2RT9A

Solution structure of a regulatory domain of meiosis inhibitor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
TDEALKPCPRCQSPAKYQPHKKRGLCSRLACGFDFCVLCLCAYHGSEDCRRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F-box only protein 43
publication title The zinc-binding region (ZBR) fragment of Emi2 can inhibit APC/C by targeting its association with the coactivator Cdc20 and UBE2C-mediated ubiquitylation
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rt9A00
4DGLA 2RT9A 2M6NA 3EEDA 4MD7A 4MD9A 1QF8A 2M48A 1RQFA 1JWHC 2R6MA 4MD8A 4NH1C 2JMOA
chains in the Genus database with same CATH superfamily
1WZNA 2DE7A 1WIIA 1K731 1W2BZ 3NDJA 3K7AI 2JA5I 3GTJI 1YJW1 3CC41 5FLXf 1VQKZ 4NBBA 3JAMb 4E31A 1S721 3NFZA 1Z01A 2QREB 2JIPA 2JMOA 2ZAEB 5D1PA 4Y7NI 3CMAZ 3CQZI 3HOYI 3GKQA 3CCSZ 1Q7Y1 1TWAI 3F3PC 1X3WA 1K83I 2VPXA 2O4HA 2HF1A 1N8R2 1VQ41 4BY7I 1TWGI 4A3LI 3CCEZ 2PMZA 1Y1VS 1QVFY 3T4NB 1VQP1 2Q4ZA 1VQ5Z 2KPIA 4E32A 2RT9A 4QTUA 1I3QI 4BBSI 1VQ6Z 2JA6I 2JIQA 3CCM1 1WJ2A 2O53A 1SFOI 3GTLI 1YUAA 3VB9A 1Y1VI 2NVYI 2NVQI 2E2HI 3IF8A 3G4SZ 4NBDA 5IT9f 2VPWA 3TE5B 3CCJZ 3HOUI 2LFUA 2W03A 3PO3I 4RVHA 2OTJZ 3OW2Z 2E2II 2OOYB 1N8R1 5C4XI 2PM9A 4NBFA 3CCV1 2DE5A 4DGLA 1YI21 3FKII 1KQSZ 3U50C 4AYBA 3CC71 1K8A2 1Q812 4A93I 2F4OA 1QVGY 4RVDA 3CCU1 3H0GI 1VQOZ 2QR1B 3H3VJ 1VQN1 3CCL1 1Y8CA 2R92I 1Q822 2R6MA 4A3EI 2B63I 3S2DI 2V45A 4QTTA 2IV2X 3I4MI 2V8JA 1FDIA 4A3BI 1VLAA 3JAMf 1P9NA 1Q862 5A2Qb 1VQM1 4A3DI 3CC2Z 2M6NA 1QYPA 1TWCI 1K8A1 1KC82 1X0TA 2Q51A 1RO2A 3OW2Y 3G711 1K9M2 4DK1A 4BBRI 2EGTA 1VQ7Z 3ESWA 3P5JB 4NB8A 4XX2A 2I3CA 1WW9A 3F3FC 1YHQZ 2YADA 3HOZI 5C4JI 1KRLA 1Y1WI 1YJ91 1RLYA 2NAPA 1YIJZ 2JIMA 3I551 1NJI2 2QA41 1VQ9Z 3S1QI 4MH4A 4NOZA 1Q861 2W04A 2VPYA 1TWFI 3D9XA 3S1RI 1YJNZ 3G6EZ 1DL6A 2VUGA 1KC81 2GTHA 3FQMA 5LL6f 1ZB9A 3CMEZ 1Z02A 3BG1B 1RO4A 3PO3S 2V8IA 5T64A 3CPWY 3J80b 2GTIA 1NP6A 1RQFA 1JWHC 3CCQZ 1W2BY 4E2XA 1LQLA 5FLMI 2VPZA 1TWHI 1YITZ 3D2LA 3IFUA 3GTMS 1L1OC 4MD8A 3QWUA 4E2YA 2V3VA 3EEDA 2NVTI 3MZLB 2QEX1 1YJWZ 2OTL1 3CC4Z 3CD61 3CCR1 4NBGA 1S72Z 5D1OA 1JJ2Z 3GTMI 4E2ZA 2JA8I 1RO0A 1USPB 4HH4A 4MD9A 5A2Qf 2JIRA 4EWCA 1VQK1 4A3GI 3NH8A 4BXXI 4S1TA 3NDIA 4HGYA 1VQ4Z 4TNUA 3S15I 4NBAA 4NBCA 2YU9I 3CMA1 1KD12 4A3FI 1YUKA 2OOXB 3CCS1 5IP7I 4RVFA 1VQPZ 2VF1A 4A3JI 2RBLA 1X3ZA 4RV9A 3CCMZ 3CCE1 1USPA 2QRDB 2RHBA 1VQL1 2LEXA 1ZB8A 1WCMI 3VMGA 4HGZA 1Q811 2JA7I 2JUBA 3S16I 4NBHA 3IX0A 2AKLA 2KI7B 1QVFZ 1TFIA 2JNYA 4NH1C 1VQ61 2V8KA 3HOXI 3KIFA 3S17I 3NH5A 1Q821 2E7ZA 1KQSY 2QEXZ 3RZDI 4A3MI 3TDHB 5AN9F 3G4S1 3CCVZ 3CCJ1 3Q87A 1YI2Z 3CC7Z 2OTJ1 3J80f 2JS4A 3IR7A 3I561 1I6HI 1NUIA 3CCUZ 2R7ZI 3J81b 2F4MA 3J7A4 2HU9A 5IP9I 1VQNZ 2J6AA 2QKDA 3CCLZ 3GTKI 3I4NI 2R93I 2JR6A 5T6BA 3FQQA 1VQ81 3MONA 1K9M1 3GTQI 4BY1I 3GTPI 1VQO1 1M902 1QXFA 3VMHA 1SIWA 2NVXI 2LIYA 2M48A 5D1OB 3S2HI 2GU2A 1QVGZ 2QRCB 4DQYB 2AYDA 5C3EI 2IZ4A 1VQMZ 5FLXb 1VQLZ 4A3KI 1I50I 1QF8A 3NH4A 3G71Z 1NJI1 2WAQA 3MZKB 2K3RA 4RVGA 3HOVI 3CC21 3S1NI 4E30A 1M1K2 2P3YA 3KIHA 4NB9A 1PFTA 1R9TI 2RPRA 4A3CI 1YJ9Z 1M901 2DE6A 2P28A 3CXCZ 4E33A 1VQ71 3GTGI 4RS4A 4MONA 2QLVB 3I56Z 3I55Z 3EERA 2QA4Z 2BJOA 1YHQ1 1N2FA 1Z03A 2OZKA 4X6AI 1FDOA 2RIQA 1ML8A 3HKZA 2G2KA 3HOWI 1YIJ1 2WB1A 4NBEA 1VQ8Z 2IZ3A 4MXUA 1S7MA 5IT9b 2Y0SA 3VTNA 1VQ91 3S1MI 4CL1A 1K732 4Y52I 4MD7A 1Q16A 2K5RA 1YJN1 3G6E1 3S14I 3M4OI 1M1K1 1RNIA 3PO2I 3LUSA 4MRIA 3GCFA 3CME1 3BG0B 1VQ51 3I07A 1AA6A 5T67A 4NFRA 3RZOI 2E2JI 4A3II 5CM2M 3J81f 2E9HA 1Q7Y2 3CCQ1 4E2WA 3GTOI 1JJ2Y 2PK7A 3CPWZ 3M3YI 2JIOA 2VUMI 1KD11 2OTLZ 3CXCY 2H85A 3VMIA 1YIT1 5C44I 3D6WA 3CD6Z 1ZH1A 3CCRZ
chains in the Genus database with same CATH topology
2DE7A 1WIIA 1K731 1W2BZ 3NDJA 3K7AI 2JA5I 3GTJI 1YJW1 3CC41 5FLXf 1VQKZ 4NBBA 3JAMb 4E31A 1S721 3NFZA 1Z01A 2QREB 2JMOA 2ZAEB 5D1PA 4Y7NI 3CMAZ 3CQZI 3HOYI 3GKQA 3CCSZ 1Q7Y1 1TWAI 3F3PC 1X3WA 1K83I 2O4HA 2HF1A 1N8R2 1VQ41 4BY7I 1TWGI 4A3LI 3CCEZ 2PMZA 1Y1VS 1QVFY 3T4NB 1VQP1 2Q4ZA 1VQ5Z 2KPIA 4E32A 2RT9A 4QTUA 1I3QI 4BBSI 1VQ6Z 2JA6I 3CCM1 2O53A 1SFOI 3GTLI 1YUAA 3VB9A 1Y1VI 2NVYI 2NVQI 2E2HI 3IF8A 3G4SZ 4NBDA 5IT9f 3TE5B 3CCJZ 3HOUI 2LFUA 2W03A 3PO3I 4RVHA 2OTJZ 3OW2Z 2E2II 2OOYB 1N8R1 5C4XI 2PM9A 4NBFA 3CCV1 2DE5A 4DGLA 1YI21 3FKII 1KQSZ 3U50C 4AYBA 3CC71 1K8A2 1Q812 4A93I 2F4OA 1QVGY 4RVDA 3CCU1 3H0GI 1VQOZ 2QR1B 3H3VJ 1VQN1 3CCL1 2R92I 1Q822 2R6MA 4A3EI 2B63I 3S2DI 4QTTA 3I4MI 2V8JA 4A3BI 1VLAA 3JAMf 1P9NA 1Q862 5A2Qb 1VQM1 4A3DI 3CC2Z 2M6NA 1QYPA 1TWCI 1K8A1 1KC82 1X0TA 2Q51A 1RO2A 3OW2Y 3G711 1K9M2 4DK1A 4BBRI 2EGTA 1VQ7Z 3ESWA 3P5JB 4NB8A 4XX2A 2I3CA 1WW9A 3F3FC 1YHQZ 2YADA 3HOZI 5C4JI 1KRLA 1Y1WI 1YJ91 1RLYA 1YIJZ 3I551 1NJI2 2QA41 1VQ9Z 3S1QI 4MH4A 4NOZA 1Q861 2W04A 1TWFI 3D9XA 3S1RI 1YJNZ 3G6EZ 1DL6A 2VUGA 1KC81 2GTHA 3FQMA 5LL6f 1ZB9A 3CMEZ 1Z02A 3BG1B 1RO4A 3PO3S 2V8IA 5T64A 3CPWY 3J80b 2GTIA 1NP6A 1RQFA 1JWHC 3CCQZ 1W2BY 4E2XA 1LQLA 5FLMI 1TWHI 1YITZ 3IFUA 3GTMS 1L1OC 4MD8A 3QWUA 4E2YA 3EEDA 2NVTI 3MZLB 2QEX1 1YJWZ 2OTL1 3CC4Z 3CD61 3CCR1 4NBGA 1S72Z 5D1OA 1JJ2Z 3GTMI 4E2ZA 2JA8I 1RO0A 1USPB 4HH4A 4MD9A 5A2Qf 4EWCA 1VQK1 4A3GI 3NH8A 4BXXI 4S1TA 3NDIA 4HGYA 1VQ4Z 4TNUA 3S15I 4NBAA 4NBCA 2YU9I 3CMA1 1KD12 4A3FI 1YUKA 2OOXB 3CCS1 5IP7I 4RVFA 1VQPZ 2VF1A 4A3JI 2RBLA 1X3ZA 4RV9A 3CCMZ 3CCE1 1USPA 2QRDB 2RHBA 1VQL1 1ZB8A 1WCMI 3VMGA 4HGZA 1Q811 2JA7I 2JUBA 3S16I 4NBHA 3IX0A 2AKLA 2KI7B 1QVFZ 1TFIA 2JNYA 4NH1C 1VQ61 2V8KA 3HOXI 3KIFA 3S17I 3NH5A 1Q821 1KQSY 2QEXZ 3RZDI 4A3MI 3TDHB 5AN9F 3G4S1 3CCVZ 3CCJ1 3Q87A 1YI2Z 3CC7Z 2OTJ1 3J80f 2JS4A 3I561 1I6HI 1NUIA 3CCUZ 2R7ZI 3J81b 2F4MA 3J7A4 2HU9A 5IP9I 1VQNZ 2J6AA 2QKDA 3CCLZ 3GTKI 3I4NI 2R93I 2JR6A 5T6BA 3FQQA 1VQ81 3MONA 1K9M1 3GTQI 4BY1I 3GTPI 1VQO1 1M902 3VMHA 2NVXI 2LIYA 2M48A 5D1OB 3S2HI 2GU2A 1QVGZ 2QRCB 4DQYB 5C3EI 2IZ4A 1VQMZ 5FLXb 1VQLZ 4A3KI 1I50I 1QF8A 3NH4A 3G71Z 1NJI1 2WAQA 3MZKB 2K3RA 4RVGA 3HOVI 3CC21 3S1NI 4E30A 1M1K2 2P3YA 3KIHA 4NB9A 1PFTA 1R9TI 2RPRA 4A3CI 1YJ9Z 1M901 2DE6A 2P28A 3CXCZ 4E33A 1VQ71 3GTGI 4RS4A 4MONA 2QLVB 3I56Z 3I55Z 3EERA 2QA4Z 2BJOA 1YHQ1 1Z03A 1N2FA 2OZKA 4X6AI 2RIQA 1ML8A 3HKZA 2G2KA 3HOWI 1YIJ1 1VQ8Z 2WB1A 4NBEA 2IZ3A 4MXUA 1S7MA 5IT9b 2Y0SA 3VTNA 1VQ91 3S1MI 4CL1A 1K732 4Y52I 4MD7A 2K5RA 1YJN1 3G6E1 3S14I 3M4OI 1M1K1 1RNIA 3PO2I 3LUSA 4MRIA 3GCFA 3CME1 3BG0B 1VQ51 3I07A 5T67A 4NFRA 3RZOI 2E2JI 4A3II 5CM2M 3J81f 2E9HA 1Q7Y2 3CCQ1 4E2WA 3GTOI 1JJ2Y 2PK7A 3CPWZ 3M3YI 2VUMI 1KD11 2OTLZ 3CXCY 2H85A 3VMIA 1YIT1 5C44I 3D6WA 3CD6Z 1ZH1A 3CCRZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGL A;  2RT9 A;  2M6N A;  3EED A;  4MD7 A;  4MD9 A;  1QF8 A;  2M48 A;  1RQF A;  1JWH C;  2R6M A;  4MD8 A;  4NH1 C;  2JMO A; 
#chains in the Genus database with same CATH topology
 1WZN A;  2DE7 A;  1WII A;  1K73 1;  1W2B Z;  3NDJ A;  3K7A I;  2JA5 I;  3GTJ I;  1YJW 1;  3CC4 1;  5FLX f;  1VQK Z;  4NBB A;  3JAM b;  4E31 A;  1S72 1;  3NFZ A;  1Z01 A;  2QRE B;  2JIP A;  2JMO A;  2ZAE B;  5D1P A;  4Y7N I;  3CMA Z;  3CQZ I;  3HOY I;  3GKQ A;  3CCS Z;  1Q7Y 1;  1TWA I;  3F3P C;  1X3W A;  1K83 I;  2VPX A;  2O4H A;  2HF1 A;  1N8R 2;  1VQ4 1;  4BY7 I;  1TWG I;  4A3L I;  3CCE Z;  2PMZ A;  1Y1V S;  1QVF Y;  3T4N B;  1VQP 1;  2Q4Z A;  1VQ5 Z;  2KPI A;  4E32 A;  2RT9 A;  4QTU A;  1I3Q I;  4BBS I;  1VQ6 Z;  2JA6 I;  2JIQ A;  3CCM 1;  1WJ2 A;  2O53 A;  1SFO I;  3GTL I;  1YUA A;  3VB9 A;  1Y1V I;  2NVY I;  2NVQ I;  2E2H I;  3IF8 A;  3G4S Z;  4NBD A;  5IT9 f;  2VPW A;  3TE5 B;  3CCJ Z;  3HOU I;  2LFU A;  2W03 A;  3PO3 I;  4RVH A;  2OTJ Z;  3OW2 Z;  2E2I I;  2OOY B;  1N8R 1;  5C4X I;  2PM9 A;  4NBF A;  3CCV 1;  2DE5 A;  4DGL A;  1YI2 1;  3FKI I;  1KQS Z;  3U50 C;  4AYB A;  3CC7 1;  1K8A 2;  1Q81 2;  4A93 I;  2F4O A;  1QVG Y;  4RVD A;  3CCU 1;  3H0G I;  1VQO Z;  2QR1 B;  3H3V J;  1VQN 1;  3CCL 1;  1Y8C A;  2R92 I;  1Q82 2;  2R6M A;  4A3E I;  2B63 I;  3S2D I;  2V45 A;  4QTT A;  2IV2 X;  3I4M I;  2V8J A;  1FDI A;  4A3B I;  1VLA A;  3JAM f;  1P9N A;  1Q86 2;  5A2Q b;  1VQM 1;  4A3D I;  3CC2 Z;  2M6N A;  1QYP A;  1TWC I;  1K8A 1;  1KC8 2;  1X0T A;  2Q51 A;  1RO2 A;  3OW2 Y;  3G71 1;  1K9M 2;  4DK1 A;  4BBR I;  2EGT A;  1VQ7 Z;  3ESW A;  3P5J B;  4NB8 A;  4XX2 A;  2I3C A;  1WW9 A;  3F3F C;  1YHQ Z;  2YAD A;  3HOZ I;  5C4J I;  1KRL A;  1Y1W I;  1YJ9 1;  1RLY A;  2NAP A;  1YIJ Z;  2JIM A;  3I55 1;  1NJI 2;  2QA4 1;  1VQ9 Z;  3S1Q I;  4MH4 A;  4NOZ A;  1Q86 1;  2W04 A;  2VPY A;  1TWF I;  3D9X A;  3S1R I;  1YJN Z;  3G6E Z;  1DL6 A;  2VUG A;  1KC8 1;  2GTH A;  3FQM A;  5LL6 f;  1ZB9 A;  3CME Z;  1Z02 A;  3BG1 B;  1RO4 A;  3PO3 S;  2V8I A;  5T64 A;  3CPW Y;  3J80 b;  2GTI A;  1NP6 A;  1RQF A;  1JWH C;  3CCQ Z;  1W2B Y;  4E2X A;  1LQL A;  5FLM I;  2VPZ A;  1TWH I;  1YIT Z;  3D2L A;  3IFU A;  3GTM S;  1L1O C;  4MD8 A;  3QWU A;  4E2Y A;  2V3V A;  3EED A;  2NVT I;  3MZL B;  2QEX 1;  1YJW Z;  2OTL 1;  3CC4 Z;  3CD6 1;  3CCR 1;  4NBG A;  1S72 Z;  5D1O A;  1JJ2 Z;  3GTM I;  4E2Z A;  2JA8 I;  1RO0 A;  1USP B;  4HH4 A;  4MD9 A;  5A2Q f;  2JIR A;  4EWC A;  1VQK 1;  4A3G I;  3NH8 A;  4BXX I;  4S1T A;  3NDI A;  4HGY A;  1VQ4 Z;  4TNU A;  3S15 I;  4NBA A;  4NBC A;  2YU9 I;  3CMA 1;  1KD1 2;  4A3F I;  1YUK A;  2OOX B;  3CCS 1;  5IP7 I;  4RVF A;  1VQP Z;  2VF1 A;  4A3J I;  2RBL A;  1X3Z A;  4RV9 A;  3CCM Z;  3CCE 1;  1USP A;  2QRD B;  2RHB A;  1VQL 1;  2LEX A;  1ZB8 A;  1WCM I;  3VMG A;  4HGZ A;  1Q81 1;  2JA7 I;  2JUB A;  3S16 I;  4NBH A;  3IX0 A;  2AKL A;  2KI7 B;  1QVF Z;  1TFI A;  2JNY A;  4NH1 C;  1VQ6 1;  2V8K A;  3HOX I;  3KIF A;  3S17 I;  3NH5 A;  1Q82 1;  2E7Z A;  1KQS Y;  2QEX Z;  3RZD I;  4A3M I;  3TDH B;  5AN9 F;  3G4S 1;  3CCV Z;  3CCJ 1;  3Q87 A;  1YI2 Z;  3CC7 Z;  2OTJ 1;  3J80 f;  2JS4 A;  3IR7 A;  3I56 1;  1I6H I;  1NUI A;  3CCU Z;  2R7Z I;  3J81 b;  2F4M A;  3J7A 4;  2HU9 A;  5IP9 I;  1VQN Z;  2J6A A;  2QKD A;  3CCL Z;  3GTK I;  3I4N I;  2R93 I;  2JR6 A;  5T6B A;  3FQQ A;  1VQ8 1;  3MON A;  1K9M 1;  3GTQ I;  4BY1 I;  3GTP I;  1VQO 1;  1M90 2;  1QXF A;  3VMH A;  1SIW A;  2NVX I;  2LIY A;  2M48 A;  5D1O B;  3S2H I;  2GU2 A;  1QVG Z;  2QRC B;  4DQY B;  2AYD A;  5C3E I;  2IZ4 A;  1VQM Z;  5FLX b;  1VQL Z;  4A3K I;  1I50 I;  1QF8 A;  3NH4 A;  3G71 Z;  1NJI 1;  2WAQ A;  3MZK B;  2K3R A;  4RVG A;  3HOV I;  3CC2 1;  3S1N I;  4E30 A;  1M1K 2;  2P3Y A;  3KIH A;  4NB9 A;  1PFT A;  1R9T I;  2RPR A;  4A3C I;  1YJ9 Z;  1M90 1;  2DE6 A;  2P28 A;  3CXC Z;  4E33 A;  1VQ7 1;  3GTG I;  4RS4 A;  4MON A;  2QLV B;  3I56 Z;  3I55 Z;  3EER A;  2QA4 Z;  2BJO A;  1YHQ 1;  1N2F A;  1Z03 A;  2OZK A;  4X6A I;  1FDO A;  2RIQ A;  1ML8 A;  3HKZ A;  2G2K A;  3HOW I;  1YIJ 1;  2WB1 A;  4NBE A;  1VQ8 Z;  2IZ3 A;  4MXU A;  1S7M A;  5IT9 b;  2Y0S A;  3VTN A;  1VQ9 1;  3S1M I;  4CL1 A;  1K73 2;  4Y52 I;  4MD7 A;  1Q16 A;  2K5R A;  1YJN 1;  3G6E 1;  3S14 I;  3M4O I;  1M1K 1;  1RNI A;  3PO2 I;  3LUS A;  4MRI A;  3GCF A;  3CME 1;  3BG0 B;  1VQ5 1;  3I07 A;  1AA6 A;  5T67 A;  4NFR A;  3RZO I;  2E2J I;  4A3I I;  5CM2 M;  3J81 f;  2E9H A;  1Q7Y 2;  3CCQ 1;  4E2W A;  3GTO I;  1JJ2 Y;  2PK7 A;  3CPW Z;  3M3Y I;  2JIO A;  2VUM I;  1KD1 1;  2OTL Z;  3CXC Y;  2H85 A;  3VMI A;  1YIT 1;  5C44 I;  3D6W A;  3CD6 Z;  1ZH1 A;  3CCR Z; 
#chains in the Genus database with same CATH homology
 2DE7 A;  1WII A;  1K73 1;  1W2B Z;  3NDJ A;  3K7A I;  2JA5 I;  3GTJ I;  1YJW 1;  3CC4 1;  5FLX f;  1VQK Z;  4NBB A;  3JAM b;  4E31 A;  1S72 1;  3NFZ A;  1Z01 A;  2QRE B;  2JMO A;  2ZAE B;  5D1P A;  4Y7N I;  3CMA Z;  3CQZ I;  3HOY I;  3GKQ A;  3CCS Z;  1Q7Y 1;  1TWA I;  3F3P C;  1X3W A;  1K83 I;  2O4H A;  2HF1 A;  1N8R 2;  1VQ4 1;  4BY7 I;  1TWG I;  4A3L I;  3CCE Z;  2PMZ A;  1Y1V S;  1QVF Y;  3T4N B;  1VQP 1;  2Q4Z A;  1VQ5 Z;  2KPI A;  4E32 A;  2RT9 A;  4QTU A;  1I3Q I;  4BBS I;  1VQ6 Z;  2JA6 I;  3CCM 1;  2O53 A;  1SFO I;  3GTL I;  1YUA A;  3VB9 A;  1Y1V I;  2NVY I;  2NVQ I;  2E2H I;  3IF8 A;  3G4S Z;  4NBD A;  5IT9 f;  3TE5 B;  3CCJ Z;  3HOU I;  2LFU A;  2W03 A;  3PO3 I;  4RVH A;  2OTJ Z;  3OW2 Z;  2E2I I;  2OOY B;  1N8R 1;  5C4X I;  2PM9 A;  4NBF A;  3CCV 1;  2DE5 A;  4DGL A;  1YI2 1;  3FKI I;  1KQS Z;  3U50 C;  4AYB A;  3CC7 1;  1K8A 2;  1Q81 2;  4A93 I;  2F4O A;  1QVG Y;  4RVD A;  3CCU 1;  3H0G I;  1VQO Z;  2QR1 B;  3H3V J;  1VQN 1;  3CCL 1;  2R92 I;  1Q82 2;  2R6M A;  4A3E I;  2B63 I;  3S2D I;  4QTT A;  3I4M I;  2V8J A;  4A3B I;  1VLA A;  3JAM f;  1P9N A;  1Q86 2;  5A2Q b;  1VQM 1;  4A3D I;  3CC2 Z;  2M6N A;  1QYP A;  1TWC I;  1K8A 1;  1KC8 2;  1X0T A;  2Q51 A;  1RO2 A;  3OW2 Y;  3G71 1;  1K9M 2;  4DK1 A;  4BBR I;  2EGT A;  1VQ7 Z;  3ESW A;  3P5J B;  4NB8 A;  4XX2 A;  2I3C A;  1WW9 A;  3F3F C;  1YHQ Z;  2YAD A;  3HOZ I;  5C4J I;  1KRL A;  1Y1W I;  1YJ9 1;  1RLY A;  1YIJ Z;  3I55 1;  1NJI 2;  2QA4 1;  1VQ9 Z;  3S1Q I;  4MH4 A;  4NOZ A;  1Q86 1;  2W04 A;  1TWF I;  3D9X A;  3S1R I;  1YJN Z;  3G6E Z;  1DL6 A;  2VUG A;  1KC8 1;  2GTH A;  3FQM A;  5LL6 f;  1ZB9 A;  3CME Z;  1Z02 A;  3BG1 B;  1RO4 A;  3PO3 S;  2V8I A;  5T64 A;  3CPW Y;  3J80 b;  2GTI A;  1NP6 A;  1RQF A;  1JWH C;  3CCQ Z;  1W2B Y;  4E2X A;  1LQL A;  5FLM I;  1TWH I;  1YIT Z;  3IFU A;  3GTM S;  1L1O C;  4MD8 A;  3QWU A;  4E2Y A;  3EED A;  2NVT I;  3MZL B;  2QEX 1;  1YJW Z;  2OTL 1;  3CC4 Z;  3CD6 1;  3CCR 1;  4NBG A;  1S72 Z;  5D1O A;  1JJ2 Z;  3GTM I;  4E2Z A;  2JA8 I;  1RO0 A;  1USP B;  4HH4 A;  4MD9 A;  5A2Q f;  4EWC A;  1VQK 1;  4A3G I;  3NH8 A;  4BXX I;  4S1T A;  3NDI A;  4HGY A;  1VQ4 Z;  4TNU A;  3S15 I;  4NBA A;  4NBC A;  2YU9 I;  3CMA 1;  1KD1 2;  4A3F I;  1YUK A;  2OOX B;  3CCS 1;  5IP7 I;  4RVF A;  1VQP Z;  2VF1 A;  4A3J I;  2RBL A;  1X3Z A;  4RV9 A;  3CCM Z;  3CCE 1;  1USP A;  2QRD B;  2RHB A;  1VQL 1;  1ZB8 A;  1WCM I;  3VMG A;  4HGZ A;  1Q81 1;  2JA7 I;  2JUB A;  3S16 I;  4NBH A;  3IX0 A;  2AKL A;  2KI7 B;  1QVF Z;  1TFI A;  2JNY A;  4NH1 C;  1VQ6 1;  2V8K A;  3HOX I;  3KIF A;  3S17 I;  3NH5 A;  1Q82 1;  1KQS Y;  2QEX Z;  3RZD I;  4A3M I;  3TDH B;  5AN9 F;  3G4S 1;  3CCV Z;  3CCJ 1;  3Q87 A;  1YI2 Z;  3CC7 Z;  2OTJ 1;  3J80 f;  2JS4 A;  3I56 1;  1I6H I;  1NUI A;  3CCU Z;  2R7Z I;  3J81 b;  2F4M A;  3J7A 4;  2HU9 A;  5IP9 I;  1VQN Z;  2J6A A;  2QKD A;  3CCL Z;  3GTK I;  3I4N I;  2R93 I;  2JR6 A;  5T6B A;  3FQQ A;  1VQ8 1;  3MON A;  1K9M 1;  3GTQ I;  4BY1 I;  3GTP I;  1VQO 1;  1M90 2;  3VMH A;  2NVX I;  2LIY A;  2M48 A;  5D1O B;  3S2H I;  2GU2 A;  1QVG Z;  2QRC B;  4DQY B;  5C3E I;  2IZ4 A;  1VQM Z;  5FLX b;  1VQL Z;  4A3K I;  1I50 I;  1QF8 A;  3NH4 A;  3G71 Z;  1NJI 1;  2WAQ A;  3MZK B;  2K3R A;  4RVG A;  3HOV I;  3CC2 1;  3S1N I;  4E30 A;  1M1K 2;  2P3Y A;  3KIH A;  4NB9 A;  1PFT A;  1R9T I;  2RPR A;  4A3C I;  1YJ9 Z;  1M90 1;  2DE6 A;  2P28 A;  3CXC Z;  4E33 A;  1VQ7 1;  3GTG I;  4RS4 A;  4MON A;  2QLV B;  3I56 Z;  3I55 Z;  3EER A;  2QA4 Z;  2BJO A;  1YHQ 1;  1Z03 A;  1N2F A;  2OZK A;  4X6A I;  2RIQ A;  1ML8 A;  3HKZ A;  2G2K A;  3HOW I;  1YIJ 1;  1VQ8 Z;  2WB1 A;  4NBE A;  2IZ3 A;  4MXU A;  1S7M A;  5IT9 b;  2Y0S A;  3VTN A;  1VQ9 1;  3S1M I;  4CL1 A;  1K73 2;  4Y52 I;  4MD7 A;  2K5R A;  1YJN 1;  3G6E 1;  3S14 I;  3M4O I;  1M1K 1;  1RNI A;  3PO2 I;  3LUS A;  4MRI A;  3GCF A;  3CME 1;  3BG0 B;  1VQ5 1;  3I07 A;  5T67 A;  4NFR A;  3RZO I;  2E2J I;  4A3I I;  5CM2 M;  3J81 f;  2E9H A;  1Q7Y 2;  3CCQ 1;  4E2W A;  3GTO I;  1JJ2 Y;  2PK7 A;  3CPW Z;  3M3Y I;  2VUM I;  1KD1 1;  2OTL Z;  3CXC Y;  2H85 A;  3VMI A;  1YIT 1;  5C44 I;  3D6W A;  3CD6 Z;  1ZH1 A;  3CCR Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...