3GTMI

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmI02
3S14I 4A3LI 3PO2I 4X6AI 4A3CI 1I50I 4QTTA 2AKLA 4NOZA 3HOZI 3VMGA 4BY7I 2P3YA 1TWAI 2J6AA 3GCFA 3GTJI 1TWGI 2DE7A 3K7AI 1R9TI 2HF1A 4NBFA 1Y1WI 4NBHA 4A3FI 3GTKI 3GTOI 4NB8A 3VB9A 3EERA 4BBSI 1RO4A 2JA6I 1TWFI 3GTMS 4NBDA 5CM2M 3S1MI 4A3BI 3S1NI 2JA8I 4A3DI 3S15I 3VMHA 3HOVI 1USPB 3GTLI 3Q87A 3GKQA 3S16I 3HOWI 1I6HI 3HOUI 2E2II 2E2HI 3RZDI 2BJOA 3GTQI 3CQZI 4A93I 1ZB8A 2KPIA 3GTGI 4NBBA 1N2FA 5IP7I 2YU9I 3PO3I 2K5RA 3GTMI 2E2JI 1SFOI 2JR6A 5C44I 1ML8A 1WCMI 1I3QI 1YUAA 2F4MA 3FKII 3I07A 1X3WA 4BXXI 2NVXI 2JNYA 2R93I 4MH4A 4A3KI 2JA5I 5C4XI 1TWCI 4A3EI 5FLMI 3S1QI 1TFIA 3S2HI 3RZOI 4A3JI 3M3YI 1QYPA 2F4OA 1RLYA 4Y7NI 3I4NI 3I4MI 3U50C 3S17I 4NBGA 4Y52I 1WW9A 1LQLA 2JS4A 4NBEA 4A3MI 4NBCA 4NB9A 3HOXI 4BY1I 3VMIA 3HOYI 1Y1VI 4NBAA 3H0GI 2R92I 2B63I 3D6WA 2DE5A 2NVQI 3H3VJ 3M4OI 2R7ZI 1DL6A 1PFTA 4A3II 5C4JI 1X3ZA 1TWHI 3PO3S 1NUIA 3GTPI 3S2DI 4QTUA 5IP9I 1K83I 4A3GI 1L1OC 1Y1VS 3ESWA 2JA7I 5C3EI 2DE6A 2RBLA 2VUMI 1ZB9A 1USPA 1VLAA 4XX2A 4BBRI 3S1RI 2NVYI 2PK7A 2NVTI 3LUSA
chains in the Genus database with same CATH superfamily
3IFUA 4TNUA 1VQ8Z 3CPWY 1I50I 4QTTA 3CCVZ 2AKLA 4NOZA 3G711 4BY7I 1KC81 1M901 1VQOZ 2V3VA 3CCQZ 3CCQ1 1WZNA 1VQN1 3GTOI 4NBHA 4MD9A 4NB8A 3CCV1 3EERA 2QR1B 2IV2X 1YJWZ 4MD7A 3I551 2QA4Z 3CCS1 2P28A 3GTMS 4NBDA 5CM2M 2QEX1 1QVFY 1K732 3NFZA 3S1MI 1VQ71 5FLXb 2LFUA 2QKDA 3VMHA 1VQPZ 3IX0A 4HH4A 1YITZ 2OTL1 1Q7Y1 4E30A 1VQLZ 1AA6A 1X0TA 2BJOA 2QA41 3CCJ1 1KD12 5T67A 1JJ2Y 1KD11 2W03A 1N8R2 1KRLA 2JIQA 3GTMI 2RHBA 5C44I 3FQMA 1YUAA 1S721 2I3CA 2JMOA 4BXXI 4EWCA 1Q861 3G71Z 2R93I 4MH4A 5D1OA 3CC41 5IT9f 4Y7NI 1RNIA 2JUBA 2RT9A 4Y52I 1NJI2 2V45A 1SIWA 3CCLZ 4MONA 4NB9A 3VMIA 1Y1VI 4NBAA 2DE5A 2NVQI 2ZAEB 2OTLZ 4MD8A 1DL6A 3P5JB 1X3ZA 3G4SZ 2M48A 1NUIA 4DK1A 3J81b 1VQ91 3F3PC 1K83I 2E9HA 5AN9F 1VQ4Z 3CCEZ 2QREB 1YJW1 4RVFA 3CC2Z 3MZLB 3CXCY 2PK7A 4E33A 2EGTA 3S14I 2GTIA 3PO2I 2Q51A 4A3CI 2RPRA 1VQO1 1WJ2A 2P3YA 2VPYA 1M1K1 2J6AA 3NDJA 3J81f 2VPWA 4RV9A 1Q7Y2 5D1PA 1FDIA 2O4HA 1S7MA 1YUKA 1Y1WI 4A3FI 4RS4A 1YJN1 3VB9A 2H85A 4BBSI 2GTHA 2OZKA 3CCE1 3D2LA 4NFRA 1VQM1 4DGLA 4RVDA 2OTJ1 2JIOA 2VUGA 1K9M2 5T64A 1VQ9Z 1Q862 4E2YA 3S1NI 3S15I 1RO0A 1USPB 3GTLI 3Q87A 2O53A 2VF1A 1M902 3JAMf 2E2II 1YJ91 3GTQI 3CQZI 4A93I 1NJI1 1NP6A 4NBBA 5IP7I 1YHQ1 1YIT1 1K8A1 4E32A 2JR6A 1K731 1WCMI 2LEXA 2KI7B 1VQ7Z 3I07A 4E2ZA 1FDOA 3CCR1 3IR7A 2JNYA 2YADA 2JA5I 5T6BA 5C4XI 1TWCI 3I55Z 3BG1B 3CPWZ 2Y0SA 1VQNZ 3NH5A 3TE5B 1QF8A 4NBCA 2W04A 1VQ81 3HOYI 2QLVB 1JWHC 1YHQZ 2V8IA 3G6EZ 3G6E1 3M4OI 2E7ZA 1QVGY 4A3II 5C4JI 1VQ5Z 1JJ2Z 1YI21 4S1TA 1YJ9Z 1P9NA 3CCUZ 1Q811 4QTUA 2V8KA 2VPZA 4A3GI 4RVGA 2QEXZ 1L1OC 2JA7I 2DE6A 3CCSZ 1N8R1 1USPA 4XX2A 3S1RI 1KQSZ 2NVYI 2NVTI 1Z02A 5A2Qb 2LIYA 5LL6f 1W2BZ 2G2KA 4MRIA 1YJNZ 3FQQA 1TWAI 4RVHA 1VQ61 2HF1A 4NBFA 2JIMA 4DQYB 3CMAZ 2JA6I 1Q821 4E2WA 2VPXA 3VTNA 3EEDA 3CD6Z 4A3DI 2RIQA 2OOXB 1VQ41 1M1K2 3D9XA 3S16I 3HOUI 2E2HI 1WIIA 1W2BY 3I561 3CMEZ 1N2FA 2YU9I 2K5RA 1SFOI 1ML8A 1YIJ1 2F4MA 4NH1C 1VQK1 2NVXI 2V8JA 4A3KI 3TDHB 4E2XA 3S1QI 3HKZA 3RZOI 3CC4Z 1ZH1A 1RLYA 3I4MI 1VQ6Z 3U50C 1YIJZ 4NBGA 1RQFA 4HGYA 2Q4ZA 1WW9A 3NH8A 3CCRZ 1Y8CA 1S72Z 2JS4A 4A3MI 2OOYB 5D1OB 4BY1I 1Z01A 2IZ3A 1VQ51 3H0GI 2R92I 3IF8A 3NH4A 4E31A 2R7ZI 1KC82 3BG0B 1PFTA 3OW2Z 2QRCB 1VQL1 2JIPA 3GTPI 2PMZA 3QWUA 3T4NB 3CXCZ 3CCL1 3CCU1 1VQP1 3ESWA 5C3EI 1YI2Z 2VUMI 2WAQA 1Q822 3CMA1 3KIFA 1VLAA 4BBRI 1K8A2 3MZKB 4A3LI 4X6AI 5IT9b 2JIRA 3J7A4 3HOZI 3VMGA 3GCFA 3GTJI 1TWGI 2DE7A 3K7AI 1R9TI 3GTKI 1RO4A 2PM9A 1TWFI 1K9M1 4A3BI 2QRDB 3CC21 2JA8I 3HOVI 5A2Qf 2K3RA 2R6MA 3GKQA 3HOWI 3CME1 1I6HI 2M6NA 3I56Z 1VQMZ 5FLXf 3RZDI 4CL1A 3J80f 4AYBA 1KQSY 1ZB8A 2KPIA 3GTGI 3KIHA 3CCM1 3PO3I 2E2JI 1I3QI 3FKII 3CC71 1X3WA 1QXFA 4A3EI 5FLMI 1TFIA 3S2HI 4A3JI 3M3YI 1QYPA 2F4OA 3I4NI 3NDIA 1VQKZ 3S17I 3J80b 2HU9A 4MXUA 1LQLA 2IZ4A 3CC7Z 4NBEA 3HOXI 2GU2A 3F3FC 3CCMZ 3OW2Y 2B63I 3D6WA 3H3VJ 2AYDA 3MONA 3CCJZ 4HGZA 1TWHI 3JAMb 3PO3S 1Q812 3CD61 3S2DI 1QVFZ 2NAPA 5IP9I 1Z03A 2WB1A 1QVGZ 2OTJZ 1Y1VS 2RBLA 3G4S1 1Q16A 1ZB9A 1RO2A 3LUSA
chains in the Genus database with same CATH topology
3IFUA 4TNUA 1VQ8Z 3CPWY 1I50I 4QTTA 3CCVZ 2AKLA 4NOZA 3G711 4BY7I 1KC81 1M901 1VQOZ 3CCQZ 3CCQ1 1VQN1 3GTOI 4NBHA 4MD9A 4NB8A 3CCV1 3EERA 2QR1B 1YJWZ 4MD7A 3I551 2QA4Z 3CCS1 2P28A 3GTMS 4NBDA 5CM2M 2QEX1 1QVFY 1K732 3NFZA 3S1MI 1VQ71 5FLXb 2LFUA 2QKDA 3VMHA 1VQPZ 3IX0A 4HH4A 1YITZ 2OTL1 1Q7Y1 4E30A 1VQLZ 1X0TA 2BJOA 2QA41 3CCJ1 1KD12 5T67A 1JJ2Y 1KD11 2W03A 1N8R2 1KRLA 3GTMI 2RHBA 5C44I 3FQMA 1YUAA 1S721 2I3CA 2JMOA 4BXXI 4EWCA 1Q861 3G71Z 2R93I 4MH4A 5D1OA 3CC41 5IT9f 4Y7NI 1RNIA 2JUBA 2RT9A 4Y52I 1NJI2 3CCLZ 4MONA 4NB9A 3VMIA 1Y1VI 4NBAA 2DE5A 2NVQI 2ZAEB 2OTLZ 4MD8A 1DL6A 3P5JB 1X3ZA 3G4SZ 2M48A 1NUIA 4DK1A 3J81b 1VQ91 3F3PC 1K83I 2E9HA 5AN9F 1VQ4Z 3CCEZ 2QREB 1YJW1 4RVFA 3CC2Z 3MZLB 3CXCY 2PK7A 4E33A 2EGTA 3S14I 2GTIA 3PO2I 2Q51A 4A3CI 2RPRA 1VQO1 2P3YA 1M1K1 2J6AA 3NDJA 3J81f 4RV9A 1Q7Y2 5D1PA 2O4HA 1S7MA 1YUKA 1Y1WI 4A3FI 4RS4A 1YJN1 3VB9A 2H85A 4BBSI 2GTHA 2OZKA 3CCE1 4NFRA 1VQM1 4DGLA 4RVDA 2OTJ1 2VUGA 1K9M2 5T64A 1VQ9Z 1Q862 4E2YA 3S1NI 3S15I 1RO0A 1USPB 3GTLI 3Q87A 2O53A 2VF1A 1M902 3JAMf 2E2II 1YJ91 3GTQI 3CQZI 4A93I 1NJI1 1NP6A 4NBBA 5IP7I 1YHQ1 1YIT1 1K8A1 4E32A 2JR6A 1K731 1WCMI 2KI7B 1VQ7Z 3I07A 4E2ZA 3CCR1 2JNYA 2YADA 2JA5I 5T6BA 5C4XI 1TWCI 3I55Z 3BG1B 3CPWZ 2Y0SA 1VQNZ 3NH5A 3TE5B 1QF8A 4NBCA 2W04A 1VQ81 3HOYI 2QLVB 1JWHC 1YHQZ 2V8IA 3G6EZ 3G6E1 3M4OI 1QVGY 4A3II 5C4JI 1VQ5Z 1JJ2Z 1YI21 4S1TA 1YJ9Z 1P9NA 3CCUZ 1Q811 4QTUA 2V8KA 4A3GI 4RVGA 2QEXZ 1L1OC 2JA7I 2DE6A 3CCSZ 1N8R1 1USPA 4XX2A 3S1RI 1KQSZ 2NVYI 2NVTI 1Z02A 5A2Qb 2LIYA 5LL6f 1W2BZ 2G2KA 4MRIA 1YJNZ 3FQQA 1TWAI 4RVHA 1VQ61 2HF1A 4NBFA 4DQYB 3CMAZ 2JA6I 1Q821 4E2WA 3VTNA 3EEDA 3CD6Z 4A3DI 2RIQA 2OOXB 1VQ41 1M1K2 3D9XA 3S16I 3HOUI 2E2HI 1WIIA 1W2BY 3I561 3CMEZ 1N2FA 2YU9I 2K5RA 1SFOI 1ML8A 1YIJ1 2F4MA 4NH1C 1VQK1 2NVXI 2V8JA 4A3KI 3TDHB 4E2XA 3S1QI 3HKZA 3RZOI 3CC4Z 1ZH1A 1RLYA 3I4MI 1VQ6Z 3U50C 1YIJZ 4NBGA 1RQFA 4HGYA 2Q4ZA 1WW9A 3NH8A 3CCRZ 1S72Z 2JS4A 4A3MI 2OOYB 5D1OB 4BY1I 1Z01A 2IZ3A 1VQ51 3H0GI 2R92I 3IF8A 3NH4A 4E31A 2R7ZI 1KC82 3BG0B 1PFTA 3OW2Z 2QRCB 1VQL1 3GTPI 2PMZA 3QWUA 3T4NB 3CXCZ 3CCL1 3CCU1 1VQP1 3ESWA 5C3EI 1YI2Z 2VUMI 2WAQA 1Q822 3CMA1 3KIFA 1VLAA 4BBRI 1K8A2 3MZKB 4A3LI 4X6AI 5IT9b 3J7A4 3HOZI 3VMGA 3GCFA 3GTJI 1TWGI 2DE7A 3K7AI 1R9TI 3GTKI 1RO4A 2PM9A 1TWFI 1K9M1 4A3BI 2QRDB 3CC21 2JA8I 3HOVI 5A2Qf 2K3RA 2R6MA 3GKQA 3HOWI 3CME1 1I6HI 2M6NA 3I56Z 1VQMZ 5FLXf 3RZDI 4CL1A 3J80f 4AYBA 1KQSY 1ZB8A 2KPIA 3GTGI 3KIHA 3CCM1 3PO3I 2E2JI 1I3QI 3FKII 3CC71 1X3WA 4A3EI 5FLMI 1TFIA 3S2HI 4A3JI 3M3YI 1QYPA 2F4OA 3I4NI 3NDIA 1VQKZ 3S17I 3J80b 2HU9A 4MXUA 1LQLA 2IZ4A 3CC7Z 4NBEA 3HOXI 2GU2A 3F3FC 3CCMZ 3OW2Y 2B63I 3D6WA 3H3VJ 3MONA 3CCJZ 4HGZA 1TWHI 3JAMb 3PO3S 1Q812 3CD61 3S2DI 1QVFZ 5IP9I 1Z03A 1QVGZ 2WB1A 2OTJZ 1Y1VS 2RBLA 3G4S1 1ZB9A 1RO2A 3LUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 I;  4A3L I;  3PO2 I;  4X6A I;  4A3C I;  1I50 I;  4QTT A;  2AKL A;  4NOZ A;  3HOZ I;  3VMG A;  4BY7 I;  2P3Y A;  1TWA I;  2J6A A;  3GCF A;  3GTJ I;  1TWG I;  2DE7 A;  3K7A I;  1R9T I;  2HF1 A;  4NBF A;  1Y1W I;  4NBH A;  4A3F I;  3GTK I;  3GTO I;  4NB8 A;  3VB9 A;  3EER A;  4BBS I;  1RO4 A;  2JA6 I;  1TWF I;  3GTM S;  4NBD A;  5CM2 M;  3S1M I;  4A3B I;  3S1N I;  2JA8 I;  4A3D I;  3S15 I;  3VMH A;  3HOV I;  1USP B;  3GTL I;  3Q87 A;  3GKQ A;  3S16 I;  3HOW I;  1I6H I;  3HOU I;  2E2I I;  2E2H I;  3RZD I;  2BJO A;  3GTQ I;  3CQZ I;  4A93 I;  1ZB8 A;  2KPI A;  3GTG I;  4NBB A;  1N2F A;  5IP7 I;  2YU9 I;  3PO3 I;  2K5R A;  3GTM I;  2E2J I;  1SFO I;  2JR6 A;  5C44 I;  1ML8 A;  1WCM I;  1I3Q I;  1YUA A;  2F4M A;  3FKI I;  3I07 A;  1X3W A;  4BXX I;  2NVX I;  2JNY A;  2R93 I;  4MH4 A;  4A3K I;  2JA5 I;  5C4X I;  1TWC I;  4A3E I;  5FLM I;  3S1Q I;  1TFI A;  3S2H I;  3RZO I;  4A3J I;  3M3Y I;  1QYP A;  2F4O A;  1RLY A;  4Y7N I;  3I4N I;  3I4M I;  3U50 C;  3S17 I;  4NBG A;  4Y52 I;  1WW9 A;  1LQL A;  2JS4 A;  4NBE A;  4A3M I;  4NBC A;  4NB9 A;  3HOX I;  4BY1 I;  3VMI A;  3HOY I;  1Y1V I;  4NBA A;  3H0G I;  2R92 I;  2B63 I;  3D6W A;  2DE5 A;  2NVQ I;  3H3V J;  3M4O I;  2R7Z I;  1DL6 A;  1PFT A;  4A3I I;  5C4J I;  1X3Z A;  1TWH I;  3PO3 S;  1NUI A;  3GTP I;  3S2D I;  4QTU A;  5IP9 I;  1K83 I;  4A3G I;  1L1O C;  1Y1V S;  3ESW A;  2JA7 I;  5C3E I;  2DE6 A;  2RBL A;  2VUM I;  1ZB9 A;  1USP A;  1VLA A;  4XX2 A;  4BBR I;  3S1R I;  2NVY I;  2PK7 A;  2NVT I;  3LUS A; 
#chains in the Genus database with same CATH topology
 3IFU A;  4TNU A;  1VQ8 Z;  3CPW Y;  1I50 I;  4QTT A;  3CCV Z;  2AKL A;  4NOZ A;  3G71 1;  4BY7 I;  1KC8 1;  1M90 1;  1VQO Z;  2V3V A;  3CCQ Z;  3CCQ 1;  1WZN A;  1VQN 1;  3GTO I;  4NBH A;  4MD9 A;  4NB8 A;  3CCV 1;  3EER A;  2QR1 B;  2IV2 X;  1YJW Z;  4MD7 A;  3I55 1;  2QA4 Z;  3CCS 1;  2P28 A;  3GTM S;  4NBD A;  5CM2 M;  2QEX 1;  1QVF Y;  1K73 2;  3NFZ A;  3S1M I;  1VQ7 1;  5FLX b;  2LFU A;  2QKD A;  3VMH A;  1VQP Z;  3IX0 A;  4HH4 A;  1YIT Z;  2OTL 1;  1Q7Y 1;  4E30 A;  1VQL Z;  1AA6 A;  1X0T A;  2BJO A;  2QA4 1;  3CCJ 1;  1KD1 2;  5T67 A;  1JJ2 Y;  1KD1 1;  2W03 A;  1N8R 2;  1KRL A;  2JIQ A;  3GTM I;  2RHB A;  5C44 I;  3FQM A;  1YUA A;  1S72 1;  2I3C A;  2JMO A;  4BXX I;  4EWC A;  1Q86 1;  3G71 Z;  2R93 I;  4MH4 A;  5D1O A;  3CC4 1;  5IT9 f;  4Y7N I;  1RNI A;  2JUB A;  2RT9 A;  4Y52 I;  1NJI 2;  2V45 A;  1SIW A;  3CCL Z;  4MON A;  4NB9 A;  3VMI A;  1Y1V I;  4NBA A;  2DE5 A;  2NVQ I;  2ZAE B;  2OTL Z;  4MD8 A;  1DL6 A;  3P5J B;  1X3Z A;  3G4S Z;  2M48 A;  1NUI A;  4DK1 A;  3J81 b;  1VQ9 1;  3F3P C;  1K83 I;  2E9H A;  5AN9 F;  1VQ4 Z;  3CCE Z;  2QRE B;  1YJW 1;  4RVF A;  3CC2 Z;  3MZL B;  3CXC Y;  2PK7 A;  4E33 A;  2EGT A;  3S14 I;  2GTI A;  3PO2 I;  2Q51 A;  4A3C I;  2RPR A;  1VQO 1;  1WJ2 A;  2P3Y A;  2VPY A;  1M1K 1;  2J6A A;  3NDJ A;  3J81 f;  2VPW A;  4RV9 A;  1Q7Y 2;  5D1P A;  1FDI A;  2O4H A;  1S7M A;  1YUK A;  1Y1W I;  4A3F I;  4RS4 A;  1YJN 1;  3VB9 A;  2H85 A;  4BBS I;  2GTH A;  2OZK A;  3CCE 1;  3D2L A;  4NFR A;  1VQM 1;  4DGL A;  4RVD A;  2OTJ 1;  2JIO A;  2VUG A;  1K9M 2;  5T64 A;  1VQ9 Z;  1Q86 2;  4E2Y A;  3S1N I;  3S15 I;  1RO0 A;  1USP B;  3GTL I;  3Q87 A;  2O53 A;  2VF1 A;  1M90 2;  3JAM f;  2E2I I;  1YJ9 1;  3GTQ I;  3CQZ I;  4A93 I;  1NJI 1;  1NP6 A;  4NBB A;  5IP7 I;  1YHQ 1;  1YIT 1;  1K8A 1;  4E32 A;  2JR6 A;  1K73 1;  1WCM I;  2LEX A;  2KI7 B;  1VQ7 Z;  3I07 A;  4E2Z A;  1FDO A;  3CCR 1;  3IR7 A;  2JNY A;  2YAD A;  2JA5 I;  5T6B A;  5C4X I;  1TWC I;  3I55 Z;  3BG1 B;  3CPW Z;  2Y0S A;  1VQN Z;  3NH5 A;  3TE5 B;  1QF8 A;  4NBC A;  2W04 A;  1VQ8 1;  3HOY I;  2QLV B;  1JWH C;  1YHQ Z;  2V8I A;  3G6E Z;  3G6E 1;  3M4O I;  2E7Z A;  1QVG Y;  4A3I I;  5C4J I;  1VQ5 Z;  1JJ2 Z;  1YI2 1;  4S1T A;  1YJ9 Z;  1P9N A;  3CCU Z;  1Q81 1;  4QTU A;  2V8K A;  2VPZ A;  4A3G I;  4RVG A;  2QEX Z;  1L1O C;  2JA7 I;  2DE6 A;  3CCS Z;  1N8R 1;  1USP A;  4XX2 A;  3S1R I;  1KQS Z;  2NVY I;  2NVT I;  1Z02 A;  5A2Q b;  2LIY A;  5LL6 f;  1W2B Z;  2G2K A;  4MRI A;  1YJN Z;  3FQQ A;  1TWA I;  4RVH A;  1VQ6 1;  2HF1 A;  4NBF A;  2JIM A;  4DQY B;  3CMA Z;  2JA6 I;  1Q82 1;  4E2W A;  2VPX A;  3VTN A;  3EED A;  3CD6 Z;  4A3D I;  2RIQ A;  2OOX B;  1VQ4 1;  1M1K 2;  3D9X A;  3S16 I;  3HOU I;  2E2H I;  1WII A;  1W2B Y;  3I56 1;  3CME Z;  1N2F A;  2YU9 I;  2K5R A;  1SFO I;  1ML8 A;  1YIJ 1;  2F4M A;  4NH1 C;  1VQK 1;  2NVX I;  2V8J A;  4A3K I;  3TDH B;  4E2X A;  3S1Q I;  3HKZ A;  3RZO I;  3CC4 Z;  1ZH1 A;  1RLY A;  3I4M I;  1VQ6 Z;  3U50 C;  1YIJ Z;  4NBG A;  1RQF A;  4HGY A;  2Q4Z A;  1WW9 A;  3NH8 A;  3CCR Z;  1Y8C A;  1S72 Z;  2JS4 A;  4A3M I;  2OOY B;  5D1O B;  4BY1 I;  1Z01 A;  2IZ3 A;  1VQ5 1;  3H0G I;  2R92 I;  3IF8 A;  3NH4 A;  4E31 A;  2R7Z I;  1KC8 2;  3BG0 B;  1PFT A;  3OW2 Z;  2QRC B;  1VQL 1;  2JIP A;  3GTP I;  2PMZ A;  3QWU A;  3T4N B;  3CXC Z;  3CCL 1;  3CCU 1;  1VQP 1;  3ESW A;  5C3E I;  1YI2 Z;  2VUM I;  2WAQ A;  1Q82 2;  3CMA 1;  3KIF A;  1VLA A;  4BBR I;  1K8A 2;  3MZK B;  4A3L I;  4X6A I;  5IT9 b;  2JIR A;  3J7A 4;  3HOZ I;  3VMG A;  3GCF A;  3GTJ I;  1TWG I;  2DE7 A;  3K7A I;  1R9T I;  3GTK I;  1RO4 A;  2PM9 A;  1TWF I;  1K9M 1;  4A3B I;  2QRD B;  3CC2 1;  2JA8 I;  3HOV I;  5A2Q f;  2K3R A;  2R6M A;  3GKQ A;  3HOW I;  3CME 1;  1I6H I;  2M6N A;  3I56 Z;  1VQM Z;  5FLX f;  3RZD I;  4CL1 A;  3J80 f;  4AYB A;  1KQS Y;  1ZB8 A;  2KPI A;  3GTG I;  3KIH A;  3CCM 1;  3PO3 I;  2E2J I;  1I3Q I;  3FKI I;  3CC7 1;  1X3W A;  1QXF A;  4A3E I;  5FLM I;  1TFI A;  3S2H I;  4A3J I;  3M3Y I;  1QYP A;  2F4O A;  3I4N I;  3NDI A;  1VQK Z;  3S17 I;  3J80 b;  2HU9 A;  4MXU A;  1LQL A;  2IZ4 A;  3CC7 Z;  4NBE A;  3HOX I;  2GU2 A;  3F3F C;  3CCM Z;  3OW2 Y;  2B63 I;  3D6W A;  3H3V J;  2AYD A;  3MON A;  3CCJ Z;  4HGZ A;  1TWH I;  3JAM b;  3PO3 S;  1Q81 2;  3CD6 1;  3S2D I;  1QVF Z;  2NAP A;  5IP9 I;  1Z03 A;  2WB1 A;  1QVG Z;  2OTJ Z;  1Y1V S;  2RBL A;  3G4S 1;  1Q16 A;  1ZB9 A;  1RO2 A;  3LUS A; 
#chains in the Genus database with same CATH homology
 3IFU A;  4TNU A;  1VQ8 Z;  3CPW Y;  1I50 I;  4QTT A;  3CCV Z;  2AKL A;  4NOZ A;  3G71 1;  4BY7 I;  1KC8 1;  1M90 1;  1VQO Z;  3CCQ Z;  3CCQ 1;  1VQN 1;  3GTO I;  4NBH A;  4MD9 A;  4NB8 A;  3CCV 1;  3EER A;  2QR1 B;  1YJW Z;  4MD7 A;  3I55 1;  2QA4 Z;  3CCS 1;  2P28 A;  3GTM S;  4NBD A;  5CM2 M;  2QEX 1;  1QVF Y;  1K73 2;  3NFZ A;  3S1M I;  1VQ7 1;  5FLX b;  2LFU A;  2QKD A;  3VMH A;  1VQP Z;  3IX0 A;  4HH4 A;  1YIT Z;  2OTL 1;  1Q7Y 1;  4E30 A;  1VQL Z;  1X0T A;  2BJO A;  2QA4 1;  3CCJ 1;  1KD1 2;  5T67 A;  1JJ2 Y;  1KD1 1;  2W03 A;  1N8R 2;  1KRL A;  3GTM I;  2RHB A;  5C44 I;  3FQM A;  1YUA A;  1S72 1;  2I3C A;  2JMO A;  4BXX I;  4EWC A;  1Q86 1;  3G71 Z;  2R93 I;  4MH4 A;  5D1O A;  3CC4 1;  5IT9 f;  4Y7N I;  1RNI A;  2JUB A;  2RT9 A;  4Y52 I;  1NJI 2;  3CCL Z;  4MON A;  4NB9 A;  3VMI A;  1Y1V I;  4NBA A;  2DE5 A;  2NVQ I;  2ZAE B;  2OTL Z;  4MD8 A;  1DL6 A;  3P5J B;  1X3Z A;  3G4S Z;  2M48 A;  1NUI A;  4DK1 A;  3J81 b;  1VQ9 1;  3F3P C;  1K83 I;  2E9H A;  5AN9 F;  1VQ4 Z;  3CCE Z;  2QRE B;  1YJW 1;  4RVF A;  3CC2 Z;  3MZL B;  3CXC Y;  2PK7 A;  4E33 A;  2EGT A;  3S14 I;  2GTI A;  3PO2 I;  2Q51 A;  4A3C I;  2RPR A;  1VQO 1;  2P3Y A;  1M1K 1;  2J6A A;  3NDJ A;  3J81 f;  4RV9 A;  1Q7Y 2;  5D1P A;  2O4H A;  1S7M A;  1YUK A;  1Y1W I;  4A3F I;  4RS4 A;  1YJN 1;  3VB9 A;  2H85 A;  4BBS I;  2GTH A;  2OZK A;  3CCE 1;  4NFR A;  1VQM 1;  4DGL A;  4RVD A;  2OTJ 1;  2VUG A;  1K9M 2;  5T64 A;  1VQ9 Z;  1Q86 2;  4E2Y A;  3S1N I;  3S15 I;  1RO0 A;  1USP B;  3GTL I;  3Q87 A;  2O53 A;  2VF1 A;  1M90 2;  3JAM f;  2E2I I;  1YJ9 1;  3GTQ I;  3CQZ I;  4A93 I;  1NJI 1;  1NP6 A;  4NBB A;  5IP7 I;  1YHQ 1;  1YIT 1;  1K8A 1;  4E32 A;  2JR6 A;  1K73 1;  1WCM I;  2KI7 B;  1VQ7 Z;  3I07 A;  4E2Z A;  3CCR 1;  2JNY A;  2YAD A;  2JA5 I;  5T6B A;  5C4X I;  1TWC I;  3I55 Z;  3BG1 B;  3CPW Z;  2Y0S A;  1VQN Z;  3NH5 A;  3TE5 B;  1QF8 A;  4NBC A;  2W04 A;  1VQ8 1;  3HOY I;  2QLV B;  1JWH C;  1YHQ Z;  2V8I A;  3G6E Z;  3G6E 1;  3M4O I;  1QVG Y;  4A3I I;  5C4J I;  1VQ5 Z;  1JJ2 Z;  1YI2 1;  4S1T A;  1YJ9 Z;  1P9N A;  3CCU Z;  1Q81 1;  4QTU A;  2V8K A;  4A3G I;  4RVG A;  2QEX Z;  1L1O C;  2JA7 I;  2DE6 A;  3CCS Z;  1N8R 1;  1USP A;  4XX2 A;  3S1R I;  1KQS Z;  2NVY I;  2NVT I;  1Z02 A;  5A2Q b;  2LIY A;  5LL6 f;  1W2B Z;  2G2K A;  4MRI A;  1YJN Z;  3FQQ A;  1TWA I;  4RVH A;  1VQ6 1;  2HF1 A;  4NBF A;  4DQY B;  3CMA Z;  2JA6 I;  1Q82 1;  4E2W A;  3VTN A;  3EED A;  3CD6 Z;  4A3D I;  2RIQ A;  2OOX B;  1VQ4 1;  1M1K 2;  3D9X A;  3S16 I;  3HOU I;  2E2H I;  1WII A;  1W2B Y;  3I56 1;  3CME Z;  1N2F A;  2YU9 I;  2K5R A;  1SFO I;  1ML8 A;  1YIJ 1;  2F4M A;  4NH1 C;  1VQK 1;  2NVX I;  2V8J A;  4A3K I;  3TDH B;  4E2X A;  3S1Q I;  3HKZ A;  3RZO I;  3CC4 Z;  1ZH1 A;  1RLY A;  3I4M I;  1VQ6 Z;  3U50 C;  1YIJ Z;  4NBG A;  1RQF A;  4HGY A;  2Q4Z A;  1WW9 A;  3NH8 A;  3CCR Z;  1S72 Z;  2JS4 A;  4A3M I;  2OOY B;  5D1O B;  4BY1 I;  1Z01 A;  2IZ3 A;  1VQ5 1;  3H0G I;  2R92 I;  3IF8 A;  3NH4 A;  4E31 A;  2R7Z I;  1KC8 2;  3BG0 B;  1PFT A;  3OW2 Z;  2QRC B;  1VQL 1;  3GTP I;  2PMZ A;  3QWU A;  3T4N B;  3CXC Z;  3CCL 1;  3CCU 1;  1VQP 1;  3ESW A;  5C3E I;  1YI2 Z;  2VUM I;  2WAQ A;  1Q82 2;  3CMA 1;  3KIF A;  1VLA A;  4BBR I;  1K8A 2;  3MZK B;  4A3L I;  4X6A I;  5IT9 b;  3J7A 4;  3HOZ I;  3VMG A;  3GCF A;  3GTJ I;  1TWG I;  2DE7 A;  3K7A I;  1R9T I;  3GTK I;  1RO4 A;  2PM9 A;  1TWF I;  1K9M 1;  4A3B I;  2QRD B;  3CC2 1;  2JA8 I;  3HOV I;  5A2Q f;  2K3R A;  2R6M A;  3GKQ A;  3HOW I;  3CME 1;  1I6H I;  2M6N A;  3I56 Z;  1VQM Z;  5FLX f;  3RZD I;  4CL1 A;  3J80 f;  4AYB A;  1KQS Y;  1ZB8 A;  2KPI A;  3GTG I;  3KIH A;  3CCM 1;  3PO3 I;  2E2J I;  1I3Q I;  3FKI I;  3CC7 1;  1X3W A;  4A3E I;  5FLM I;  1TFI A;  3S2H I;  4A3J I;  3M3Y I;  1QYP A;  2F4O A;  3I4N I;  3NDI A;  1VQK Z;  3S17 I;  3J80 b;  2HU9 A;  4MXU A;  1LQL A;  2IZ4 A;  3CC7 Z;  4NBE A;  3HOX I;  2GU2 A;  3F3F C;  3CCM Z;  3OW2 Y;  2B63 I;  3D6W A;  3H3V J;  3MON A;  3CCJ Z;  4HGZ A;  1TWH I;  3JAM b;  3PO3 S;  1Q81 2;  3CD6 1;  3S2D I;  1QVF Z;  5IP9 I;  1Z03 A;  1QVG Z;  2WB1 A;  2OTJ Z;  1Y1V S;  2RBL A;  3G4S 1;  1ZB9 A;  1RO2 A;  3LUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...