2RT9A

Solution structure of a regulatory domain of meiosis inhibitor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
b'TDEALKPCPRCQSPAKYQPHKKRGLCSRLACGFDFCVLCLCAYHGSEDCRRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F-box only protein 43
publication title The zinc-binding region (ZBR) fragment of Emi2 can inhibit APC/C by targeting its association with the coactivator Cdc20 and UBE2C-mediated ubiquitylation
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rt9A00
2JMOA 2RT9A 1QF8A 3EEDA 2M48A 1JWHC 4MD9A 4DGLA 4MD8A 4NH1C 1RQFA 2M6NA 2R6MA 4MD7A
chains in the Genus database with same CATH superfamily
4RVGA 1Q16A 1Q7Y1 4A3BI 1Y1VS 1S721 3HOYI 3I4MI 2PK7A 4MONA 1FDIA 1USPB 2OTJZ 3S17I 3I56Z 1QVGY 1VQ61 5D1PA 3GCFA 5FLXf 3CCLZ 4A93I 3IX0A 5C4XI 3CCEZ 1KD11 3K7AI 3CC7Z 4BBSI 1YI2Z 1YUKA 4QTUA 2K5RA 4RVDA 2JIRA 2QA4Z 1K732 2F4OA 3H0GI 2Y0SA 2E2II 3GTLI 1X3WA 1QVFY 2JR6A 2NVXI 3J80f 3D2LA 4Y7NI 3GTQI 1Z02A 2LFUA 4QTTA 5D1OA 3I561 1YJ91 3U50C 4NBEA 3CCM1 1NJI2 1AA6A 3CCE1 4Y52I 3CC71 3Q87A 1I50I 3OW2Z 1YI21 4E33A 4HGZA 1RQFA 1QVGZ 2QREB 3S1QI 1JJ2Z 3QWUA 2M48A 2WAQA 1VQ5Z 3GTPI 4NB9A 1KRLA 3S15I 5C44I 3CCUZ 1RO4A 4RS4A 2DE7A 3NFZA 2E2HI 3HOVI 2KI7B 3CCVZ 5IP7I 3RZOI 1Q811 1QVFZ 2E7ZA 5AN9F 3CC4Z 1Q7Y2 2P28A 3LUSA 1YJNZ 1VQL1 1Y1WI 1Q861 5CM2M 1M901 2YADA 1ZB9A 3S16I 3I07A 4XX2A 1WW9A 1TWCI 1VQ71 3CMA1 2NVQI 1KD12 3HOXI 2YU9I 1TWFI 2IZ3A 3M4OI 1YHQZ 1SIWA 1NUIA 3MONA 1YIT1 2JIQA 3EERA 1S72Z 3G4S1 3PO3S 2JA6I 1Y1VI 1N8R2 1TFIA 1VQ6Z 4NBHA 1YJN1 1LQLA 3FQMA 4NH1C 3CXCY 2VUMI 3J7A4 2O4HA 4X6AI 3ESWA 5FLXb 2GTIA 1ZH1A 4DK1A 4MD7A 4CL1A 4A3FI 4NBCA 2DE6A 1X0TA 3NDJA 1VQKZ 3KIFA 3GTMS 3I551 2IV2X 1YHQ1 2Q4ZA 2NVYI 5A2Qb 2QRCB 2M6NA 2R7ZI 2ZAEB 2PMZA 3VTNA 3EEDA 1RO2A 3TE5B 1VQN1 1YJ9Z 1K8A1 4AYBA 3IF8A 4A3CI 1VQM1 3CCMZ 1ZB8A 2EGTA 2JS4A 3S1RI 5IT9f 4A3GI 1DL6A 1VQ91 3TDHB 4NBGA 4A3KI 4E30A 2OOXB 3CD6Z 2GU2A 1Q812 3G711 1I3QI 1VQK1 1VQPZ 3J81f 1Q862 3JAMf 1NP6A 1M902 2V3VA 2H85A 2RHBA 3BG0B 4NFRA 4S1TA 1TWGI 1VQ81 3MZLB 3MZKB 4E31A 3P5JB 1Q821 2V45A 3D6WA 1YIJ1 1VQLZ 3BG1B 5T6BA 2DE5A 1P9NA 4MD8A 2IZ4A 3CD61 3S14I 1VQP1 4TNUA 2JA7I 3RZDI 3FKII 1Z03A 1ML8A 2J6AA 3CMAZ 1VQ7Z 2R93I 4DGLA 4A3II 2G2KA 2NVTI 2R92I 2GTHA 4EWCA 1YITZ 3CCS1 2RPRA 2O53A 3F3PC 3G4SZ 4RVHA 3CCRZ 1SFOI 3CCJZ 4NBBA 2HU9A 3NH4A 1RO0A 1WIIA 1WCMI 2JIMA 2VPWA 3PO2I 3KIHA 3PO3I 5D1OB 3GTGI 2R6MA 4MXUA 2OTL1 1R9TI 4RV9A 1W2BY 1K8A2 2BJOA 4BY7I 4NBDA 3I55Z 3VB9A 3CME1 3NH5A 5IP9I 2QR1B 2W04A 1X3ZA 2NAPA 2VF1A 2RT9A 3GTMI 3CCR1 2V8IA 1L1OC 3CCJ1 1VQNZ 3S1NI 3S1MI 1VQMZ 3CC21 1USPA 3CPWY 5LL6f 3GTJI 2QLVB 1TWAI 1VQ9Z 2VPYA 3FQQA 1Q822 3G71Z 5IT9b 2OZKA 1N2FA 4BXXI 2E9HA 1I6HI 2VPZA 1W2BZ 3J81b 3HOZI 4MH4A 3J80b 1VQ8Z 2QEX1 3GKQA 1Z01A 2JMOA 3HOUI 1YIJZ 4E32A 1S7MA 2AKLA 2JIPA 2B63I 1K9M1 3OW2Y 2I3CA 4HH4A 1VQ41 3VMIA 3CPWZ 3CXCZ 4NOZA 1PFTA 1KC81 3CCQ1 1JJ2Y 2W03A 3T4NB 1K83I 3D9XA 3CCSZ 2V8JA 4A3MI 5FLMI 5A2Qf 1YJWZ 2HF1A 4A3EI 1VQOZ 1N8R1 2JNYA 2QRDB 1KQSY 3NDIA 4E2YA 4BBRI 1M1K1 2F4MA 2E2JI 2OTLZ 2PM9A 5T67A 2OTJ1 3VMHA 4MD9A 3CCL1 1QYPA 3CMEZ 5C4JI 1FDOA 4A3JI 2KPIA 2K3RA 4HGYA 3S2HI 2JIOA 3NH8A 2VPXA 5T64A 3H3VJ 2WB1A 2QA41 1YJW1 1VQO1 1YUAA 3CQZI 3CC2Z 4E2XA 4A3DI 4NB8A 2LEXA 1VLAA 4BY1I 3G6EZ 3I4NI 2LIYA 1QF8A 2VUGA 1KQSZ 1K731 2RIQA 2P3YA 1Y8CA 2AYDA 1K9M2 3S2DI 3GTKI 3IR7A 1WZNA 3F3FC 1KC82 3M3YI 2QEXZ 4E2WA 4MRIA 1VQ51 2V8KA 1JWHC 3CCU1 1NJI1 3HOWI 3G6E1 3CCV1 3IFUA 3HKZA 2JA8I 4A3LI 4E2ZA 4NBFA 4DQYB 1VQ4Z 2Q51A 1TWHI 3CC41 1WJ2A 2JA5I 1RNIA 1M1K2 2JUBA 3CCQZ 2RBLA 1QXFA 4NBAA 3VMGA 3JAMb 1RLYA 2OOYB 2QKDA 5C3EI 4RVFA 3GTOI
chains in the Genus database with same CATH topology
4RVGA 1Q7Y1 4A3BI 1Y1VS 1S721 3HOYI 3I4MI 2PK7A 4MONA 1USPB 2OTJZ 3S17I 3I56Z 1QVGY 1VQ61 5D1PA 3GCFA 5FLXf 3CCLZ 4A93I 3IX0A 5C4XI 3CCEZ 1KD11 3K7AI 3CC7Z 4BBSI 1YI2Z 1YUKA 4QTUA 2K5RA 4RVDA 2QA4Z 1K732 2F4OA 3H0GI 2Y0SA 2E2II 3GTLI 1X3WA 1QVFY 2JR6A 2NVXI 3J80f 4Y7NI 3GTQI 1Z02A 2LFUA 4QTTA 5D1OA 3I561 1YJ91 3U50C 4NBEA 3CCM1 1NJI2 3CCE1 4Y52I 3CC71 3Q87A 1I50I 3OW2Z 1YI21 4E33A 4HGZA 1RQFA 1QVGZ 2QREB 3S1QI 1JJ2Z 3QWUA 2M48A 2WAQA 1VQ5Z 3GTPI 4NB9A 1KRLA 3S15I 5C44I 3CCUZ 1RO4A 4RS4A 2DE7A 3NFZA 2E2HI 3HOVI 2KI7B 3CCVZ 5IP7I 3RZOI 1Q811 1QVFZ 5AN9F 3CC4Z 1Q7Y2 2P28A 3LUSA 1YJNZ 1VQL1 1Y1WI 1Q861 5CM2M 1M901 2YADA 1ZB9A 3S16I 3I07A 4XX2A 1WW9A 1TWCI 1VQ71 3CMA1 2NVQI 1KD12 3HOXI 2YU9I 1TWFI 2IZ3A 3M4OI 1YHQZ 1NUIA 3MONA 1YIT1 3EERA 1S72Z 3G4S1 3PO3S 2JA6I 1Y1VI 1N8R2 1TFIA 1VQ6Z 4NBHA 1YJN1 1LQLA 3FQMA 4NH1C 3CXCY 2VUMI 3J7A4 2O4HA 4X6AI 3ESWA 5FLXb 2GTIA 1ZH1A 4DK1A 4MD7A 4CL1A 4A3FI 4NBCA 2DE6A 1X0TA 3NDJA 1VQKZ 3KIFA 3GTMS 3I551 1YHQ1 2Q4ZA 2NVYI 5A2Qb 2QRCB 2M6NA 2R7ZI 2ZAEB 2PMZA 3VTNA 3EEDA 1RO2A 3TE5B 1VQN1 1YJ9Z 1K8A1 4AYBA 3IF8A 4A3CI 1VQM1 3CCMZ 1ZB8A 2EGTA 2JS4A 3S1RI 5IT9f 4A3GI 1DL6A 1VQ91 3TDHB 4NBGA 4A3KI 4E30A 2OOXB 3CD6Z 2GU2A 1Q812 3G711 1I3QI 1VQK1 1VQPZ 3J81f 1Q862 3JAMf 1NP6A 1M902 2H85A 2RHBA 3BG0B 4NFRA 4S1TA 1TWGI 1VQ81 3MZLB 3MZKB 4E31A 3P5JB 1Q821 3D6WA 1YIJ1 1VQLZ 3BG1B 5T6BA 2DE5A 1P9NA 4MD8A 2IZ4A 3CD61 3S14I 1VQP1 4TNUA 2JA7I 3RZDI 3FKII 1Z03A 1ML8A 2J6AA 3CMAZ 1VQ7Z 2R93I 4DGLA 4A3II 2G2KA 2NVTI 2R92I 2GTHA 4EWCA 1YITZ 3CCS1 2RPRA 2O53A 3F3PC 3G4SZ 4RVHA 3CCRZ 1SFOI 3CCJZ 4NBBA 2HU9A 3NH4A 1RO0A 1WIIA 1WCMI 3PO2I 3KIHA 3PO3I 5D1OB 3GTGI 2R6MA 4MXUA 2OTL1 1R9TI 4RV9A 1W2BY 1K8A2 2BJOA 4BY7I 4NBDA 3I55Z 3VB9A 3CME1 3NH5A 5IP9I 2QR1B 2W04A 1X3ZA 2VF1A 2RT9A 3GTMI 3CCR1 2V8IA 1L1OC 3CCJ1 1VQNZ 3S1NI 3S1MI 1VQMZ 3CC21 1USPA 3CPWY 5LL6f 3GTJI 2QLVB 1TWAI 1VQ9Z 3FQQA 1Q822 3G71Z 5IT9b 2OZKA 1N2FA 4BXXI 2E9HA 1I6HI 1W2BZ 3J81b 3HOZI 4MH4A 1VQ8Z 3J80b 2QEX1 3GKQA 1Z01A 2JMOA 3HOUI 1YIJZ 4E32A 1S7MA 2AKLA 2B63I 1K9M1 3OW2Y 2I3CA 4HH4A 1VQ41 3VMIA 3CPWZ 3CXCZ 4NOZA 1PFTA 1KC81 3CCQ1 1JJ2Y 2W03A 3T4NB 1K83I 3D9XA 3CCSZ 2V8JA 4A3MI 5FLMI 5A2Qf 1YJWZ 2HF1A 4A3EI 1VQOZ 1N8R1 2JNYA 2QRDB 1KQSY 3NDIA 4E2YA 4BBRI 1M1K1 2F4MA 2E2JI 2OTLZ 2PM9A 5T67A 2OTJ1 3VMHA 4MD9A 3CCL1 1QYPA 3CMEZ 5C4JI 4A3JI 2KPIA 2K3RA 4HGYA 3S2HI 3NH8A 5T64A 3H3VJ 2WB1A 2QA41 1YJW1 1VQO1 1YUAA 3CQZI 3CC2Z 4E2XA 4A3DI 4NB8A 1VLAA 4BY1I 3G6EZ 3I4NI 2LIYA 1QF8A 2VUGA 1KQSZ 1K731 2RIQA 2P3YA 1K9M2 3S2DI 3GTKI 3F3FC 1KC82 3M3YI 2QEXZ 4E2WA 4MRIA 1VQ51 2V8KA 1JWHC 3CCU1 1NJI1 3HOWI 3G6E1 3CCV1 3IFUA 3HKZA 2JA8I 4A3LI 4E2ZA 4NBFA 4DQYB 1VQ4Z 2Q51A 1TWHI 3CC41 2JA5I 1RNIA 1M1K2 2JUBA 3CCQZ 2RBLA 4NBAA 3VMGA 3JAMb 1RLYA 2OOYB 2QKDA 5C3EI 4RVFA 3GTOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMO A;  2RT9 A;  1QF8 A;  3EED A;  2M48 A;  1JWH C;  4MD9 A;  4DGL A;  4MD8 A;  4NH1 C;  1RQF A;  2M6N A;  2R6M A;  4MD7 A; 
#chains in the Genus database with same CATH topology
 4RVG A;  1Q16 A;  1Q7Y 1;  4A3B I;  1Y1V S;  1S72 1;  3HOY I;  3I4M I;  2PK7 A;  4MON A;  1FDI A;  1USP B;  2OTJ Z;  3S17 I;  3I56 Z;  1QVG Y;  1VQ6 1;  5D1P A;  3GCF A;  5FLX f;  3CCL Z;  4A93 I;  3IX0 A;  5C4X I;  3CCE Z;  1KD1 1;  3K7A I;  3CC7 Z;  4BBS I;  1YI2 Z;  1YUK A;  4QTU A;  2K5R A;  4RVD A;  2JIR A;  2QA4 Z;  1K73 2;  2F4O A;  3H0G I;  2Y0S A;  2E2I I;  3GTL I;  1X3W A;  1QVF Y;  2JR6 A;  2NVX I;  3J80 f;  3D2L A;  4Y7N I;  3GTQ I;  1Z02 A;  2LFU A;  4QTT A;  5D1O A;  3I56 1;  1YJ9 1;  3U50 C;  4NBE A;  3CCM 1;  1NJI 2;  1AA6 A;  3CCE 1;  4Y52 I;  3CC7 1;  3Q87 A;  1I50 I;  3OW2 Z;  1YI2 1;  4E33 A;  4HGZ A;  1RQF A;  1QVG Z;  2QRE B;  3S1Q I;  1JJ2 Z;  3QWU A;  2M48 A;  2WAQ A;  1VQ5 Z;  3GTP I;  4NB9 A;  1KRL A;  3S15 I;  5C44 I;  3CCU Z;  1RO4 A;  4RS4 A;  2DE7 A;  3NFZ A;  2E2H I;  3HOV I;  2KI7 B;  3CCV Z;  5IP7 I;  3RZO I;  1Q81 1;  1QVF Z;  2E7Z A;  5AN9 F;  3CC4 Z;  1Q7Y 2;  2P28 A;  3LUS A;  1YJN Z;  1VQL 1;  1Y1W I;  1Q86 1;  5CM2 M;  1M90 1;  2YAD A;  1ZB9 A;  3S16 I;  3I07 A;  4XX2 A;  1WW9 A;  1TWC I;  1VQ7 1;  3CMA 1;  2NVQ I;  1KD1 2;  3HOX I;  2YU9 I;  1TWF I;  2IZ3 A;  3M4O I;  1YHQ Z;  1SIW A;  1NUI A;  3MON A;  1YIT 1;  2JIQ A;  3EER A;  1S72 Z;  3G4S 1;  3PO3 S;  2JA6 I;  1Y1V I;  1N8R 2;  1TFI A;  1VQ6 Z;  4NBH A;  1YJN 1;  1LQL A;  3FQM A;  4NH1 C;  3CXC Y;  2VUM I;  3J7A 4;  2O4H A;  4X6A I;  3ESW A;  5FLX b;  2GTI A;  1ZH1 A;  4DK1 A;  4MD7 A;  4CL1 A;  4A3F I;  4NBC A;  2DE6 A;  1X0T A;  3NDJ A;  1VQK Z;  3KIF A;  3GTM S;  3I55 1;  2IV2 X;  1YHQ 1;  2Q4Z A;  2NVY I;  5A2Q b;  2QRC B;  2M6N A;  2R7Z I;  2ZAE B;  2PMZ A;  3VTN A;  3EED A;  1RO2 A;  3TE5 B;  1VQN 1;  1YJ9 Z;  1K8A 1;  4AYB A;  3IF8 A;  4A3C I;  1VQM 1;  3CCM Z;  1ZB8 A;  2EGT A;  2JS4 A;  3S1R I;  5IT9 f;  4A3G I;  1DL6 A;  1VQ9 1;  3TDH B;  4NBG A;  4A3K I;  4E30 A;  2OOX B;  3CD6 Z;  2GU2 A;  1Q81 2;  3G71 1;  1I3Q I;  1VQK 1;  1VQP Z;  3J81 f;  1Q86 2;  3JAM f;  1NP6 A;  1M90 2;  2V3V A;  2H85 A;  2RHB A;  3BG0 B;  4NFR A;  4S1T A;  1TWG I;  1VQ8 1;  3MZL B;  3MZK B;  4E31 A;  3P5J B;  1Q82 1;  2V45 A;  3D6W A;  1YIJ 1;  1VQL Z;  3BG1 B;  5T6B A;  2DE5 A;  1P9N A;  4MD8 A;  2IZ4 A;  3CD6 1;  3S14 I;  1VQP 1;  4TNU A;  2JA7 I;  3RZD I;  3FKI I;  1Z03 A;  1ML8 A;  2J6A A;  3CMA Z;  1VQ7 Z;  2R93 I;  4DGL A;  4A3I I;  2G2K A;  2NVT I;  2R92 I;  2GTH A;  4EWC A;  1YIT Z;  3CCS 1;  2RPR A;  2O53 A;  3F3P C;  3G4S Z;  4RVH A;  3CCR Z;  1SFO I;  3CCJ Z;  4NBB A;  2HU9 A;  3NH4 A;  1RO0 A;  1WII A;  1WCM I;  2JIM A;  2VPW A;  3PO2 I;  3KIH A;  3PO3 I;  5D1O B;  3GTG I;  2R6M A;  4MXU A;  2OTL 1;  1R9T I;  4RV9 A;  1W2B Y;  1K8A 2;  2BJO A;  4BY7 I;  4NBD A;  3I55 Z;  3VB9 A;  3CME 1;  3NH5 A;  5IP9 I;  2QR1 B;  2W04 A;  1X3Z A;  2NAP A;  2VF1 A;  2RT9 A;  3GTM I;  3CCR 1;  2V8I A;  1L1O C;  3CCJ 1;  1VQN Z;  3S1N I;  3S1M I;  1VQM Z;  3CC2 1;  1USP A;  3CPW Y;  5LL6 f;  3GTJ I;  2QLV B;  1TWA I;  1VQ9 Z;  2VPY A;  3FQQ A;  1Q82 2;  3G71 Z;  5IT9 b;  2OZK A;  1N2F A;  4BXX I;  2E9H A;  1I6H I;  2VPZ A;  1W2B Z;  3J81 b;  3HOZ I;  4MH4 A;  3J80 b;  1VQ8 Z;  2QEX 1;  3GKQ A;  1Z01 A;  2JMO A;  3HOU I;  1YIJ Z;  4E32 A;  1S7M A;  2AKL A;  2JIP A;  2B63 I;  1K9M 1;  3OW2 Y;  2I3C A;  4HH4 A;  1VQ4 1;  3VMI A;  3CPW Z;  3CXC Z;  4NOZ A;  1PFT A;  1KC8 1;  3CCQ 1;  1JJ2 Y;  2W03 A;  3T4N B;  1K83 I;  3D9X A;  3CCS Z;  2V8J A;  4A3M I;  5FLM I;  5A2Q f;  1YJW Z;  2HF1 A;  4A3E I;  1VQO Z;  1N8R 1;  2JNY A;  2QRD B;  1KQS Y;  3NDI A;  4E2Y A;  4BBR I;  1M1K 1;  2F4M A;  2E2J I;  2OTL Z;  2PM9 A;  5T67 A;  2OTJ 1;  3VMH A;  4MD9 A;  3CCL 1;  1QYP A;  3CME Z;  5C4J I;  1FDO A;  4A3J I;  2KPI A;  2K3R A;  4HGY A;  3S2H I;  2JIO A;  3NH8 A;  2VPX A;  5T64 A;  3H3V J;  2WB1 A;  2QA4 1;  1YJW 1;  1VQO 1;  1YUA A;  3CQZ I;  3CC2 Z;  4E2X A;  4A3D I;  4NB8 A;  2LEX A;  1VLA A;  4BY1 I;  3G6E Z;  3I4N I;  2LIY A;  1QF8 A;  2VUG A;  1KQS Z;  1K73 1;  2RIQ A;  2P3Y A;  1Y8C A;  2AYD A;  1K9M 2;  3S2D I;  3GTK I;  3IR7 A;  1WZN A;  3F3F C;  1KC8 2;  3M3Y I;  2QEX Z;  4E2W A;  4MRI A;  1VQ5 1;  2V8K A;  1JWH C;  3CCU 1;  1NJI 1;  3HOW I;  3G6E 1;  3CCV 1;  3IFU A;  3HKZ A;  2JA8 I;  4A3L I;  4E2Z A;  4NBF A;  4DQY B;  1VQ4 Z;  2Q51 A;  1TWH I;  3CC4 1;  1WJ2 A;  2JA5 I;  1RNI A;  1M1K 2;  2JUB A;  3CCQ Z;  2RBL A;  1QXF A;  4NBA A;  3VMG A;  3JAM b;  1RLY A;  2OOY B;  2QKD A;  5C3E I;  4RVF A;  3GTO I; 
#chains in the Genus database with same CATH homology
 4RVG A;  1Q7Y 1;  4A3B I;  1Y1V S;  1S72 1;  3HOY I;  3I4M I;  2PK7 A;  4MON A;  1USP B;  2OTJ Z;  3S17 I;  3I56 Z;  1QVG Y;  1VQ6 1;  5D1P A;  3GCF A;  5FLX f;  3CCL Z;  4A93 I;  3IX0 A;  5C4X I;  3CCE Z;  1KD1 1;  3K7A I;  3CC7 Z;  4BBS I;  1YI2 Z;  1YUK A;  4QTU A;  2K5R A;  4RVD A;  2QA4 Z;  1K73 2;  2F4O A;  3H0G I;  2Y0S A;  2E2I I;  3GTL I;  1X3W A;  1QVF Y;  2JR6 A;  2NVX I;  3J80 f;  4Y7N I;  3GTQ I;  1Z02 A;  2LFU A;  4QTT A;  5D1O A;  3I56 1;  1YJ9 1;  3U50 C;  4NBE A;  3CCM 1;  1NJI 2;  3CCE 1;  4Y52 I;  3CC7 1;  3Q87 A;  1I50 I;  3OW2 Z;  1YI2 1;  4E33 A;  4HGZ A;  1RQF A;  1QVG Z;  2QRE B;  3S1Q I;  1JJ2 Z;  3QWU A;  2M48 A;  2WAQ A;  1VQ5 Z;  3GTP I;  4NB9 A;  1KRL A;  3S15 I;  5C44 I;  3CCU Z;  1RO4 A;  4RS4 A;  2DE7 A;  3NFZ A;  2E2H I;  3HOV I;  2KI7 B;  3CCV Z;  5IP7 I;  3RZO I;  1Q81 1;  1QVF Z;  5AN9 F;  3CC4 Z;  1Q7Y 2;  2P28 A;  3LUS A;  1YJN Z;  1VQL 1;  1Y1W I;  1Q86 1;  5CM2 M;  1M90 1;  2YAD A;  1ZB9 A;  3S16 I;  3I07 A;  4XX2 A;  1WW9 A;  1TWC I;  1VQ7 1;  3CMA 1;  2NVQ I;  1KD1 2;  3HOX I;  2YU9 I;  1TWF I;  2IZ3 A;  3M4O I;  1YHQ Z;  1NUI A;  3MON A;  1YIT 1;  3EER A;  1S72 Z;  3G4S 1;  3PO3 S;  2JA6 I;  1Y1V I;  1N8R 2;  1TFI A;  1VQ6 Z;  4NBH A;  1YJN 1;  1LQL A;  3FQM A;  4NH1 C;  3CXC Y;  2VUM I;  3J7A 4;  2O4H A;  4X6A I;  3ESW A;  5FLX b;  2GTI A;  1ZH1 A;  4DK1 A;  4MD7 A;  4CL1 A;  4A3F I;  4NBC A;  2DE6 A;  1X0T A;  3NDJ A;  1VQK Z;  3KIF A;  3GTM S;  3I55 1;  1YHQ 1;  2Q4Z A;  2NVY I;  5A2Q b;  2QRC B;  2M6N A;  2R7Z I;  2ZAE B;  2PMZ A;  3VTN A;  3EED A;  1RO2 A;  3TE5 B;  1VQN 1;  1YJ9 Z;  1K8A 1;  4AYB A;  3IF8 A;  4A3C I;  1VQM 1;  3CCM Z;  1ZB8 A;  2EGT A;  2JS4 A;  3S1R I;  5IT9 f;  4A3G I;  1DL6 A;  1VQ9 1;  3TDH B;  4NBG A;  4A3K I;  4E30 A;  2OOX B;  3CD6 Z;  2GU2 A;  1Q81 2;  3G71 1;  1I3Q I;  1VQK 1;  1VQP Z;  3J81 f;  1Q86 2;  3JAM f;  1NP6 A;  1M90 2;  2H85 A;  2RHB A;  3BG0 B;  4NFR A;  4S1T A;  1TWG I;  1VQ8 1;  3MZL B;  3MZK B;  4E31 A;  3P5J B;  1Q82 1;  3D6W A;  1YIJ 1;  1VQL Z;  3BG1 B;  5T6B A;  2DE5 A;  1P9N A;  4MD8 A;  2IZ4 A;  3CD6 1;  3S14 I;  1VQP 1;  4TNU A;  2JA7 I;  3RZD I;  3FKI I;  1Z03 A;  1ML8 A;  2J6A A;  3CMA Z;  1VQ7 Z;  2R93 I;  4DGL A;  4A3I I;  2G2K A;  2NVT I;  2R92 I;  2GTH A;  4EWC A;  1YIT Z;  3CCS 1;  2RPR A;  2O53 A;  3F3P C;  3G4S Z;  4RVH A;  3CCR Z;  1SFO I;  3CCJ Z;  4NBB A;  2HU9 A;  3NH4 A;  1RO0 A;  1WII A;  1WCM I;  3PO2 I;  3KIH A;  3PO3 I;  5D1O B;  3GTG I;  2R6M A;  4MXU A;  2OTL 1;  1R9T I;  4RV9 A;  1W2B Y;  1K8A 2;  2BJO A;  4BY7 I;  4NBD A;  3I55 Z;  3VB9 A;  3CME 1;  3NH5 A;  5IP9 I;  2QR1 B;  2W04 A;  1X3Z A;  2VF1 A;  2RT9 A;  3GTM I;  3CCR 1;  2V8I A;  1L1O C;  3CCJ 1;  1VQN Z;  3S1N I;  3S1M I;  1VQM Z;  3CC2 1;  1USP A;  3CPW Y;  5LL6 f;  3GTJ I;  2QLV B;  1TWA I;  1VQ9 Z;  3FQQ A;  1Q82 2;  3G71 Z;  5IT9 b;  2OZK A;  1N2F A;  4BXX I;  2E9H A;  1I6H I;  1W2B Z;  3J81 b;  3HOZ I;  4MH4 A;  1VQ8 Z;  3J80 b;  2QEX 1;  3GKQ A;  1Z01 A;  2JMO A;  3HOU I;  1YIJ Z;  4E32 A;  1S7M A;  2AKL A;  2B63 I;  1K9M 1;  3OW2 Y;  2I3C A;  4HH4 A;  1VQ4 1;  3VMI A;  3CPW Z;  3CXC Z;  4NOZ A;  1PFT A;  1KC8 1;  3CCQ 1;  1JJ2 Y;  2W03 A;  3T4N B;  1K83 I;  3D9X A;  3CCS Z;  2V8J A;  4A3M I;  5FLM I;  5A2Q f;  1YJW Z;  2HF1 A;  4A3E I;  1VQO Z;  1N8R 1;  2JNY A;  2QRD B;  1KQS Y;  3NDI A;  4E2Y A;  4BBR I;  1M1K 1;  2F4M A;  2E2J I;  2OTL Z;  2PM9 A;  5T67 A;  2OTJ 1;  3VMH A;  4MD9 A;  3CCL 1;  1QYP A;  3CME Z;  5C4J I;  4A3J I;  2KPI A;  2K3R A;  4HGY A;  3S2H I;  3NH8 A;  5T64 A;  3H3V J;  2WB1 A;  2QA4 1;  1YJW 1;  1VQO 1;  1YUA A;  3CQZ I;  3CC2 Z;  4E2X A;  4A3D I;  4NB8 A;  1VLA A;  4BY1 I;  3G6E Z;  3I4N I;  2LIY A;  1QF8 A;  2VUG A;  1KQS Z;  1K73 1;  2RIQ A;  2P3Y A;  1K9M 2;  3S2D I;  3GTK I;  3F3F C;  1KC8 2;  3M3Y I;  2QEX Z;  4E2W A;  4MRI A;  1VQ5 1;  2V8K A;  1JWH C;  3CCU 1;  1NJI 1;  3HOW I;  3G6E 1;  3CCV 1;  3IFU A;  3HKZ A;  2JA8 I;  4A3L I;  4E2Z A;  4NBF A;  4DQY B;  1VQ4 Z;  2Q51 A;  1TWH I;  3CC4 1;  2JA5 I;  1RNI A;  1M1K 2;  2JUB A;  3CCQ Z;  2RBL A;  4NBA A;  3VMG A;  3JAM b;  1RLY A;  2OOY B;  2QKD A;  5C3E I;  4RVF A;  3GTO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...