I;  2JA8 I;  3HOU I;  1RNI A;  3GTQ I;  3GTG I;  2R6M A;  1S72 Z;  3I56 Z;  3S17 I;  4NFR A;  3RZO I;  1VQ7 Z;  1X0T A;  1USP B;  4QTU A;  1VQ4 1;  2EGT A;  3NDI A;  5FLX b;  4BBS I;  4NBE A;  5D1O A;  1QYP A;  3CC2 Z;  3CCV 1;  1VQM 1;  2R92 I;  1JJ2 Z;  2WB1 A;  2OTJ Z;  3I55 1;  4MD7 A;  2VUM I;  2I3C A;  3F3P C;  3S2H I;  4A3G I;  1WII A;  3I55 Z;  3CCS 1;  4NBD A;  3GTJ I;  2NVQ I;  2QEX Z;  1Y1V S;  1P9N A;  1VQO 1;  3PO3 S;  4NBG A;  1L1O C;  4A3E I;  3BG1 B;  3CD6 Z;  1KC8 1;  4A3K I;  2LIY A;  4X6A I;  1X3W A;  4EWC A;  3JAM b;  4RVG A;  4RS4 A;  3HOW I;  4NB8 A;  1VQK 1;  2JUB A;  1VQ5 1;  2PM9 A;  3IX0 A;  3G4S Z;  4MXU A;  4E2W A;  4MH4 A;  1YIJ Z;  5D1O B;  1VQ9 Z;  4A3J I;  2V8J A;  1YIT 1;  2HF1 A;  3CCJ 1;  1SFO I;  3JAM f;  1W2B Y;  3ESW A;  2Q4Z A;  1VQ6 1;  4TNU A;  1YJW 1;  2K5R A;  1K8A 1;  3NDJ A;  2QR1 B;  3LUS A;  3CCJ Z;  3MZK B;  2E2J I;  3S15 I;  1KQS Z;  4E30 A;  4A3L I;  1YJ9 1;  3CPW Y;  4NBC A;  3IF8 A;  5IP7 I;  1QF8 A;  1Q81 1;  1NUI A;  2W04 A;  4E33 A;  2QRC B;  4A3B I;  1USP A;  5LL6 f;  3OW2 Z;  4RVD A;  2P28 A;  2AKL A;  1K9M 1;  3FQQ A;  1Q7Y 1;  1K73 2;  2RHB A;  1Z02 A;  3GCF A;  1YHQ Z;  2OZK A;  2ZAE B;  4MD8 A;  2KI7 B;  3G6E Z;  3IFU A;  2DE5 A;  4A3F I;  3NH5 A;  3BG0 B;  3VMG A;  1WCM I;  3PO2 I;  3H3V J;  1S7M A;  4DGL A;  2NVT I;  3EER A;  1R9T I;  1N2F A;  4NH1 C;  1JJ2 Y;  3J81 f;  3MON A;  5AN9 F;  3CMA 1;  3CC4 1;  2OOY B;  4S1T A;  1X3Z A;  2YU9 I;  4MRI A;  1QVF Z;  2OOX B;  5FLM I;  1VQ4 Z;  4BXX I;  1ZB8 A;  2QRD B;  2P3Y A;  4CL1 A;  5CM2 M;  3CCV Z;  1VQM Z;  3CQZ I;  5IT9 f;  4MON A;  2Q51 A;  5IP9 I;  3CXC Z;  2R7Z I;  1YJN 1;  2GTH A;  1VQ8 1;  3TE5 B;  4DQY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...