3HOUI

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3houI02
2JA6I 2JNYA 2F4OA 4MH4A 2BJOA 2NVQI 5C4XI 4NBCA 1WCMI 4QTUA 2DE5A 5FLMI 3VMIA 2YU9I 3ESWA 1Y1WI 5C3EI 1K83I 1Y1VI 2VUMI 1R9TI 2E2JI 4A93I 1L1OC 5CM2M 3PO2I 1WW9A 3VB9A 1USPA 4A3DI 2JA5I 2DE7A 4NBGA 2RBLA 4BBRI 1NUIA 2JS4A 4Y52I 3GTKI 2KPIA 3U50C 3S1QI 1I6HI 4NB9A 3I4NI 3EERA 1Y1VS 1USPB 3GTMI 1ZB9A 2R7ZI 3HOVI 2NVYI 4A3MI 1TWAI 4A3EI 3Q87A 1VLAA 3HOWI 2E2HI 3S16I 3HOZI 4A3CI 3FKII 3HOYI 3PO3S 4A3BI 2K5RA 4A3KI 3S15I 1X3WA 3GTJI 2E2II 3VMGA 5C4JI 3S1NI 4XX2A 2JR6A 4NBEA 1ZB8A 3S1RI 3LUSA 3HOXI 4NB8A 4QTTA 2NVXI 2B63I 1I50I 3S2DI 3S14I 3GKQA 4NOZA 3GTGI 3GTQI 4NBFA 1DL6A 2R93I 1RLYA 1X3ZA 4A3LI 4NBDA 2DE6A 4NBAA 1TWCI 1TWHI 3I07A 5C44I 3M3YI 1LQLA 3D6WA 1RO4A 1I3QI 3GTLI 3RZOI 3H0GI 3GCFA 3S2HI 3GTOI 1N2FA 1TWFI 4Y7NI 3CQZI 3PO3I 3VMHA 4BXXI 2P3YA 4A3II 3RZDI 2AKLA 2F4MA 4X6AI 4NBBA 3K7AI 5IP7I 1ML8A 1TFIA 4A3JI 1YUAA 3S1MI 2J6AA 4BY7I 3I4MI 3H3VJ 3M4OI 1SFOI 4A3GI 2NVTI 3GTMS 3HOUI 4NBHA 2R92I 1PFTA 2PK7A 4A3FI 1QYPA 1TWGI 2JA7I 2HF1A 2JA8I 4BBSI 5IP9I 3S17I 4BY1I 3GTPI
chains in the Genus database with same CATH superfamily
1YJN1 3CCS1 2JA6I 1WJ2A 1VQO1 1QF8A 5C4XI 4E2YA 2DE5A 5FLMI 3VMIA 1Q821 1NP6A 3ESWA 1Y1WI 1KD12 1Y1VI 1R9TI 2E2JI 4A93I 1L1OC 2IV2X 1NJI1 3TE5B 3PO2I 1QVFZ 4MONA 2RBLA 4HGYA 3FQQA 2KPIA 3U50C 3I4NI 1YIJZ 1Z02A 3HOVI 1Q7Y2 2EGTA 1YI2Z 1VQN1 3CCMZ 3CC7Z 1YITZ 1YJ91 2E2HI 1YJW1 4A3CI 3CCL1 2NAPA 4A3BI 2LEXA 3GTJI 3VMGA 3S1NI 3G6EZ 2HU9A 3CCR1 3LUSA 3HOXI 2NVXI 2IZ3A 4CL1A 3BG1B 3CCLZ 1I50I 2PM9A 4RS4A 2AYDA 1YIT1 2QA41 2WB1A 3CC41 2ZAEB 4NOZA 3GTGI 4MD9A 3J81b 3CCSZ 1ZH1A 4AYBA 5LL6f 1TWHI 2VPXA 3D6WA 1I3QI 5T6BA 2W03A 2K3RA 5D1OA 4RVGA 1VQP1 1VQ6Z 1NJI2 4DQYB 1KQSZ 3PO3I 4BXXI 3BG0B 3CMEZ 3F3PC 4X6AI 3G4SZ 5IP7I 1RNIA 4A3JI 1YUAA 2J6AA 4E2ZA 3H3VJ 4A3GI 1SFOI 2NVTI 2VPWA 2QRCB 4NBHA 1JJ2Z 1PFTA 4A3FI 1TWGI 3CCU1 3S17I 3CCJZ 3I551 2JNYA 4EWCA 1Q16A 2BJOA 2NVQI 3F3FC 3QWUA 3CME1 1JJ2Y 1WCMI 2OTJ1 2Q4ZA 1VQ4Z 3KIHA 1K9M1 1Z01A 4RVHA 1USPA 2DE7A 1VQ71 1Y8CA 2QR1B 1S7MA 3T4NB 3G71Z 1VQ5Z 1VQ91 3GTKI 1VQM1 1QVFY 3S1QI 2W04A 4NB9A 3CMA1 1Y1VS 1USPB 2QREB 2R7ZI 3CCEZ 3CXCY 4DK1A 5IT9f 3Q87A 1VLAA 3EEDA 1SIWA 3S16I 3HOYI 1AA6A 3J7A4 3S15I 1W2BZ 2E2II 2OTLZ 3G6E1 1VQMZ 2VPZA 1Q812 1KD11 4NBEA 1ZB8A 2Q51A 1VQ8Z 3S1RI 3CCE1 4NFRA 2V3VA 4QTTA 4E31A 3GKQA 3G711 1K8A1 3CCQ1 3CD6Z 1DL6A 2R93I 1VQ7Z 1RLYA 2QEX1 2DE6A 1YUKA 2E9HA 1LQLA 1RO4A 3OW2Y 3CCJ1 3H0GI 3GCFA 2OZKA 3CPWZ 1VQK1 3CCV1 2GTIA 3CCUZ 4MXUA 1YHQ1 1TWFI 2GU2A 2P3YA 3RZDI 2AKLA 3FQMA 3S1MI 1YHQZ 1VQL1 3IR7A 3CCVZ 3M4OI 3IX0A 3HOUI 2PK7A 1QVGY 1K731 5AN9F 2JA7I 1VQKZ 4BBSI 5IP9I 2O4HA 1X0TA 3GTPI 2F4OA 4MD8A 1VQPZ 4MH4A 2RPRA 4NBCA 1QXFA 1Z03A 4QTUA 2YU9I 2H85A 5C3EI 1K83I 1VQ81 2RHBA 1KQSY 3P5JB 2QA4Z 1WW9A 5D1PA 2OTL1 3VB9A 1Q822 2JA5I 2LFUA 4NBGA 1NUIA 1W2BY 3J80f 3CC2Z 1I6HI 3GTMI 3D2LA 3CCRZ 1TWAI 5FLXf 3CXCZ 3CCM1 2RT9A 1VQ51 3HOWI 1VQNZ 1WIIA 3HOZI 1RO2A 1WZNA 3FKII 5FLXb 2M6NA 3PO3S 2K5RA 4A3KI 1YIJ1 4TNUA 2V8JA 3I561 1N8R2 2RIQA 3J80b 1Q861 5T67A 1FDOA 3NDIA 3S14I 1KRLA 3NH5A 1RO0A 3HKZA 4E2WA 2VF1A 2QKDA 3TDHB 2OTJZ 2QLVB 3CC21 4NBAA 2G2KA 1TWCI 3I07A 5C44I 3VTNA 2JIRA 1K8A2 3GTLI 2JMOA 2OOXB 3J81f 3GTOI 1KC81 4Y7NI 1YJNZ 4S1TA 1K9M2 3CQZI 2V8IA 3VMHA 2VPYA 3G4S1 3D9XA 4HGZA 4HH4A 2F4MA 3MONA 3KIFA 1Q862 1TFIA 1Q7Y1 4E2XA 1M901 4E32A 4RVDA 2JIPA 4E33A 1QYPA 2JA8I 2QEXZ 1VQLZ 2LIYA 3CD61 2GTHA 2OOYB 3CC4Z 1S721 1KC82 4RV9A 3NFZA 3JAMb 2VUMI 3MZKB 5CM2M 2JIOA 4A3DI 2V8KA 4BBRI 1YJWZ 2YADA 1YJ9Z 2JS4A 4Y52I 2E7ZA 1M902 3EERA 2IZ4A 5T64A 1ZB9A 1K732 1M1K2 3NH8A 3CMAZ 2NVYI 4A3MI 4MD7A 4A3EI 3CCQZ 3CC71 1YI21 4E30A 2Y0SA 1X3WA 5C4JI 4XX2A 5IT9b 2JR6A 3I56Z 2M48A 1VQ41 4NB8A 2B63I 3S2DI 2V45A 2QRDB 3MZLB 1VQOZ 2R6MA 3I55Z 3GTQI 4NBFA 5A2Qf 1X3ZA 3NDJA 4A3LI 4NBDA 2O53A 5D1OB 1VQ9Z 3M3YI 3NH4A 2JUBA 2PMZA 3RZOI 3IFUA 2WAQA 5A2Qb 3CPWY 1S72Z 3S2HI 1N2FA 3OW2Z 2KI7B 1P9NA 1N8R1 3JAMf 4RVFA 4A3II 1FDIA 4NBBA 3K7AI 1ML8A 2P28A 2VUGA 1Q811 1RQFA 4BY7I 2JIQA 3I4MI 1VQ61 4DGLA 1M1K1 2I3CA 3GTMS 2JIMA 1JWHC 2R92I 3IF8A 2HF1A 1QVGZ 4NH1C 4BY1I 4MRIA
chains in the Genus database with same CATH topology
1YJN1 3CCS1 2JA6I 1VQO1 1QF8A 5C4XI 4E2YA 2DE5A 5FLMI 3VMIA 1Q821 1NP6A 3ESWA 1Y1WI 1KD12 1Y1VI 1R9TI 2E2JI 4A93I 1L1OC 1NJI1 3TE5B 3PO2I 1QVFZ 4MONA 2RBLA 4HGYA 3FQQA 2KPIA 3U50C 3I4NI 1YIJZ 1Z02A 3HOVI 1Q7Y2 2EGTA 1YI2Z 1VQN1 3CCMZ 3CC7Z 1YITZ 1YJ91 2E2HI 1YJW1 4A3CI 3CCL1 4A3BI 3GTJI 3VMGA 3S1NI 3G6EZ 2HU9A 3CCR1 3LUSA 3HOXI 2NVXI 2IZ3A 4CL1A 3BG1B 3CCLZ 1I50I 2PM9A 4RS4A 1YIT1 2QA41 2WB1A 3CC41 2ZAEB 4NOZA 3GTGI 4MD9A 3J81b 3CCSZ 1ZH1A 4AYBA 5LL6f 1TWHI 3D6WA 1I3QI 5T6BA 2W03A 2K3RA 5D1OA 4RVGA 1VQP1 1VQ6Z 1NJI2 4DQYB 1KQSZ 3PO3I 4BXXI 3BG0B 3CMEZ 3F3PC 4X6AI 3G4SZ 5IP7I 1RNIA 4A3JI 1YUAA 2J6AA 4E2ZA 3H3VJ 4A3GI 1SFOI 2NVTI 2QRCB 4NBHA 1JJ2Z 1PFTA 4A3FI 1TWGI 3CCU1 3S17I 3CCJZ 3I551 2JNYA 4EWCA 2BJOA 2NVQI 3F3FC 3QWUA 3CME1 1JJ2Y 1WCMI 2OTJ1 2Q4ZA 1VQ4Z 3KIHA 1K9M1 1Z01A 4RVHA 1USPA 2DE7A 1VQ71 2QR1B 1S7MA 3T4NB 3G71Z 1VQ5Z 1VQ91 3GTKI 1VQM1 1QVFY 3S1QI 2W04A 4NB9A 3CMA1 1Y1VS 1USPB 2QREB 2R7ZI 3CCEZ 3CXCY 4DK1A 5IT9f 3Q87A 1VLAA 3EEDA 3S16I 3HOYI 3J7A4 3S15I 1W2BZ 2E2II 2OTLZ 3G6E1 1VQMZ 1Q812 1KD11 4NBEA 1ZB8A 2Q51A 1VQ8Z 3S1RI 3CCE1 4NFRA 4QTTA 4E31A 3GKQA 3G711 1K8A1 3CCQ1 3CD6Z 1DL6A 2R93I 1VQ7Z 1RLYA 2QEX1 2DE6A 1YUKA 2E9HA 1LQLA 1RO4A 3OW2Y 3CCJ1 3H0GI 3GCFA 2OZKA 3CPWZ 1VQK1 3CCV1 2GTIA 3CCUZ 4MXUA 1YHQ1 1TWFI 2GU2A 2P3YA 3RZDI 2AKLA 3FQMA 3S1MI 1YHQZ 1VQL1 3CCVZ 3M4OI 3IX0A 3HOUI 2PK7A 1QVGY 1K731 5AN9F 2JA7I 1VQKZ 4BBSI 5IP9I 2O4HA 1X0TA 3GTPI 2F4OA 4MD8A 1VQPZ 4MH4A 2RPRA 4NBCA 1Z03A 4QTUA 2YU9I 2H85A 5C3EI 1K83I 1VQ81 2RHBA 1KQSY 3P5JB 2QA4Z 1WW9A 5D1PA 2OTL1 3VB9A 1Q822 2JA5I 2LFUA 4NBGA 1NUIA 1W2BY 3J80f 3CC2Z 1I6HI 3GTMI 3CCRZ 1TWAI 5FLXf 3CXCZ 3CCM1 2RT9A 1VQ51 3HOWI 1VQNZ 1WIIA 3HOZI 1RO2A 3FKII 5FLXb 2M6NA 3PO3S 2K5RA 4A3KI 1YIJ1 4TNUA 2V8JA 3I561 1N8R2 2RIQA 3J80b 1Q861 5T67A 3NDIA 3S14I 1KRLA 3NH5A 1RO0A 3HKZA 4E2WA 2VF1A 2QKDA 3TDHB 2OTJZ 2QLVB 3CC21 4NBAA 1TWCI 2G2KA 3I07A 5C44I 3VTNA 1K8A2 3GTLI 2JMOA 2OOXB 3J81f 3GTOI 1KC81 4Y7NI 1YJNZ 4S1TA 1K9M2 3CQZI 2V8IA 3VMHA 3G4S1 3D9XA 4HGZA 4HH4A 2F4MA 3MONA 3KIFA 1Q862 1TFIA 1Q7Y1 4E2XA 1M901 4E32A 4RVDA 4E33A 1QYPA 2JA8I 2QEXZ 1VQLZ 2LIYA 3CD61 2GTHA 2OOYB 3CC4Z 1S721 1KC82 4RV9A 3NFZA 3JAMb 2VUMI 3MZKB 5CM2M 4A3DI 2V8KA 4BBRI 1YJWZ 2YADA 1YJ9Z 2JS4A 4Y52I 1M902 3EERA 2IZ4A 5T64A 1ZB9A 1K732 1M1K2 3NH8A 3CMAZ 2NVYI 4A3MI 4MD7A 4A3EI 3CCQZ 3CC71 1YI21 4E30A 2Y0SA 1X3WA 5C4JI 4XX2A 5IT9b 2JR6A 3I56Z 2M48A 1VQ41 4NB8A 2B63I 3S2DI 2QRDB 3MZLB 1VQOZ 2R6MA 3I55Z 3GTQI 4NBFA 5A2Qf 1X3ZA 3NDJA 4A3LI 4NBDA 2O53A 5D1OB 1VQ9Z 3M3YI 3NH4A 2JUBA 2PMZA 3RZOI 3IFUA 2WAQA 5A2Qb 3CPWY 1S72Z 3S2HI 1N2FA 3OW2Z 2KI7B 1P9NA 1N8R1 3JAMf 4RVFA 4A3II 4NBBA 3K7AI 1ML8A 2P28A 2VUGA 1Q811 1RQFA 4BY7I 3I4MI 1VQ61 4DGLA 1M1K1 2I3CA 3GTMS 1JWHC 2R92I 3IF8A 2HF1A 1QVGZ 4NH1C 4BY1I 4MRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 I;  2JNY A;  2F4O A;  4MH4 A;  2BJO A;  2NVQ I;  5C4X I;  4NBC A;  1WCM I;  4QTU A;  2DE5 A;  5FLM I;  3VMI A;  2YU9 I;  3ESW A;  1Y1W I;  5C3E I;  1K83 I;  1Y1V I;  2VUM I;  1R9T I;  2E2J I;  4A93 I;  1L1O C;  5CM2 M;  3PO2 I;  1WW9 A;  3VB9 A;  1USP A;  4A3D I;  2JA5 I;  2DE7 A;  4NBG A;  2RBL A;  4BBR I;  1NUI A;  2JS4 A;  4Y52 I;  3GTK I;  2KPI A;  3U50 C;  3S1Q I;  1I6H I;  4NB9 A;  3I4N I;  3EER A;  1Y1V S;  1USP B;  3GTM I;  1ZB9 A;  2R7Z I;  3HOV I;  2NVY I;  4A3M I;  1TWA I;  4A3E I;  3Q87 A;  1VLA A;  3HOW I;  2E2H I;  3S16 I;  3HOZ I;  4A3C I;  3FKI I;  3HOY I;  3PO3 S;  4A3B I;  2K5R A;  4A3K I;  3S15 I;  1X3W A;  3GTJ I;  2E2I I;  3VMG A;  5C4J I;  3S1N I;  4XX2 A;  2JR6 A;  4NBE A;  1ZB8 A;  3S1R I;  3LUS A;  3HOX I;  4NB8 A;  4QTT A;  2NVX I;  2B63 I;  1I50 I;  3S2D I;  3S14 I;  3GKQ A;  4NOZ A;  3GTG I;  3GTQ I;  4NBF A;  1DL6 A;  2R93 I;  1RLY A;  1X3Z A;  4A3L I;  4NBD A;  2DE6 A;  4NBA A;  1TWC I;  1TWH I;  3I07 A;  5C44 I;  3M3Y I;  1LQL A;  3D6W A;  1RO4 A;  1I3Q I;  3GTL I;  3RZO I;  3H0G I;  3GCF A;  3S2H I;  3GTO I;  1N2F A;  1TWF I;  4Y7N I;  3CQZ I;  3PO3 I;  3VMH A;  4BXX I;  2P3Y A;  4A3I I;  3RZD I;  2AKL A;  2F4M A;  4X6A I;  4NBB A;  3K7A I;  5IP7 I;  1ML8 A;  1TFI A;  4A3J I;  1YUA A;  3S1M I;  2J6A A;  4BY7 I;  3I4M I;  3H3V J;  3M4O I;  1SFO I;  4A3G I;  2NVT I;  3GTM S;  3HOU I;  4NBH A;  2R92 I;  1PFT A;  2PK7 A;  4A3F I;  1QYP A;  1TWG I;  2JA7 I;  2HF1 A;  2JA8 I;  4BBS I;  5IP9 I;  3S17 I;  4BY1 I;  3GTP I; 
#chains in the Genus database with same CATH topology
 1YJN 1;  3CCS 1;  2JA6 I;  1WJ2 A;  1VQO 1;  1QF8 A;  5C4X I;  4E2Y A;  2DE5 A;  5FLM I;  3VMI A;  1Q82 1;  1NP6 A;  3ESW A;  1Y1W I;  1KD1 2;  1Y1V I;  1R9T I;  2E2J I;  4A93 I;  1L1O C;  2IV2 X;  1NJI 1;  3TE5 B;  3PO2 I;  1QVF Z;  4MON A;  2RBL A;  4HGY A;  3FQQ A;  2KPI A;  3U50 C;  3I4N I;  1YIJ Z;  1Z02 A;  3HOV I;  1Q7Y 2;  2EGT A;  1YI2 Z;  1VQN 1;  3CCM Z;  3CC7 Z;  1YIT Z;  1YJ9 1;  2E2H I;  1YJW 1;  4A3C I;  3CCL 1;  2NAP A;  4A3B I;  2LEX A;  3GTJ I;  3VMG A;  3S1N I;  3G6E Z;  2HU9 A;  3CCR 1;  3LUS A;  3HOX I;  2NVX I;  2IZ3 A;  4CL1 A;  3BG1 B;  3CCL Z;  1I50 I;  2PM9 A;  4RS4 A;  2AYD A;  1YIT 1;  2QA4 1;  2WB1 A;  3CC4 1;  2ZAE B;  4NOZ A;  3GTG I;  4MD9 A;  3J81 b;  3CCS Z;  1ZH1 A;  4AYB A;  5LL6 f;  1TWH I;  2VPX A;  3D6W A;  1I3Q I;  5T6B A;  2W03 A;  2K3R A;  5D1O A;  4RVG A;  1VQP 1;  1VQ6 Z;  1NJI 2;  4DQY B;  1KQS Z;  3PO3 I;  4BXX I;  3BG0 B;  3CME Z;  3F3P C;  4X6A I;  3G4S Z;  5IP7 I;  1RNI A;  4A3J I;  1YUA A;  2J6A A;  4E2Z A;  3H3V J;  4A3G I;  1SFO I;  2NVT I;  2VPW A;  2QRC B;  4NBH A;  1JJ2 Z;  1PFT A;  4A3F I;  1TWG I;  3CCU 1;  3S17 I;  3CCJ Z;  3I55 1;  2JNY A;  4EWC A;  1Q16 A;  2BJO A;  2NVQ I;  3F3F C;  3QWU A;  3CME 1;  1JJ2 Y;  1WCM I;  2OTJ 1;  2Q4Z A;  1VQ4 Z;  3KIH A;  1K9M 1;  1Z01 A;  4RVH A;  1USP A;  2DE7 A;  1VQ7 1;  1Y8C A;  2QR1 B;  1S7M A;  3T4N B;  3G71 Z;  1VQ5 Z;  1VQ9 1;  3GTK I;  1VQM 1;  1QVF Y;  3S1Q I;  2W04 A;  4NB9 A;  3CMA 1;  1Y1V S;  1USP B;  2QRE B;  2R7Z I;  3CCE Z;  3CXC Y;  4DK1 A;  5IT9 f;  3Q87 A;  1VLA A;  3EED A;  1SIW A;  3S16 I;  3HOY I;  1AA6 A;  3J7A 4;  3S15 I;  1W2B Z;  2E2I I;  2OTL Z;  3G6E 1;  1VQM Z;  2VPZ A;  1Q81 2;  1KD1 1;  4NBE A;  1ZB8 A;  2Q51 A;  1VQ8 Z;  3S1R I;  3CCE 1;  4NFR A;  2V3V A;  4QTT A;  4E31 A;  3GKQ A;  3G71 1;  1K8A 1;  3CCQ 1;  3CD6 Z;  1DL6 A;  2R93 I;  1VQ7 Z;  1RLY A;  2QEX 1;  2DE6 A;  1YUK A;  2E9H A;  1LQL A;  1RO4 A;  3OW2 Y;  3CCJ 1;  3H0G I;  3GCF A;  2OZK A;  3CPW Z;  1VQK 1;  3CCV 1;  2GTI A;  3CCU Z;  4MXU A;  1YHQ 1;  1TWF I;  2GU2 A;  2P3Y A;  3RZD I;  2AKL A;  3FQM A;  3S1M I;  1YHQ Z;  1VQL 1;  3IR7 A;  3CCV Z;  3M4O I;  3IX0 A;  3HOU I;  2PK7 A;  1QVG Y;  1K73 1;  5AN9 F;  2JA7 I;  1VQK Z;  4BBS I;  5IP9 I;  2O4H A;  1X0T A;  3GTP I;  2F4O A;  4MD8 A;  1VQP Z;  4MH4 A;  2RPR A;  4NBC A;  1QXF A;  1Z03 A;  4QTU A;  2YU9 I;  2H85 A;  5C3E I;  1K83 I;  1VQ8 1;  2RHB A;  1KQS Y;  3P5J B;  2QA4 Z;  1WW9 A;  5D1P A;  2OTL 1;  3VB9 A;  1Q82 2;  2JA5 I;  2LFU A;  4NBG A;  1NUI A;  1W2B Y;  3J80 f;  3CC2 Z;  1I6H I;  3GTM I;  3D2L A;  3CCR Z;  1TWA I;  5FLX f;  3CXC Z;  3CCM 1;  2RT9 A;  1VQ5 1;  3HOW I;  1VQN Z;  1WII A;  3HOZ I;  1RO2 A;  1WZN A;  3FKI I;  5FLX b;  2M6N A;  3PO3 S;  2K5R A;  4A3K I;  1YIJ 1;  4TNU A;  2V8J A;  3I56 1;  1N8R 2;  2RIQ A;  3J80 b;  1Q86 1;  5T67 A;  1FDO A;  3NDI A;  3S14 I;  1KRL A;  3NH5 A;  1RO0 A;  3HKZ A;  4E2W A;  2VF1 A;  2QKD A;  3TDH B;  2OTJ Z;  2QLV B;  3CC2 1;  4NBA A;  2G2K A;  1TWC I;  3I07 A;  5C44 I;  3VTN A;  2JIR A;  1K8A 2;  3GTL I;  2JMO A;  2OOX B;  3J81 f;  3GTO I;  1KC8 1;  4Y7N I;  1YJN Z;  4S1T A;  1K9M 2;  3CQZ I;  2V8I A;  3VMH A;  2VPY A;  3G4S 1;  3D9X A;  4HGZ A;  4HH4 A;  2F4M A;  3MON A;  3KIF A;  1Q86 2;  1TFI A;  1Q7Y 1;  4E2X A;  1M90 1;  4E32 A;  4RVD A;  2JIP A;  4E33 A;  1QYP A;  2JA8 I;  2QEX Z;  1VQL Z;  2LIY A;  3CD6 1;  2GTH A;  2OOY B;  3CC4 Z;  1S72 1;  1KC8 2;  4RV9 A;  3NFZ A;  3JAM b;  2VUM I;  3MZK B;  5CM2 M;  2JIO A;  4A3D I;  2V8K A;  4BBR I;  1YJW Z;  2YAD A;  1YJ9 Z;  2JS4 A;  4Y52 I;  2E7Z A;  1M90 2;  3EER A;  2IZ4 A;  5T64 A;  1ZB9 A;  1K73 2;  1M1K 2;  3NH8 A;  3CMA Z;  2NVY I;  4A3M I;  4MD7 A;  4A3E I;  3CCQ Z;  3CC7 1;  1YI2 1;  4E30 A;  2Y0S A;  1X3W A;  5C4J I;  4XX2 A;  5IT9 b;  2JR6 A;  3I56 Z;  2M48 A;  1VQ4 1;  4NB8 A;  2B63 I;  3S2D I;  2V45 A;  2QRD B;  3MZL B;  1VQO Z;  2R6M A;  3I55 Z;  3GTQ I;  4NBF A;  5A2Q f;  1X3Z A;  3NDJ A;  4A3L I;  4NBD A;  2O53 A;  5D1O B;  1VQ9 Z;  3M3Y I;  3NH4 A;  2JUB A;  2PMZ A;  3RZO I;  3IFU A;  2WAQ A;  5A2Q b;  3CPW Y;  1S72 Z;  3S2H I;  1N2F A;  3OW2 Z;  2KI7 B;  1P9N A;  1N8R 1;  3JAM f;  4RVF A;  4A3I I;  1FDI A;  4NBB A;  3K7A I;  1ML8 A;  2P28 A;  2VUG A;  1Q81 1;  1RQF A;  4BY7 I;  2JIQ A;  3I4M I;  1VQ6 1;  4DGL A;  1M1K 1;  2I3C A;  3GTM S;  2JIM A;  1JWH C;  2R92 I;  3IF8 A;  2HF1 A;  1QVG Z;  4NH1 C;  4BY1 I;  4MRI A; 
#chains in the Genus database with same CATH homology
 1YJN 1;  3CCS 1;  2JA6 I;  1VQO 1;  1QF8 A;  5C4X I;  4E2Y A;  2DE5 A;  5FLM I;  3VMI A;  1Q82 1;  1NP6 A;  3ESW A;  1Y1W I;  1KD1 2;  1Y1V I;  1R9T I;  2E2J I;  4A93 I;  1L1O C;  1NJI 1;  3TE5 B;  3PO2 I;  1QVF Z;  4MON A;  2RBL A;  4HGY A;  3FQQ A;  2KPI A;  3U50 C;  3I4N I;  1YIJ Z;  1Z02 A;  3HOV I;  1Q7Y 2;  2EGT A;  1YI2 Z;  1VQN 1;  3CCM Z;  3CC7 Z;  1YIT Z;  1YJ9 1;  2E2H I;  1YJW 1;  4A3C I;  3CCL 1;  4A3B I;  3GTJ I;  3VMG A;  3S1N I;  3G6E Z;  2HU9 A;  3CCR 1;  3LUS A;  3HOX I;  2NVX I;  2IZ3 A;  4CL1 A;  3BG1 B;  3CCL Z;  1I50 I;  2PM9 A;  4RS4 A;  1YIT 1;  2QA4 1;  2WB1 A;  3CC4 1;  2ZAE B;  4NOZ A;  3GTG I;  4MD9 A;  3J81 b;  3CCS Z;  1ZH1 A;  4AYB A;  5LL6 f;  1TWH I;  3D6W A;  1I3Q I;  5T6B A;  2W03 A;  2K3R A;  5D1O A;  4RVG A;  1VQP 1;  1VQ6 Z;  1NJI 2;  4DQY B;  1KQS Z;  3PO3 I;  4BXX I;  3BG0 B;  3CME Z;  3F3P C;  4X6A I;  3G4S Z;  5IP7 I;  1RNI A;  4A3J I;  1YUA A;  2J6A A;  4E2Z A;  3H3V J;  4A3G I;  1SFO I;  2NVT I;  2QRC B;  4NBH A;  1JJ2 Z;  1PFT A;  4A3F I;  1TWG I;  3CCU 1;  3S17 I;  3CCJ Z;  3I55 1;  2JNY A;  4EWC A;  2BJO A;  2NVQ I;  3F3F C;  3QWU A;  3CME 1;  1JJ2 Y;  1WCM I;  2OTJ 1;  2Q4Z A;  1VQ4 Z;  3KIH A;  1K9M 1;  1Z01 A;  4RVH A;  1USP A;  2DE7 A;  1VQ7 1;  2QR1 B;  1S7M A;  3T4N B;  3G71 Z;  1VQ5 Z;  1VQ9 1;  3GTK I;  1VQM 1;  1QVF Y;  3S1Q I;  2W04 A;  4NB9 A;  3CMA 1;  1Y1V S;  1USP B;  2QRE B;  2R7Z I;  3CCE Z;  3CXC Y;  4DK1 A;  5IT9 f;  3Q87 A;  1VLA A;  3EED A;  3S16 I;  3HOY I;  3J7A 4;  3S15 I;  1W2B Z;  2E2I I;  2OTL Z;  3G6E 1;  1VQM Z;  1Q81 2;  1KD1 1;  4NBE A;  1ZB8 A;  2Q51 A;  1VQ8 Z;  3S1R I;  3CCE 1;  4NFR A;  4QTT A;  4E31 A;  3GKQ A;  3G71 1;  1K8A 1;  3CCQ 1;  3CD6 Z;  1DL6 A;  2R93 I;  1VQ7 Z;  1RLY A;  2QEX 1;  2DE6 A;  1YUK A;  2E9H A;  1LQL A;  1RO4 A;  3OW2 Y;  3CCJ 1;  3H0G I;  3GCF A;  2OZK A;  3CPW Z;  1VQK 1;  3CCV 1;  2GTI A;  3CCU Z;  4MXU A;  1YHQ 1;  1TWF I;  2GU2 A;  2P3Y A;  3RZD I;  2AKL A;  3FQM A;  3S1M I;  1YHQ Z;  1VQL 1;  3CCV Z;  3M4O I;  3IX0 A;  3HOU I;  2PK7 A;  1QVG Y;  1K73 1;  5AN9 F;  2JA7 I;  1VQK Z;  4BBS I;  5IP9 I;  2O4H A;  1X0T A;  3GTP I;  2F4O A;  4MD8 A;  1VQP Z;  4MH4 A;  2RPR A;  4NBC A;  1Z03 A;  4QTU A;  2YU9 I;  2H85 A;  5C3E I;  1K83 I;  1VQ8 1;  2RHB A;  1KQS Y;  3P5J B;  2QA4 Z;  1WW9 A;  5D1P A;  2OTL 1;  3VB9 A;  1Q82 2;  2JA5 I;  2LFU A;  4NBG A;  1NUI A;  1W2B Y;  3J80 f;  3CC2 Z;  1I6H I;  3GTM I;  3CCR Z;  1TWA I;  5FLX f;  3CXC Z;  3CCM 1;  2RT9 A;  1VQ5 1;  3HOW I;  1VQN Z;  1WII A;  3HOZ I;  1RO2 A;  3FKI I;  5FLX b;  2M6N A;  3PO3 S;  2K5R A;  4A3K I;  1YIJ 1;  4TNU A;  2V8J A;  3I56 1;  1N8R 2;  2RIQ A;  3J80 b;  1Q86 1;  5T67 A;  3NDI A;  3S14 I;  1KRL A;  3NH5 A;  1RO0 A;  3HKZ A;  4E2W A;  2VF1 A;  2QKD A;  3TDH B;  2OTJ Z;  2QLV B;  3CC2 1;  4NBA A;  1TWC I;  2G2K A;  3I07 A;  5C44 I;  3VTN A;  1K8A 2;  3GTL I;  2JMO A;  2OOX B;  3J81 f;  3GTO I;  1KC8 1;  4Y7N I;  1YJN Z;  4S1T A;  1K9M 2;  3CQZ I;  2V8I A;  3VMH A;  3G4S 1;  3D9X A;  4HGZ A;  4HH4 A;  2F4M A;  3MON A;  3KIF A;  1Q86 2;  1TFI A;  1Q7Y 1;  4E2X A;  1M90 1;  4E32 A;  4RVD A;  4E33 A;  1QYP A;  2JA8 I;  2QEX Z;  1VQL Z;  2LIY A;  3CD6 1;  2GTH A;  2OOY B;  3CC4 Z;  1S72 1;  1KC8 2;  4RV9 A;  3NFZ A;  3JAM b;  2VUM I;  3MZK B;  5CM2 M;  4A3D I;  2V8K A;  4BBR I;  1YJW Z;  2YAD A;  1YJ9 Z;  2JS4 A;  4Y52 I;  1M90 2;  3EER A;  2IZ4 A;  5T64 A;  1ZB9 A;  1K73 2;  1M1K 2;  3NH8 A;  3CMA Z;  2NVY I;  4A3M I;  4MD7 A;  4A3E I;  3CCQ Z;  3CC7 1;  1YI2 1;  4E30 A;  2Y0S A;  1X3W A;  5C4J I;  4XX2 A;  5IT9 b;  2JR6 A;  3I56 Z;  2M48 A;  1VQ4 1;  4NB8 A;  2B63 I;  3S2D I;  2QRD B;  3MZL B;  1VQO Z;  2R6M A;  3I55 Z;  3GTQ I;  4NBF A;  5A2Q f;  1X3Z A;  3NDJ A;  4A3L I;  4NBD A;  2O53 A;  5D1O B;  1VQ9 Z;  3M3Y I;  3NH4 A;  2JUB A;  2PMZ A;  3RZO I;  3IFU A;  2WAQ A;  5A2Q b;  3CPW Y;  1S72 Z;  3S2H I;  1N2F A;  3OW2 Z;  2KI7 B;  1P9N A;  1N8R 1;  3JAM f;  4RVF A;  4A3I I;  4NBB A;  3K7A I;  1ML8 A;  2P28 A;  2VUG A;  1Q81 1;  1RQF A;  4BY7 I;  3I4M I;  1VQ6 1;  4DGL A;  1M1K 1;  2I3C A;  3GTM S;  1JWH C;  2R92 I;  3IF8 A;  2HF1 A;  1QVG Z;  4NH1 C;  4BY1 I;  4MRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...