2OTJ1

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2otj100
3CPWZ 1VQ91 1NJI2 1VQL1 3CCEZ 1Q821 1VQ61 1VQ7Z 1YIJZ 1QVFY 1KQSZ 1KQSY 2OTJ1 3CCJZ 1N8R2 3I55Z 1YITZ 1VQPZ 3CCS1 2QA4Z 1K9M2 3CPWY 2OTL1 1Q812 1S72Z 1K731 1VQ51 1Q7Y2 3I56Z 1QVGY 1W2BZ 1YI2Z 1YJ9Z 3CC21 3OW2Y 3G6EZ 1VQM1 1M901 1VQLZ 1Q7Y1 2OTJZ 3CCRZ 3CCLZ 1K8A1 1N8R1 1YJW1 3CCJ1 1VQN1 1VQP1 1KC81 1S721 1K732 1KD12 3CMEZ 3CCMZ 1YHQZ 3I561 1KD11 3CXCY 3CCL1 1JJ2Y 1YJNZ 1VQNZ 3CCU1 1KC82 3G711 3G4SZ 3CC41 3CC2Z 3CC7Z 3CMA1 1VQO1 3CME1 1M902 1YJ91 1VQK1 3CCVZ 3CCM1 3CD61 1YHQ1 3CCQZ 1Q811 2QEX1 1YJN1 1QVGZ 1M1K2 1VQ41 3G71Z 3G4S1 3CC4Z 1VQ8Z 1VQOZ 1VQ71 3CXCZ 3CC71 3CMAZ 1VQKZ 3CCE1 1VQ6Z 3CCUZ 2QEXZ 3CCV1 1VQ9Z 3I551 1YIT1 3CD6Z 1K8A2 1QVFZ 1VQ5Z 1JJ2Z 1YIJ1 1W2BY 1NJI1 1VQ4Z 2OTLZ 1Q861 1YI21 1Q822 1VQ81 3CCQ1 2QA41 3CCR1 1Q862 3OW2Z 1VQMZ 3G6E1 1M1K1 1YJWZ 3CCSZ 1K9M1
chains in the Genus database with same CATH superfamily
4DGLA 1S7MA 2RHBA 4NBGA 1VQ91 4RVFA 1NJI2 3CCEZ 4MONA 2QLVB 1YIJZ 4E2YA 1QVFY 3FQMA 2E7ZA 4AYBA 1K83I 2GU2A 2QKDA 1YITZ 1VQPZ 2QA4Z 3NFZA 4NBHA 1Y1VI 3RZDI 2JNYA 2M48A 1ZH1A 4NH1C 1KRLA 3GTMI 3CC21 3OW2Y 1VQLZ 3CQZI 1RO0A 2OTJZ 2NVXI 1ML8A 3J81f 1N8R1 1K8A1 5D1OB 3BG1B 4RVGA 1YJW1 4HGZA 2F4MA 3CCJ1 1VQN1 1N2FA 5T67A 1KC81 2RIQA 1S721 3BG0B 2NAPA 3GTMS 2QR1B 1RO4A 2QREB 1KD12 3I4MI 2PM9A 2GTIA 4NOZA 4NB9A 1KD11 4A3II 1RLYA 4A3EI 3EEDA 2PMZA 3G711 1VLAA 3MZLB 2R93I 1Z02A 1YJ91 2V3VA 1VQK1 1YHQ1 3CCQZ 1Q811 1RQFA 2VUGA 3S1NI 2JUBA 3TE5B 2VF1A 3G4S1 5IT9b 2DE7A 3M3YI 4A93I 3CXCZ 2W04A 5IP9I 1SIWA 4A3CI 5FLXf 3MZKB 4A3MI 4A3BI 1VQ9Z 2V45A 1YIT1 3CD6Z 1K8A2 3NH5A 2F4OA 2WAQA 5A2Qb 2DE5A 1VQ4Z 1YIJ1 2OTLZ 4E32A 3VMIA 4NBFA 1QF8A 3D9XA 2QA41 1Q862 5C4JI 2JIQA 1Z01A 1M1K1 2OOYB 3RZOI 2I3CA 1R9TI 1PFTA 4A3LI 3S1QI 3CPWZ 3HOWI 1VQL1 3IX0A 1VQ61 3VTNA 3GKQA 1KQSZ 2OTJ1 1TFIA 3D6WA 3F3FC 3CCS1 1Y8CA 3J80f 3VMGA 1X3WA 4MH4A 2LIYA 4EWCA 2YU9I 3S17I 3JAMb 3S14I 1QVGY 3J7A4 1W2BZ 3LUSA 3GTPI 2QRDB 2V8IA 5LL6f 4E2WA 4Y7NI 1VQP1 3HOYI 3HKZA 1K732 2O4HA 1FDOA 3Q87A 1TWAI 5D1PA 3CCMZ 1AA6A 2NVYI 3I561 2E2II 3IF8A 3CCL1 1WJ2A 2JIMA 1YJNZ 3U50C 1QXFA 1VQNZ 3HOUI 4NFRA 1TWHI 3HOZI 3G4SZ 2IZ4A 4HH4A 3CC2Z 2JIRA 3CME1 5T6BA 3KIFA 5C4XI 1Y1WI 2AYDA 2QRCB 2B63I 1M1K2 1VQ41 4E2ZA 4RV9A 4BXXI 3GTOI 1YUKA 3QWUA 2Q4ZA 1VQKZ 4S1TA 2JA7I 4BY7I 4A3FI 4Y52I 1P9NA 1L1OC 2IZ3A 5FLXb 5T64A 1RNIA 2M6NA 2RPRA 1JJ2Z 1NJI1 3PO3S 2K3RA 1Q861 2G2KA 2VUMI 3S15I 5AN9F 2VPYA 3G6E1 1YJWZ 3CCSZ 2GTHA 1X3ZA 3PO3I 2JMOA 3GTKI 4TNUA 2VPXA 2Q51A 3H0GI 3S16I 3K7AI 1Q821 1TWGI 1VQ7Z 2V8JA 4NBAA 1KQSY 1JWHC 1N8R2 4RS4A 4RVDA 3I55Z 2R7ZI 3HOXI 1K9M2 2P28A 1FDIA 2E9HA 5D1OA 3CPWY 2OTL1 1Q812 3I56Z 4XX2A 2JA6I 1YJ9Z 2P3YA 4CL1A 2AKLA 4NBEA 1Q7Y1 2LFUA 4NB8A 3MONA 3CCLZ 2EGTA 3HOVI 4A3KI 3GTLI 4MD7A 3H3VJ 5A2Qf 4E2XA 3GTQI 3CMEZ 1I6HI 2V8KA 4E30A 2RT9A 2E2HI 2ZAEB 1YUAA 2NVTI 1RO2A 3CCU1 4QTUA 1WW9A 1KC82 3CC41 2NVQI 4MD9A 1VQO1 2E2JI 4DQYB 4A3DI 1SFOI 5IT9f 3F3PC 2OZKA 4MXUA 3CCM1 3S2HI 4BBSI 3I07A 2QEX1 1YJN1 5C44I 3S2DI 2KI7B 3NDJA 4MD8A 3CMAZ 3CC71 3CCE1 1ZB9A 2RBLA 3NH4A 4NBBA 1QYPA 3CCV1 3I551 1WZNA 2Y0SA 4DK1A 1VQ5Z 1W2BY 3GCFA 1YI21 1TWFI 1VQ81 3KIHA 3M4OI 3IR7A 3CCR1 2HU9A 3OW2Z 3FQQA 3JAMf 1DL6A 3J81b 4BBRI 5CM2M 3P5JB 2BJOA 3PO2I 2DE6A 1USPA 1WIIA 2H85A 2KPIA 1NUIA 4NBCA 1Q16A 3CCJZ 2PK7A 2J6AA 2VPWA 1S72Z 1K731 1VQ51 1I3QI 1Q7Y2 2WB1A 4NBDA 1YI2Z 1VQM1 3G6EZ 1WCMI 3FKII 3EERA 3GTJI 1M901 3CCRZ 2OOXB 2VPZA 3I4NI 1I50I 3T4NB 2K5RA 5C3EI 3NH8A 3S1RI 1Y1VS 1LQLA 1USPB 4A3JI 4BY1I 1YHQZ 3S1MI 3CXCY 1JJ2Y 4E31A 2R6MA 3IFUA 4E33A 4MRIA 4RVHA 3TDHB 2JIPA 1ZB8A 3CC7Z 3CMA1 2JA8I 2O53A 3VB9A 3GTGI 1M902 3CCVZ 1Z03A 3CD61 3J80b 1QVGZ 3D2LA 1TWCI 3NDIA 3G71Z 3CC4Z 1VQ8Z 2W03A 2JR6A 3ESWA 1VQOZ 4A3GI 4HGYA 1VQ71 5FLMI 1NP6A 2YADA 1VQ6Z 3CCUZ 1X0TA 2JIOA 2QEXZ 5IP7I 2IV2X 2LEXA 1QVFZ 2R92I 1Q822 4QTTA 3CCQ1 2JS4A 3VMHA 1VQMZ 2HF1A 2JA5I 1K9M1 4X6AI
chains in the Genus database with same CATH topology
4DGLA 1S7MA 2RHBA 4NBGA 1VQ91 4RVFA 1NJI2 3CCEZ 4MONA 2QLVB 1YIJZ 4E2YA 1QVFY 3FQMA 4AYBA 1K83I 2GU2A 2QKDA 1YITZ 1VQPZ 2QA4Z 3NFZA 4NBHA 1Y1VI 3RZDI 2JNYA 2M48A 1ZH1A 4NH1C 1KRLA 3GTMI 3CC21 3OW2Y 1VQLZ 3CQZI 1RO0A 2OTJZ 2NVXI 1ML8A 3J81f 1N8R1 1K8A1 5D1OB 3BG1B 4RVGA 1YJW1 4HGZA 2F4MA 3CCJ1 1VQN1 1N2FA 5T67A 1KC81 2RIQA 1S721 3BG0B 3GTMS 2QR1B 1RO4A 2QREB 1KD12 3I4MI 2PM9A 2GTIA 4NOZA 4NB9A 1KD11 4A3II 1RLYA 4A3EI 3EEDA 2PMZA 3G711 1VLAA 3MZLB 2R93I 1Z02A 1YJ91 1VQK1 1YHQ1 3CCQZ 1Q811 1RQFA 2VUGA 3S1NI 2JUBA 3TE5B 2VF1A 3G4S1 5IT9b 2DE7A 3M3YI 4A93I 3CXCZ 2W04A 5IP9I 4A3CI 5FLXf 3MZKB 4A3MI 4A3BI 1VQ9Z 1YIT1 3CD6Z 1K8A2 3NH5A 2F4OA 2WAQA 5A2Qb 2DE5A 1VQ4Z 1YIJ1 2OTLZ 4E32A 3VMIA 4NBFA 1QF8A 3D9XA 2QA41 1Q862 5C4JI 1Z01A 1M1K1 2OOYB 3RZOI 2I3CA 1R9TI 1PFTA 4A3LI 3S1QI 3CPWZ 3HOWI 1VQL1 3IX0A 1VQ61 3VTNA 3GKQA 1KQSZ 2OTJ1 1TFIA 3D6WA 3F3FC 3CCS1 3J80f 3VMGA 1X3WA 4MH4A 2LIYA 4EWCA 2YU9I 3S17I 3JAMb 3S14I 1QVGY 3J7A4 1W2BZ 3LUSA 3GTPI 2QRDB 2V8IA 5LL6f 4E2WA 4Y7NI 1VQP1 3HOYI 3HKZA 1K732 2O4HA 3Q87A 1TWAI 5D1PA 3CCMZ 2NVYI 3I561 2E2II 3IF8A 3CCL1 1YJNZ 3U50C 1VQNZ 3HOUI 4NFRA 1TWHI 3HOZI 3G4SZ 2IZ4A 4HH4A 3CC2Z 3CME1 5T6BA 3KIFA 5C4XI 1Y1WI 2QRCB 2B63I 1M1K2 1VQ41 4E2ZA 4RV9A 4BXXI 3GTOI 1YUKA 3QWUA 2Q4ZA 1VQKZ 4S1TA 2JA7I 4BY7I 4A3FI 4Y52I 1P9NA 1L1OC 2IZ3A 5FLXb 5T64A 1RNIA 2M6NA 2RPRA 1JJ2Z 1NJI1 3PO3S 2K3RA 1Q861 2G2KA 2VUMI 3S15I 5AN9F 3G6E1 1YJWZ 3CCSZ 2GTHA 1X3ZA 3PO3I 2JMOA 3GTKI 4TNUA 2Q51A 3H0GI 3S16I 3K7AI 1Q821 1TWGI 1VQ7Z 2V8JA 4NBAA 1KQSY 1JWHC 1N8R2 4RS4A 4RVDA 3I55Z 2R7ZI 3HOXI 1K9M2 2P28A 2E9HA 3CPWY 5D1OA 2OTL1 1Q812 3I56Z 4XX2A 2JA6I 1YJ9Z 2P3YA 4CL1A 2AKLA 4NBEA 1Q7Y1 2LFUA 4NB8A 3MONA 3CCLZ 2EGTA 3HOVI 4A3KI 3GTLI 4MD7A 3H3VJ 5A2Qf 4E2XA 3GTQI 3CMEZ 1I6HI 2V8KA 4E30A 2RT9A 2E2HI 2ZAEB 1YUAA 2NVTI 1RO2A 3CCU1 4QTUA 1WW9A 1KC82 3CC41 2NVQI 4MD9A 1VQO1 2E2JI 4DQYB 4A3DI 1SFOI 5IT9f 3F3PC 2OZKA 4MXUA 3CCM1 3S2HI 4BBSI 3I07A 2QEX1 1YJN1 5C44I 3S2DI 2KI7B 3NDJA 4MD8A 3CMAZ 3CC71 3CCE1 1ZB9A 2RBLA 3NH4A 4NBBA 1QYPA 3CCV1 3I551 2Y0SA 4DK1A 1VQ5Z 1W2BY 3GCFA 1YI21 1TWFI 1VQ81 3KIHA 3M4OI 3CCR1 2HU9A 3OW2Z 3FQQA 3JAMf 1DL6A 3J81b 4BBRI 5CM2M 3P5JB 2BJOA 3PO2I 2DE6A 1USPA 1WIIA 2H85A 2KPIA 1NUIA 4NBCA 3CCJZ 2PK7A 2J6AA 1S72Z 1K731 1VQ51 1I3QI 1Q7Y2 2WB1A 4NBDA 1YI2Z 1VQM1 3G6EZ 1WCMI 3FKII 3EERA 3GTJI 1M901 3CCRZ 2OOXB 3I4NI 1I50I 3T4NB 2K5RA 5C3EI 3NH8A 3S1RI 1Y1VS 1LQLA 1USPB 4A3JI 4BY1I 1YHQZ 3S1MI 3CXCY 1JJ2Y 4E31A 2R6MA 3IFUA 4E33A 4MRIA 4RVHA 3TDHB 1ZB8A 3CC7Z 3CMA1 2JA8I 2O53A 3VB9A 3GTGI 1M902 3CCVZ 1Z03A 3CD61 3J80b 1QVGZ 1TWCI 3NDIA 3G71Z 3CC4Z 1VQ8Z 2W03A 2JR6A 3ESWA 1VQOZ 4A3GI 4HGYA 1VQ71 5FLMI 1NP6A 2YADA 1VQ6Z 3CCUZ 1X0TA 2QEXZ 5IP7I 1QVFZ 2R92I 1Q822 4QTTA 3CCQ1 2JS4A 3VMHA 1VQMZ 2HF1A 2JA5I 1K9M1 4X6AI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW Z;  1VQ9 1;  1NJI 2;  1VQL 1;  3CCE Z;  1Q82 1;  1VQ6 1;  1VQ7 Z;  1YIJ Z;  1QVF Y;  1KQS Z;  1KQS Y;  2OTJ 1;  3CCJ Z;  1N8R 2;  3I55 Z;  1YIT Z;  1VQP Z;  3CCS 1;  2QA4 Z;  1K9M 2;  3CPW Y;  2OTL 1;  1Q81 2;  1S72 Z;  1K73 1;  1VQ5 1;  1Q7Y 2;  3I56 Z;  1QVG Y;  1W2B Z;  1YI2 Z;  1YJ9 Z;  3CC2 1;  3OW2 Y;  3G6E Z;  1VQM 1;  1M90 1;  1VQL Z;  1Q7Y 1;  2OTJ Z;  3CCR Z;  3CCL Z;  1K8A 1;  1N8R 1;  1YJW 1;  3CCJ 1;  1VQN 1;  1VQP 1;  1KC8 1;  1S72 1;  1K73 2;  1KD1 2;  3CME Z;  3CCM Z;  1YHQ Z;  3I56 1;  1KD1 1;  3CXC Y;  3CCL 1;  1JJ2 Y;  1YJN Z;  1VQN Z;  3CCU 1;  1KC8 2;  3G71 1;  3G4S Z;  3CC4 1;  3CC2 Z;  3CC7 Z;  3CMA 1;  1VQO 1;  3CME 1;  1M90 2;  1YJ9 1;  1VQK 1;  3CCV Z;  3CCM 1;  3CD6 1;  1YHQ 1;  3CCQ Z;  1Q81 1;  2QEX 1;  1YJN 1;  1QVG Z;  1M1K 2;  1VQ4 1;  3G71 Z;  3G4S 1;  3CC4 Z;  1VQ8 Z;  1VQO Z;  1VQ7 1;  3CXC Z;  3CC7 1;  3CMA Z;  1VQK Z;  3CCE 1;  1VQ6 Z;  3CCU Z;  2QEX Z;  3CCV 1;  1VQ9 Z;  3I55 1;  1YIT 1;  3CD6 Z;  1K8A 2;  1QVF Z;  1VQ5 Z;  1JJ2 Z;  1YIJ 1;  1W2B Y;  1NJI 1;  1VQ4 Z;  2OTL Z;  1Q86 1;  1YI2 1;  1Q82 2;  1VQ8 1;  3CCQ 1;  2QA4 1;  3CCR 1;  1Q86 2;  3OW2 Z;  1VQM Z;  3G6E 1;  1M1K 1;  1YJW Z;  3CCS Z;  1K9M 1; 
#chains in the Genus database with same CATH topology
 4DGL A;  1S7M A;  2RHB A;  4NBG A;  1VQ9 1;  4RVF A;  1NJI 2;  3CCE Z;  4MON A;  2QLV B;  1YIJ Z;  4E2Y A;  1QVF Y;  3FQM A;  2E7Z A;  4AYB A;  1K83 I;  2GU2 A;  2QKD A;  1YIT Z;  1VQP Z;  2QA4 Z;  3NFZ A;  4NBH A;  1Y1V I;  3RZD I;  2JNY A;  2M48 A;  1ZH1 A;  4NH1 C;  1KRL A;  3GTM I;  3CC2 1;  3OW2 Y;  1VQL Z;  3CQZ I;  1RO0 A;  2OTJ Z;  2NVX I;  1ML8 A;  3J81 f;  1N8R 1;  1K8A 1;  5D1O B;  3BG1 B;  4RVG A;  1YJW 1;  4HGZ A;  2F4M A;  3CCJ 1;  1VQN 1;  1N2F A;  5T67 A;  1KC8 1;  2RIQ A;  1S72 1;  3BG0 B;  2NAP A;  3GTM S;  2QR1 B;  1RO4 A;  2QRE B;  1KD1 2;  3I4M I;  2PM9 A;  2GTI A;  4NOZ A;  4NB9 A;  1KD1 1;  4A3I I;  1RLY A;  4A3E I;  3EED A;  2PMZ A;  3G71 1;  1VLA A;  3MZL B;  2R93 I;  1Z02 A;  1YJ9 1;  2V3V A;  1VQK 1;  1YHQ 1;  3CCQ Z;  1Q81 1;  1RQF A;  2VUG A;  3S1N I;  2JUB A;  3TE5 B;  2VF1 A;  3G4S 1;  5IT9 b;  2DE7 A;  3M3Y I;  4A93 I;  3CXC Z;  2W04 A;  5IP9 I;  1SIW A;  4A3C I;  5FLX f;  3MZK B;  4A3M I;  4A3B I;  1VQ9 Z;  2V45 A;  1YIT 1;  3CD6 Z;  1K8A 2;  3NH5 A;  2F4O A;  2WAQ A;  5A2Q b;  2DE5 A;  1VQ4 Z;  1YIJ 1;  2OTL Z;  4E32 A;  3VMI A;  4NBF A;  1QF8 A;  3D9X A;  2QA4 1;  1Q86 2;  5C4J I;  2JIQ A;  1Z01 A;  1M1K 1;  2OOY B;  3RZO I;  2I3C A;  1R9T I;  1PFT A;  4A3L I;  3S1Q I;  3CPW Z;  3HOW I;  1VQL 1;  3IX0 A;  1VQ6 1;  3VTN A;  3GKQ A;  1KQS Z;  2OTJ 1;  1TFI A;  3D6W A;  3F3F C;  3CCS 1;  1Y8C A;  3J80 f;  3VMG A;  1X3W A;  4MH4 A;  2LIY A;  4EWC A;  2YU9 I;  3S17 I;  3JAM b;  3S14 I;  1QVG Y;  3J7A 4;  1W2B Z;  3LUS A;  3GTP I;  2QRD B;  2V8I A;  5LL6 f;  4E2W A;  4Y7N I;  1VQP 1;  3HOY I;  3HKZ A;  1K73 2;  2O4H A;  1FDO A;  3Q87 A;  1TWA I;  5D1P A;  3CCM Z;  1AA6 A;  2NVY I;  3I56 1;  2E2I I;  3IF8 A;  3CCL 1;  1WJ2 A;  2JIM A;  1YJN Z;  3U50 C;  1QXF A;  1VQN Z;  3HOU I;  4NFR A;  1TWH I;  3HOZ I;  3G4S Z;  2IZ4 A;  4HH4 A;  3CC2 Z;  2JIR A;  3CME 1;  5T6B A;  3KIF A;  5C4X I;  1Y1W I;  2AYD A;  2QRC B;  2B63 I;  1M1K 2;  1VQ4 1;  4E2Z A;  4RV9 A;  4BXX I;  3GTO I;  1YUK A;  3QWU A;  2Q4Z A;  1VQK Z;  4S1T A;  2JA7 I;  4BY7 I;  4A3F I;  4Y52 I;  1P9N A;  1L1O C;  2IZ3 A;  5FLX b;  5T64 A;  1RNI A;  2M6N A;  2RPR A;  1JJ2 Z;  1NJI 1;  3PO3 S;  2K3R A;  1Q86 1;  2G2K A;  2VUM I;  3S15 I;  5AN9 F;  2VPY A;  3G6E 1;  1YJW Z;  3CCS Z;  2GTH A;  1X3Z A;  3PO3 I;  2JMO A;  3GTK I;  4TNU A;  2VPX A;  2Q51 A;  3H0G I;  3S16 I;  3K7A I;  1Q82 1;  1TWG I;  1VQ7 Z;  2V8J A;  4NBA A;  1KQS Y;  1JWH C;  1N8R 2;  4RS4 A;  4RVD A;  3I55 Z;  2R7Z I;  3HOX I;  1K9M 2;  2P28 A;  1FDI A;  2E9H A;  5D1O A;  3CPW Y;  2OTL 1;  1Q81 2;  3I56 Z;  4XX2 A;  2JA6 I;  1YJ9 Z;  2P3Y A;  4CL1 A;  2AKL A;  4NBE A;  1Q7Y 1;  2LFU A;  4NB8 A;  3MON A;  3CCL Z;  2EGT A;  3HOV I;  4A3K I;  3GTL I;  4MD7 A;  3H3V J;  5A2Q f;  4E2X A;  3GTQ I;  3CME Z;  1I6H I;  2V8K A;  4E30 A;  2RT9 A;  2E2H I;  2ZAE B;  1YUA A;  2NVT I;  1RO2 A;  3CCU 1;  4QTU A;  1WW9 A;  1KC8 2;  3CC4 1;  2NVQ I;  4MD9 A;  1VQO 1;  2E2J I;  4DQY B;  4A3D I;  1SFO I;  5IT9 f;  3F3P C;  2OZK A;  4MXU A;  3CCM 1;  3S2H I;  4BBS I;  3I07 A;  2QEX 1;  1YJN 1;  5C44 I;  3S2D I;  2KI7 B;  3NDJ A;  4MD8 A;  3CMA Z;  3CC7 1;  3CCE 1;  1ZB9 A;  2RBL A;  3NH4 A;  4NBB A;  1QYP A;  3CCV 1;  3I55 1;  1WZN A;  2Y0S A;  4DK1 A;  1VQ5 Z;  1W2B Y;  3GCF A;  1YI2 1;  1TWF I;  1VQ8 1;  3KIH A;  3M4O I;  3IR7 A;  3CCR 1;  2HU9 A;  3OW2 Z;  3FQQ A;  3JAM f;  1DL6 A;  3J81 b;  4BBR I;  5CM2 M;  3P5J B;  2BJO A;  3PO2 I;  2DE6 A;  1USP A;  1WII A;  2H85 A;  2KPI A;  1NUI A;  4NBC A;  1Q16 A;  3CCJ Z;  2PK7 A;  2J6A A;  2VPW A;  1S72 Z;  1K73 1;  1VQ5 1;  1I3Q I;  1Q7Y 2;  2WB1 A;  4NBD A;  1YI2 Z;  1VQM 1;  3G6E Z;  1WCM I;  3FKI I;  3EER A;  3GTJ I;  1M90 1;  3CCR Z;  2OOX B;  2VPZ A;  3I4N I;  1I50 I;  3T4N B;  2K5R A;  5C3E I;  3NH8 A;  3S1R I;  1Y1V S;  1LQL A;  1USP B;  4A3J I;  4BY1 I;  1YHQ Z;  3S1M I;  3CXC Y;  1JJ2 Y;  4E31 A;  2R6M A;  3IFU A;  4E33 A;  4MRI A;  4RVH A;  3TDH B;  2JIP A;  1ZB8 A;  3CC7 Z;  3CMA 1;  2JA8 I;  2O53 A;  3VB9 A;  3GTG I;  1M90 2;  3CCV Z;  1Z03 A;  3CD6 1;  3J80 b;  1QVG Z;  3D2L A;  1TWC I;  3NDI A;  3G71 Z;  3CC4 Z;  1VQ8 Z;  2W03 A;  2JR6 A;  3ESW A;  1VQO Z;  4A3G I;  4HGY A;  1VQ7 1;  5FLM I;  1NP6 A;  2YAD A;  1VQ6 Z;  3CCU Z;  1X0T A;  2JIO A;  2QEX Z;  5IP7 I;  2IV2 X;  2LEX A;  1QVF Z;  2R92 I;  1Q82 2;  4QTT A;  3CCQ 1;  2JS4 A;  3VMH A;  1VQM Z;  2HF1 A;  2JA5 I;  1K9M 1;  4X6A I; 
#chains in the Genus database with same CATH homology
 4DGL A;  1S7M A;  2RHB A;  4NBG A;  1VQ9 1;  4RVF A;  1NJI 2;  3CCE Z;  4MON A;  2QLV B;  1YIJ Z;  4E2Y A;  1QVF Y;  3FQM A;  4AYB A;  1K83 I;  2GU2 A;  2QKD A;  1YIT Z;  1VQP Z;  2QA4 Z;  3NFZ A;  4NBH A;  1Y1V I;  3RZD I;  2JNY A;  2M48 A;  1ZH1 A;  4NH1 C;  1KRL A;  3GTM I;  3CC2 1;  3OW2 Y;  1VQL Z;  3CQZ I;  1RO0 A;  2OTJ Z;  2NVX I;  1ML8 A;  3J81 f;  1N8R 1;  1K8A 1;  5D1O B;  3BG1 B;  4RVG A;  1YJW 1;  4HGZ A;  2F4M A;  3CCJ 1;  1VQN 1;  1N2F A;  5T67 A;  1KC8 1;  2RIQ A;  1S72 1;  3BG0 B;  3GTM S;  2QR1 B;  1RO4 A;  2QRE B;  1KD1 2;  3I4M I;  2PM9 A;  2GTI A;  4NOZ A;  4NB9 A;  1KD1 1;  4A3I I;  1RLY A;  4A3E I;  3EED A;  2PMZ A;  3G71 1;  1VLA A;  3MZL B;  2R93 I;  1Z02 A;  1YJ9 1;  1VQK 1;  1YHQ 1;  3CCQ Z;  1Q81 1;  1RQF A;  2VUG A;  3S1N I;  2JUB A;  3TE5 B;  2VF1 A;  3G4S 1;  5IT9 b;  2DE7 A;  3M3Y I;  4A93 I;  3CXC Z;  2W04 A;  5IP9 I;  4A3C I;  5FLX f;  3MZK B;  4A3M I;  4A3B I;  1VQ9 Z;  1YIT 1;  3CD6 Z;  1K8A 2;  3NH5 A;  2F4O A;  2WAQ A;  5A2Q b;  2DE5 A;  1VQ4 Z;  1YIJ 1;  2OTL Z;  4E32 A;  3VMI A;  4NBF A;  1QF8 A;  3D9X A;  2QA4 1;  1Q86 2;  5C4J I;  1Z01 A;  1M1K 1;  2OOY B;  3RZO I;  2I3C A;  1R9T I;  1PFT A;  4A3L I;  3S1Q I;  3CPW Z;  3HOW I;  1VQL 1;  3IX0 A;  1VQ6 1;  3VTN A;  3GKQ A;  1KQS Z;  2OTJ 1;  1TFI A;  3D6W A;  3F3F C;  3CCS 1;  3J80 f;  3VMG A;  1X3W A;  4MH4 A;  2LIY A;  4EWC A;  2YU9 I;  3S17 I;  3JAM b;  3S14 I;  1QVG Y;  3J7A 4;  1W2B Z;  3LUS A;  3GTP I;  2QRD B;  2V8I A;  5LL6 f;  4E2W A;  4Y7N I;  1VQP 1;  3HOY I;  3HKZ A;  1K73 2;  2O4H A;  3Q87 A;  1TWA I;  5D1P A;  3CCM Z;  2NVY I;  3I56 1;  2E2I I;  3IF8 A;  3CCL 1;  1YJN Z;  3U50 C;  1VQN Z;  3HOU I;  4NFR A;  1TWH I;  3HOZ I;  3G4S Z;  2IZ4 A;  4HH4 A;  3CC2 Z;  3CME 1;  5T6B A;  3KIF A;  5C4X I;  1Y1W I;  2QRC B;  2B63 I;  1M1K 2;  1VQ4 1;  4E2Z A;  4RV9 A;  4BXX I;  3GTO I;  1YUK A;  3QWU A;  2Q4Z A;  1VQK Z;  4S1T A;  2JA7 I;  4BY7 I;  4A3F I;  4Y52 I;  1P9N A;  1L1O C;  2IZ3 A;  5FLX b;  5T64 A;  1RNI A;  2M6N A;  2RPR A;  1JJ2 Z;  1NJI 1;  3PO3 S;  2K3R A;  1Q86 1;  2G2K A;  2VUM I;  3S15 I;  5AN9 F;  3G6E 1;  1YJW Z;  3CCS Z;  2GTH A;  1X3Z A;  3PO3 I;  2JMO A;  3GTK I;  4TNU A;  2Q51 A;  3H0G I;  3S16 I;  3K7A I;  1Q82 1;  1TWG I;  1VQ7 Z;  2V8J A;  4NBA A;  1KQS Y;  1JWH C;  1N8R 2;  4RS4 A;  4RVD A;  3I55 Z;  2R7Z I;  3HOX I;  1K9M 2;  2P28 A;  2E9H A;  3CPW Y;  5D1O A;  2OTL 1;  1Q81 2;  3I56 Z;  4XX2 A;  2JA6 I;  1YJ9 Z;  2P3Y A;  4CL1 A;  2AKL A;  4NBE A;  1Q7Y 1;  2LFU A;  4NB8 A;  3MON A;  3CCL Z;  2EGT A;  3HOV I;  4A3K I;  3GTL I;  4MD7 A;  3H3V J;  5A2Q f;  4E2X A;  3GTQ I;  3CME Z;  1I6H I;  2V8K A;  4E30 A;  2RT9 A;  2E2H I;  2ZAE B;  1YUA A;  2NVT I;  1RO2 A;  3CCU 1;  4QTU A;  1WW9 A;  1KC8 2;  3CC4 1;  2NVQ I;  4MD9 A;  1VQO 1;  2E2J I;  4DQY B;  4A3D I;  1SFO I;  5IT9 f;  3F3P C;  2OZK A;  4MXU A;  3CCM 1;  3S2H I;  4BBS I;  3I07 A;  2QEX 1;  1YJN 1;  5C44 I;  3S2D I;  2KI7 B;  3NDJ A;  4MD8 A;  3CMA Z;  3CC7 1;  3CCE 1;  1ZB9 A;  2RBL A;  3NH4 A;  4NBB A;  1QYP A;  3CCV 1;  3I55 1;  2Y0S A;  4DK1 A;  1VQ5 Z;  1W2B Y;  3GCF A;  1YI2 1;  1TWF I;  1VQ8 1;  3KIH A;  3M4O I;  3CCR 1;  2HU9 A;  3OW2 Z;  3FQQ A;  3JAM f;  1DL6 A;  3J81 b;  4BBR I;  5CM2 M;  3P5J B;  2BJO A;  3PO2 I;  2DE6 A;  1USP A;  1WII A;  2H85 A;  2KPI A;  1NUI A;  4NBC A;  3CCJ Z;  2PK7 A;  2J6A A;  1S72 Z;  1K73 1;  1VQ5 1;  1I3Q I;  1Q7Y 2;  2WB1 A;  4NBD A;  1YI2 Z;  1VQM 1;  3G6E Z;  1WCM I;  3FKI I;  3EER A;  3GTJ I;  1M90 1;  3CCR Z;  2OOX B;  3I4N I;  1I50 I;  3T4N B;  2K5R A;  5C3E I;  3NH8 A;  3S1R I;  1Y1V S;  1LQL A;  1USP B;  4A3J I;  4BY1 I;  1YHQ Z;  3S1M I;  3CXC Y;  1JJ2 Y;  4E31 A;  2R6M A;  3IFU A;  4E33 A;  4MRI A;  4RVH A;  3TDH B;  1ZB8 A;  3CC7 Z;  3CMA 1;  2JA8 I;  2O53 A;  3VB9 A;  3GTG I;  1M90 2;  3CCV Z;  1Z03 A;  3CD6 1;  3J80 b;  1QVG Z;  1TWC I;  3NDI A;  3G71 Z;  3CC4 Z;  1VQ8 Z;  2W03 A;  2JR6 A;  3ESW A;  1VQO Z;  4A3G I;  4HGY A;  1VQ7 1;  5FLM I;  1NP6 A;  2YAD A;  1VQ6 Z;  3CCU Z;  1X0T A;  2QEX Z;  5IP7 I;  1QVF Z;  2R92 I;  1Q82 2;  4QTT A;  3CCQ 1;  2JS4 A;  3VMH A;  1VQM Z;  2HF1 A;  2JA5 I;  1K9M 1;  4X6A I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...