3I4MI

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI02
2F4OA 4NB9A 1ZB8A 2PK7A 4A3CI 3HOXI 1WCMI 1VLAA 5IP7I 3S2DI 3GCFA 2JA7I 1L1OC 4NBFA 5C44I 4NBHA 1I3QI 2NVYI 3I07A 3HOVI 3GTPI 4QTTA 3GTMS 3M3YI 4A3EI 4A3JI 4NBEA 3H0GI 1SFOI 1QYPA 2J6AA 2BJOA 3HOZI 3Q87A 4BXXI 3PO2I 4NBCA 4A93I 3M4OI 4A3KI 2R92I 4A3FI 3GTMI 1TWGI 3S1QI 4A3DI 1WW9A 4BY1I 1USPA 2JA6I 3FKII 3S1NI 3K7AI 1TWHI 4NOZA 1R9TI 4BBSI 2E2JI 2E2HI 2VUMI 4BY7I 4A3GI 2NVQI 4Y7NI 2DE7A 1RO4A 2F4MA 3VMGA 3GTQI 1I50I 3GTKI 1USPB 3GTOI 1TWCI 1X3WA 2JA8I 4NB8A 3S17I 2YU9I 2R93I 3RZOI 1LQLA 3VMHA 2NVXI 1I6HI 5C3EI 4XX2A 2NVTI 3S2HI 4BBRI 1X3ZA 2E2II 3H3VJ 4Y52I 1TWAI 4A3II 2JA5I 1PFTA 3S14I 3D6WA 2HF1A 1NUIA 1N2FA 3HOYI 4A3BI 1ML8A 2KPIA 1TWFI 4NBAA 3GTLI 4A3LI 4MH4A 4A3MI 2DE5A 5C4XI 4X6AI 3LUSA 3GTJI 5C4JI 3S15I 3VMIA 1K83I 1ZB9A 4QTUA 1DL6A 1RLYA 3HOUI 5FLMI 1YUAA 3CQZI 3VB9A 1Y1VI 2K5RA 1Y1VS 3S1RI 4NBDA 3GKQA 3EERA 2AKLA 3S16I 3ESWA 2JR6A 3RZDI 2RBLA 5IP9I 1Y1WI 3PO3I 3PO3S 4NBBA 1TFIA 3HOWI 3I4MI 2JNYA 3GTGI 2P3YA 2JS4A 2B63I 3U50C 2DE6A 3I4NI 5CM2M 4NBGA 2R7ZI 3S1MI
chains in the Genus database with same CATH superfamily
4NB9A 1ZB8A 3CC2Z 5LL6f 1VLAA 5IP7I 3GCFA 3IF8A 4NBHA 3J81b 2O53A 4NBEA 1SFOI 3Q87A 4BXXI 3PO2I 4A3KI 2R92I 3CME1 3CCQZ 4MD8A 1YJW1 4A3DI 1TWHI 2IZ3A 3CCVZ 3QWUA 3CCL1 4BY7I 1VQKZ 4A3GI 2QREB 2F4MA 3NFZA 3NH4A 1YUKA 1X0TA 3NDJA 2JA8I 1Q821 3S17I 2JIMA 2QLVB 1Q861 2R93I 3RZOI 3VMHA 3NDIA 2NVTI 3S2HI 4BBRI 2P28A 2OOXB 3H3VJ 1S72Z 3CPWZ 2G2KA 1PFTA 1Q812 3CCU1 2HF1A 1VQOZ 4NBAA 2QEXZ 3D2LA 3GTLI 5AN9F 3JAMf 4A3MI 1VQ61 2DE5A 4X6AI 3KIHA 2OZKA 5IT9f 1YJN1 4E2WA 1ZB9A 2GTIA 1WJ2A 1RLYA 1AA6A 3CQZI 2Q4ZA 1Q7Y2 3VB9A 1WIIA 2RPRA 3S1RI 3CCS1 2VF1A 4NBDA 4DGLA 3EERA 1RNIA 2IV2X 1RO2A 3CMA1 2OTJ1 1N8R1 1M902 2LEXA 3G4SZ 1VQ41 2LIYA 5D1OB 1K9M1 3I561 1KD12 3CCJZ 1TFIA 2WB1A 1YHQZ 1K9M2 4NFRA 1P9NA 3CCEZ 3U50C 2HU9A 2DE6A 4E30A 2H85A 3I4NI 5CM2M 4NBGA 2OTL1 1K8A2 1Q811 2QA41 1Z01A 1SIWA 2QR1B 1YJ9Z 2VPWA 4A3CI 3G6E1 3S2DI 2JA7I 4NBFA 2JIOA 1VQLZ 1I3QI 3CCRZ 4A3JI 4E33A 3CCM1 3CC7Z 1YIT1 3G71Z 4A93I 3M4OI 1QVFY 4MONA 2JMOA 4RV9A 4RVFA 1W2BZ 1YIJZ 3K7AI 1YJWZ 1JJ2Z 4NOZA 1R9TI 4BBSI 3CD6Z 4RVHA 1YI21 3OW2Y 3CCV1 1VQNZ 1I50I 1VQK1 3GTOI 1WZNA 2YU9I 2ZAEB 1LQLA 5C3EI 3BG0B 1W2BY 1KRLA 1RO0A 4Y52I 1TWAI 4A3II 3OW2Z 3S14I 3D6WA 1NUIA 1S721 1VQ5Z 4A3BI 1TWFI 1K732 1QXFA 2M48A 3TE5B 5IT9b 5T6BA 3S15I 3NH8A 3VMIA 1VQ9Z 1DL6A 3HOUI 3CXCZ 2VPZA 1YUAA 3KIFA 2Y0SA 2QRDB 1Y1VS 2R6MA 4MD9A 2EGTA 1KC82 3I55Z 3CC41 2O4HA 3PO3I 1JJ2Y 2PMZA 4MD7A 1N8R2 2JIQA 2JNYA 2Q51A 5FLXb 2JS4A 1FDIA 3CC21 2RIQA 1NJI1 4RVDA 4HGZA 1Q7Y1 2OTLZ 3HOXI 1WCMI 2QA4Z 1Q822 2V8JA 1QVGY 3I07A 3HOVI 3GTPI 4QTTA 3GTMS 3M3YI 3H0GI 4E2XA 1QYPA 2VPXA 3TDHB 1VQ71 2J6AA 2BJOA 4NBCA 1KD11 4E31A 4A3FI 2AYDA 1YITZ 1TWGI 5D1PA 5D1OA 3J81f 1USPA 2JA6I 3CMEZ 3S1NI 3CCQ1 1Q16A 4MXUA 4HH4A 5A2Qf 1K731 1YIJ1 2NVQI 1QVGZ 4Y7NI 1RO4A 3VMGA 3GTQI 3CCLZ 3CD61 3GTKI 2VUGA 1USPB 1RQFA 3HKZA 2W04A 2NVXI 1I6HI 4XX2A 2WAQA 2I3CA 1X3ZA 3VTNA 2E2II 2JIRA 2OOYB 3JAMb 1KC81 2JA5I 1QVFZ 1N2FA 2KPIA 1VQ8Z 1ZH1A 3FQMA 3IR7A 3CCUZ 1VQPZ 4A3LI 1VQ51 1VQO1 4DQYB 4MH4A 5C4XI 2PM9A 2QEX1 3LUSA 1Z03A 1VQ6Z 1K83I 3J80f 4E2YA 4QTUA 2YADA 2VPYA 1JWHC 5FLMI 1YJNZ 2V8KA 4AYBA 2QRCB 2K5RA 1NJI2 1KQSY 3GKQA 2AKLA 3NH5A 2JR6A 3G4S1 3MZKB 4EWCA 2RBLA 2GU2A 5IP9I 5A2Qb 3I56Z 3CMAZ 3CCJ1 2LFUA 3I551 3CC4Z 4RVGA 3D9XA 1VQ4Z 1YHQ1 4DK1A 3GTGI 4S1TA 1KQSZ 1VQM1 2B63I 1S7MA 1M1K2 4CL1A 2R7ZI 3CCE1 2V45A 3S1MI 3G6EZ 2F4OA 1QF8A 3CXCY 2PK7A 1VQL1 2JIPA 1YJ91 1L1OC 2RT9A 5C44I 3CC71 2NVYI 4A3EI 4RS4A 2E7ZA 3G711 2KI7B 3T4NB 3CCR1 3HOZI 3CPWY 2RHBA 3CCMZ 1VQ7Z 4NH1C 3F3FC 1Y8CA 4E2ZA 3GTMI 1WW9A 4BY1I 3S1QI 1Z02A 3FKII 1YI2Z 4MRIA 1VQN1 2E2JI 2E2HI 2VUMI 4TNUA 2JUBA 2DE7A 3MZLB 3BG1B 2K3RA 1TWCI 1X3WA 4NB8A 3IX0A 2NAPA 1M901 2E9HA 1M1K1 2IZ4A 3MONA 3HOYI 3IFUA 1ML8A 2V8IA 1NP6A 1VQ91 1VQ81 3GTJI 5C4JI 1VQP1 4HGYA 5T67A 1Q862 3CCSZ 3EEDA 1K8A1 1Y1VI 2M6NA 2QKDA 2OTJZ 3S16I 2W03A 3ESWA 3RZDI 2GTHA 3P5JB 5T64A 3J80b 1Y1WI 5FLXf 2V3VA 3PO3S 1FDOA 3J7A4 4NBBA 4E32A 3HOWI 3I4MI 2P3YA 3F3PC 3FQQA 1VQMZ
chains in the Genus database with same CATH topology
4NB9A 1ZB8A 3CC2Z 5LL6f 1VLAA 5IP7I 3GCFA 3IF8A 4NBHA 3J81b 2O53A 4NBEA 1SFOI 3Q87A 4BXXI 3PO2I 4A3KI 2R92I 3CME1 3CCQZ 4MD8A 1YJW1 4A3DI 1TWHI 2IZ3A 3CCVZ 3QWUA 3CCL1 4BY7I 1VQKZ 4A3GI 2QREB 2F4MA 3NFZA 3NH4A 1YUKA 1X0TA 3NDJA 2JA8I 1Q821 3S17I 2QLVB 1Q861 2R93I 3RZOI 3VMHA 3NDIA 2NVTI 3S2HI 4BBRI 2P28A 2OOXB 3H3VJ 1S72Z 3CPWZ 2G2KA 1PFTA 1Q812 3CCU1 2HF1A 1VQOZ 4NBAA 2QEXZ 3GTLI 5AN9F 3JAMf 4A3MI 1VQ61 2DE5A 4X6AI 3KIHA 2OZKA 5IT9f 1YJN1 4E2WA 1ZB9A 2GTIA 1RLYA 1Q7Y2 2Q4ZA 3CQZI 3VB9A 1WIIA 2RPRA 3S1RI 3CCS1 2VF1A 4NBDA 4DGLA 3EERA 1RNIA 1RO2A 3CMA1 2OTJ1 1N8R1 1M902 3G4SZ 1VQ41 2LIYA 5D1OB 1K9M1 3I561 1KD12 3CCJZ 1TFIA 2WB1A 1YHQZ 1K9M2 4NFRA 1P9NA 3CCEZ 3U50C 2HU9A 2DE6A 4E30A 2H85A 3I4NI 5CM2M 4NBGA 2OTL1 1K8A2 1Q811 2QA41 1Z01A 2QR1B 1YJ9Z 4A3CI 3G6E1 3S2DI 2JA7I 4NBFA 1VQLZ 1I3QI 3CCRZ 4A3JI 4E33A 3CCM1 3CC7Z 1YIT1 3G71Z 4A93I 3M4OI 1QVFY 4MONA 2JMOA 4RV9A 4RVFA 1W2BZ 1YIJZ 3K7AI 1YJWZ 1JJ2Z 4NOZA 1R9TI 4BBSI 3CD6Z 4RVHA 1YI21 3OW2Y 3CCV1 1VQNZ 1I50I 1VQK1 3GTOI 2YU9I 2ZAEB 1LQLA 5C3EI 3BG0B 1W2BY 1KRLA 1RO0A 4Y52I 1TWAI 4A3II 3OW2Z 3S14I 3D6WA 1NUIA 1S721 1VQ5Z 4A3BI 1TWFI 1K732 2M48A 3TE5B 5IT9b 5T6BA 3S15I 3NH8A 3VMIA 1VQ9Z 1DL6A 3HOUI 3CXCZ 1YUAA 3KIFA 2Y0SA 2QRDB 1Y1VS 2R6MA 4MD9A 2EGTA 1KC82 3I55Z 3CC41 2O4HA 3PO3I 1JJ2Y 2PMZA 4MD7A 1N8R2 2JNYA 2Q51A 5FLXb 2JS4A 3CC21 2RIQA 1NJI1 4RVDA 4HGZA 1Q7Y1 2OTLZ 3HOXI 1WCMI 2QA4Z 1Q822 2V8JA 1QVGY 3I07A 3HOVI 3GTPI 4QTTA 3GTMS 3M3YI 3H0GI 4E2XA 1QYPA 3TDHB 1VQ71 2J6AA 2BJOA 4NBCA 1KD11 4E31A 4A3FI 3J81f 1TWGI 5D1PA 5D1OA 1YITZ 1USPA 2JA6I 3CMEZ 3S1NI 3CCQ1 4MXUA 4HH4A 5A2Qf 1K731 1YIJ1 2NVQI 1QVGZ 4Y7NI 1RO4A 3VMGA 3GTQI 3CCLZ 3CD61 3GTKI 2VUGA 1USPB 1RQFA 3HKZA 2W04A 2NVXI 1I6HI 4XX2A 2WAQA 2I3CA 1X3ZA 3VTNA 2E2II 2OOYB 3JAMb 1KC81 2JA5I 1QVFZ 1N2FA 2KPIA 1VQ8Z 1ZH1A 3FQMA 3CCUZ 1VQPZ 4A3LI 1VQ51 1VQO1 4DQYB 4MH4A 5C4XI 2PM9A 2QEX1 3LUSA 1Z03A 1VQ6Z 1K83I 3J80f 4E2YA 4QTUA 2YADA 1JWHC 5FLMI 1YJNZ 2V8KA 4AYBA 2QRCB 2K5RA 1NJI2 1KQSY 3GKQA 2AKLA 3NH5A 2JR6A 3G4S1 3MZKB 4EWCA 2RBLA 2GU2A 5IP9I 5A2Qb 3I56Z 3CMAZ 3CCJ1 2LFUA 3I551 3CC4Z 4RVGA 3D9XA 1VQ4Z 1YHQ1 4DK1A 3GTGI 4S1TA 1KQSZ 1VQM1 2B63I 1S7MA 1M1K2 4CL1A 2R7ZI 3CCE1 3S1MI 3G6EZ 2F4OA 1QF8A 3CXCY 2PK7A 1VQL1 1YJ91 1L1OC 2RT9A 5C44I 3CC71 2NVYI 4A3EI 4RS4A 3G711 2KI7B 3T4NB 3CCR1 3HOZI 3CPWY 2RHBA 3CCMZ 1VQ7Z 4NH1C 3F3FC 4E2ZA 3GTMI 3S1QI 1WW9A 4BY1I 1Z02A 3FKII 1YI2Z 4MRIA 1VQN1 2E2JI 2E2HI 2VUMI 4TNUA 2JUBA 2DE7A 3MZLB 3BG1B 2K3RA 1TWCI 1X3WA 4NB8A 3IX0A 1M901 2E9HA 1M1K1 2IZ4A 3MONA 3HOYI 3IFUA 1ML8A 2V8IA 1NP6A 1VQ91 1VQ81 3GTJI 5C4JI 1VQP1 4HGYA 5T67A 1Q862 3CCSZ 3EEDA 1K8A1 1Y1VI 2M6NA 2QKDA 2OTJZ 3S16I 2W03A 3ESWA 3RZDI 2GTHA 3P5JB 5T64A 3J80b 1Y1WI 5FLXf 3PO3S 3J7A4 4NBBA 4E32A 3HOWI 3I4MI 2P3YA 3F3PC 3FQQA 1VQMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4O A;  4NB9 A;  1ZB8 A;  2PK7 A;  4A3C I;  3HOX I;  1WCM I;  1VLA A;  5IP7 I;  3S2D I;  3GCF A;  2JA7 I;  1L1O C;  4NBF A;  5C44 I;  4NBH A;  1I3Q I;  2NVY I;  3I07 A;  3HOV I;  3GTP I;  4QTT A;  3GTM S;  3M3Y I;  4A3E I;  4A3J I;  4NBE A;  3H0G I;  1SFO I;  1QYP A;  2J6A A;  2BJO A;  3HOZ I;  3Q87 A;  4BXX I;  3PO2 I;  4NBC A;  4A93 I;  3M4O I;  4A3K I;  2R92 I;  4A3F I;  3GTM I;  1TWG I;  3S1Q I;  4A3D I;  1WW9 A;  4BY1 I;  1USP A;  2JA6 I;  3FKI I;  3S1N I;  3K7A I;  1TWH I;  4NOZ A;  1R9T I;  4BBS I;  2E2J I;  2E2H I;  2VUM I;  4BY7 I;  4A3G I;  2NVQ I;  4Y7N I;  2DE7 A;  1RO4 A;  2F4M A;  3VMG A;  3GTQ I;  1I50 I;  3GTK I;  1USP B;  3GTO I;  1TWC I;  1X3W A;  2JA8 I;  4NB8 A;  3S17 I;  2YU9 I;  2R93 I;  3RZO I;  1LQL A;  3VMH A;  2NVX I;  1I6H I;  5C3E I;  4XX2 A;  2NVT I;  3S2H I;  4BBR I;  1X3Z A;  2E2I I;  3H3V J;  4Y52 I;  1TWA I;  4A3I I;  2JA5 I;  1PFT A;  3S14 I;  3D6W A;  2HF1 A;  1NUI A;  1N2F A;  3HOY I;  4A3B I;  1ML8 A;  2KPI A;  1TWF I;  4NBA A;  3GTL I;  4A3L I;  4MH4 A;  4A3M I;  2DE5 A;  5C4X I;  4X6A I;  3LUS A;  3GTJ I;  5C4J I;  3S15 I;  3VMI A;  1K83 I;  1ZB9 A;  4QTU A;  1DL6 A;  1RLY A;  3HOU I;  5FLM I;  1YUA A;  3CQZ I;  3VB9 A;  1Y1V I;  2K5R A;  1Y1V S;  3S1R I;  4NBD A;  3GKQ A;  3EER A;  2AKL A;  3S16 I;  3ESW A;  2JR6 A;  3RZD I;  2RBL A;  5IP9 I;  1Y1W I;  3PO3 I;  3PO3 S;  4NBB A;  1TFI A;  3HOW I;  3I4M I;  2JNY A;  3GTG I;  2P3Y A;  2JS4 A;  2B63 I;  3U50 C;  2DE6 A;  3I4N I;  5CM2 M;  4NBG A;  2R7Z I;  3S1M I; 
#chains in the Genus database with same CATH topology
 4NB9 A;  1ZB8 A;  3CC2 Z;  5LL6 f;  1VLA A;  5IP7 I;  3GCF A;  3IF8 A;  4NBH A;  3J81 b;  2O53 A;  4NBE A;  1SFO I;  3Q87 A;  4BXX I;  3PO2 I;  4A3K I;  2R92 I;  3CME 1;  3CCQ Z;  4MD8 A;  1YJW 1;  4A3D I;  1TWH I;  2IZ3 A;  3CCV Z;  3QWU A;  3CCL 1;  4BY7 I;  1VQK Z;  4A3G I;  2QRE B;  2F4M A;  3NFZ A;  3NH4 A;  1YUK A;  1X0T A;  3NDJ A;  2JA8 I;  1Q82 1;  3S17 I;  2JIM A;  2QLV B;  1Q86 1;  2R93 I;  3RZO I;  3VMH A;  3NDI A;  2NVT I;  3S2H I;  4BBR I;  2P28 A;  2OOX B;  3H3V J;  1S72 Z;  3CPW Z;  2G2K A;  1PFT A;  1Q81 2;  3CCU 1;  2HF1 A;  1VQO Z;  4NBA A;  2QEX Z;  3D2L A;  3GTL I;  5AN9 F;  3JAM f;  4A3M I;  1VQ6 1;  2DE5 A;  4X6A I;  3KIH A;  2OZK A;  5IT9 f;  1YJN 1;  4E2W A;  1ZB9 A;  2GTI A;  1WJ2 A;  1RLY A;  1AA6 A;  3CQZ I;  2Q4Z A;  1Q7Y 2;  3VB9 A;  1WII A;  2RPR A;  3S1R I;  3CCS 1;  2VF1 A;  4NBD A;  4DGL A;  3EER A;  1RNI A;  2IV2 X;  1RO2 A;  3CMA 1;  2OTJ 1;  1N8R 1;  1M90 2;  2LEX A;  3G4S Z;  1VQ4 1;  2LIY A;  5D1O B;  1K9M 1;  3I56 1;  1KD1 2;  3CCJ Z;  1TFI A;  2WB1 A;  1YHQ Z;  1K9M 2;  4NFR A;  1P9N A;  3CCE Z;  3U50 C;  2HU9 A;  2DE6 A;  4E30 A;  2H85 A;  3I4N I;  5CM2 M;  4NBG A;  2OTL 1;  1K8A 2;  1Q81 1;  2QA4 1;  1Z01 A;  1SIW A;  2QR1 B;  1YJ9 Z;  2VPW A;  4A3C I;  3G6E 1;  3S2D I;  2JA7 I;  4NBF A;  2JIO A;  1VQL Z;  1I3Q I;  3CCR Z;  4A3J I;  4E33 A;  3CCM 1;  3CC7 Z;  1YIT 1;  3G71 Z;  4A93 I;  3M4O I;  1QVF Y;  4MON A;  2JMO A;  4RV9 A;  4RVF A;  1W2B Z;  1YIJ Z;  3K7A I;  1YJW Z;  1JJ2 Z;  4NOZ A;  1R9T I;  4BBS I;  3CD6 Z;  4RVH A;  1YI2 1;  3OW2 Y;  3CCV 1;  1VQN Z;  1I50 I;  1VQK 1;  3GTO I;  1WZN A;  2YU9 I;  2ZAE B;  1LQL A;  5C3E I;  3BG0 B;  1W2B Y;  1KRL A;  1RO0 A;  4Y52 I;  1TWA I;  4A3I I;  3OW2 Z;  3S14 I;  3D6W A;  1NUI A;  1S72 1;  1VQ5 Z;  4A3B I;  1TWF I;  1K73 2;  1QXF A;  2M48 A;  3TE5 B;  5IT9 b;  5T6B A;  3S15 I;  3NH8 A;  3VMI A;  1VQ9 Z;  1DL6 A;  3HOU I;  3CXC Z;  2VPZ A;  1YUA A;  3KIF A;  2Y0S A;  2QRD B;  1Y1V S;  2R6M A;  4MD9 A;  2EGT A;  1KC8 2;  3I55 Z;  3CC4 1;  2O4H A;  3PO3 I;  1JJ2 Y;  2PMZ A;  4MD7 A;  1N8R 2;  2JIQ A;  2JNY A;  2Q51 A;  5FLX b;  2JS4 A;  1FDI A;  3CC2 1;  2RIQ A;  1NJI 1;  4RVD A;  4HGZ A;  1Q7Y 1;  2OTL Z;  3HOX I;  1WCM I;  2QA4 Z;  1Q82 2;  2V8J A;  1QVG Y;  3I07 A;  3HOV I;  3GTP I;  4QTT A;  3GTM S;  3M3Y I;  3H0G I;  4E2X A;  1QYP A;  2VPX A;  3TDH B;  1VQ7 1;  2J6A A;  2BJO A;  4NBC A;  1KD1 1;  4E31 A;  4A3F I;  2AYD A;  1YIT Z;  1TWG I;  5D1P A;  5D1O A;  3J81 f;  1USP A;  2JA6 I;  3CME Z;  3S1N I;  3CCQ 1;  1Q16 A;  4MXU A;  4HH4 A;  5A2Q f;  1K73 1;  1YIJ 1;  2NVQ I;  1QVG Z;  4Y7N I;  1RO4 A;  3VMG A;  3GTQ I;  3CCL Z;  3CD6 1;  3GTK I;  2VUG A;  1USP B;  1RQF A;  3HKZ A;  2W04 A;  2NVX I;  1I6H I;  4XX2 A;  2WAQ A;  2I3C A;  1X3Z A;  3VTN A;  2E2I I;  2JIR A;  2OOY B;  3JAM b;  1KC8 1;  2JA5 I;  1QVF Z;  1N2F A;  2KPI A;  1VQ8 Z;  1ZH1 A;  3FQM A;  3IR7 A;  3CCU Z;  1VQP Z;  4A3L I;  1VQ5 1;  1VQO 1;  4DQY B;  4MH4 A;  5C4X I;  2PM9 A;  2QEX 1;  3LUS A;  1Z03 A;  1VQ6 Z;  1K83 I;  3J80 f;  4E2Y A;  4QTU A;  2YAD A;  2VPY A;  1JWH C;  5FLM I;  1YJN Z;  2V8K A;  4AYB A;  2QRC B;  2K5R A;  1NJI 2;  1KQS Y;  3GKQ A;  2AKL A;  3NH5 A;  2JR6 A;  3G4S 1;  3MZK B;  4EWC A;  2RBL A;  2GU2 A;  5IP9 I;  5A2Q b;  3I56 Z;  3CMA Z;  3CCJ 1;  2LFU A;  3I55 1;  3CC4 Z;  4RVG A;  3D9X A;  1VQ4 Z;  1YHQ 1;  4DK1 A;  3GTG I;  4S1T A;  1KQS Z;  1VQM 1;  2B63 I;  1S7M A;  1M1K 2;  4CL1 A;  2R7Z I;  3CCE 1;  2V45 A;  3S1M I;  3G6E Z;  2F4O A;  1QF8 A;  3CXC Y;  2PK7 A;  1VQL 1;  2JIP A;  1YJ9 1;  1L1O C;  2RT9 A;  5C44 I;  3CC7 1;  2NVY I;  4A3E I;  4RS4 A;  2E7Z A;  3G71 1;  2KI7 B;  3T4N B;  3CCR 1;  3HOZ I;  3CPW Y;  2RHB A;  3CCM Z;  1VQ7 Z;  4NH1 C;  3F3F C;  1Y8C A;  4E2Z A;  3GTM I;  1WW9 A;  4BY1 I;  3S1Q I;  1Z02 A;  3FKI I;  1YI2 Z;  4MRI A;  1VQN 1;  2E2J I;  2E2H I;  2VUM I;  4TNU A;  2JUB A;  2DE7 A;  3MZL B;  3BG1 B;  2K3R A;  1TWC I;  1X3W A;  4NB8 A;  3IX0 A;  2NAP A;  1M90 1;  2E9H A;  1M1K 1;  2IZ4 A;  3MON A;  3HOY I;  3IFU A;  1ML8 A;  2V8I A;  1NP6 A;  1VQ9 1;  1VQ8 1;  3GTJ I;  5C4J I;  1VQP 1;  4HGY A;  5T67 A;  1Q86 2;  3CCS Z;  3EED A;  1K8A 1;  1Y1V I;  2M6N A;  2QKD A;  2OTJ Z;  3S16 I;  2W03 A;  3ESW A;  3RZD I;  2GTH A;  3P5J B;  5T64 A;  3J80 b;  1Y1W I;  5FLX f;  2V3V A;  3PO3 S;  1FDO A;  3J7A 4;  4NBB A;  4E32 A;  3HOW I;  3I4M I;  2P3Y A;  3F3P C;  3FQQ A;  1VQM Z; 
#chains in the Genus database with same CATH homology
 4NB9 A;  1ZB8 A;  3CC2 Z;  5LL6 f;  1VLA A;  5IP7 I;  3GCF A;  3IF8 A;  4NBH A;  3J81 b;  2O53 A;  4NBE A;  1SFO I;  3Q87 A;  4BXX I;  3PO2 I;  4A3K I;  2R92 I;  3CME 1;  3CCQ Z;  4MD8 A;  1YJW 1;  4A3D I;  1TWH I;  2IZ3 A;  3CCV Z;  3QWU A;  3CCL 1;  4BY7 I;  1VQK Z;  4A3G I;  2QRE B;  2F4M A;  3NFZ A;  3NH4 A;  1YUK A;  1X0T A;  3NDJ A;  2JA8 I;  1Q82 1;  3S17 I;  2QLV B;  1Q86 1;  2R93 I;  3RZO I;  3VMH A;  3NDI A;  2NVT I;  3S2H I;  4BBR I;  2P28 A;  2OOX B;  3H3V J;  1S72 Z;  3CPW Z;  2G2K A;  1PFT A;  1Q81 2;  3CCU 1;  2HF1 A;  1VQO Z;  4NBA A;  2QEX Z;  3GTL I;  5AN9 F;  3JAM f;  4A3M I;  1VQ6 1;  2DE5 A;  4X6A I;  3KIH A;  2OZK A;  5IT9 f;  1YJN 1;  4E2W A;  1ZB9 A;  2GTI A;  1RLY A;  1Q7Y 2;  2Q4Z A;  3CQZ I;  3VB9 A;  1WII A;  2RPR A;  3S1R I;  3CCS 1;  2VF1 A;  4NBD A;  4DGL A;  3EER A;  1RNI A;  1RO2 A;  3CMA 1;  2OTJ 1;  1N8R 1;  1M90 2;  3G4S Z;  1VQ4 1;  2LIY A;  5D1O B;  1K9M 1;  3I56 1;  1KD1 2;  3CCJ Z;  1TFI A;  2WB1 A;  1YHQ Z;  1K9M 2;  4NFR A;  1P9N A;  3CCE Z;  3U50 C;  2HU9 A;  2DE6 A;  4E30 A;  2H85 A;  3I4N I;  5CM2 M;  4NBG A;  2OTL 1;  1K8A 2;  1Q81 1;  2QA4 1;  1Z01 A;  2QR1 B;  1YJ9 Z;  4A3C I;  3G6E 1;  3S2D I;  2JA7 I;  4NBF A;  1VQL Z;  1I3Q I;  3CCR Z;  4A3J I;  4E33 A;  3CCM 1;  3CC7 Z;  1YIT 1;  3G71 Z;  4A93 I;  3M4O I;  1QVF Y;  4MON A;  2JMO A;  4RV9 A;  4RVF A;  1W2B Z;  1YIJ Z;  3K7A I;  1YJW Z;  1JJ2 Z;  4NOZ A;  1R9T I;  4BBS I;  3CD6 Z;  4RVH A;  1YI2 1;  3OW2 Y;  3CCV 1;  1VQN Z;  1I50 I;  1VQK 1;  3GTO I;  2YU9 I;  2ZAE B;  1LQL A;  5C3E I;  3BG0 B;  1W2B Y;  1KRL A;  1RO0 A;  4Y52 I;  1TWA I;  4A3I I;  3OW2 Z;  3S14 I;  3D6W A;  1NUI A;  1S72 1;  1VQ5 Z;  4A3B I;  1TWF I;  1K73 2;  2M48 A;  3TE5 B;  5IT9 b;  5T6B A;  3S15 I;  3NH8 A;  3VMI A;  1VQ9 Z;  1DL6 A;  3HOU I;  3CXC Z;  1YUA A;  3KIF A;  2Y0S A;  2QRD B;  1Y1V S;  2R6M A;  4MD9 A;  2EGT A;  1KC8 2;  3I55 Z;  3CC4 1;  2O4H A;  3PO3 I;  1JJ2 Y;  2PMZ A;  4MD7 A;  1N8R 2;  2JNY A;  2Q51 A;  5FLX b;  2JS4 A;  3CC2 1;  2RIQ A;  1NJI 1;  4RVD A;  4HGZ A;  1Q7Y 1;  2OTL Z;  3HOX I;  1WCM I;  2QA4 Z;  1Q82 2;  2V8J A;  1QVG Y;  3I07 A;  3HOV I;  3GTP I;  4QTT A;  3GTM S;  3M3Y I;  3H0G I;  4E2X A;  1QYP A;  3TDH B;  1VQ7 1;  2J6A A;  2BJO A;  4NBC A;  1KD1 1;  4E31 A;  4A3F I;  3J81 f;  1TWG I;  5D1P A;  5D1O A;  1YIT Z;  1USP A;  2JA6 I;  3CME Z;  3S1N I;  3CCQ 1;  4MXU A;  4HH4 A;  5A2Q f;  1K73 1;  1YIJ 1;  2NVQ I;  1QVG Z;  4Y7N I;  1RO4 A;  3VMG A;  3GTQ I;  3CCL Z;  3CD6 1;  3GTK I;  2VUG A;  1USP B;  1RQF A;  3HKZ A;  2W04 A;  2NVX I;  1I6H I;  4XX2 A;  2WAQ A;  2I3C A;  1X3Z A;  3VTN A;  2E2I I;  2OOY B;  3JAM b;  1KC8 1;  2JA5 I;  1QVF Z;  1N2F A;  2KPI A;  1VQ8 Z;  1ZH1 A;  3FQM A;  3CCU Z;  1VQP Z;  4A3L I;  1VQ5 1;  1VQO 1;  4DQY B;  4MH4 A;  5C4X I;  2PM9 A;  2QEX 1;  3LUS A;  1Z03 A;  1VQ6 Z;  1K83 I;  3J80 f;  4E2Y A;  4QTU A;  2YAD A;  1JWH C;  5FLM I;  1YJN Z;  2V8K A;  4AYB A;  2QRC B;  2K5R A;  1NJI 2;  1KQS Y;  3GKQ A;  2AKL A;  3NH5 A;  2JR6 A;  3G4S 1;  3MZK B;  4EWC A;  2RBL A;  2GU2 A;  5IP9 I;  5A2Q b;  3I56 Z;  3CMA Z;  3CCJ 1;  2LFU A;  3I55 1;  3CC4 Z;  4RVG A;  3D9X A;  1VQ4 Z;  1YHQ 1;  4DK1 A;  3GTG I;  4S1T A;  1KQS Z;  1VQM 1;  2B63 I;  1S7M A;  1M1K 2;  4CL1 A;  2R7Z I;  3CCE 1;  3S1M I;  3G6E Z;  2F4O A;  1QF8 A;  3CXC Y;  2PK7 A;  1VQL 1;  1YJ9 1;  1L1O C;  2RT9 A;  5C44 I;  3CC7 1;  2NVY I;  4A3E I;  4RS4 A;  3G71 1;  2KI7 B;  3T4N B;  3CCR 1;  3HOZ I;  3CPW Y;  2RHB A;  3CCM Z;  1VQ7 Z;  4NH1 C;  3F3F C;  4E2Z A;  3GTM I;  3S1Q I;  1WW9 A;  4BY1 I;  1Z02 A;  3FKI I;  1YI2 Z;  4MRI A;  1VQN 1;  2E2J I;  2E2H I;  2VUM I;  4TNU A;  2JUB A;  2DE7 A;  3MZL B;  3BG1 B;  2K3R A;  1TWC I;  1X3W A;  4NB8 A;  3IX0 A;  1M90 1;  2E9H A;  1M1K 1;  2IZ4 A;  3MON A;  3HOY I;  3IFU A;  1ML8 A;  2V8I A;  1NP6 A;  1VQ9 1;  1VQ8 1;  3GTJ I;  5C4J I;  1VQP 1;  4HGY A;  5T67 A;  1Q86 2;  3CCS Z;  3EED A;  1K8A 1;  1Y1V I;  2M6N A;  2QKD A;  2OTJ Z;  3S16 I;  2W03 A;  3ESW A;  3RZD I;  2GTH A;  3P5J B;  5T64 A;  3J80 b;  1Y1W I;  5FLX f;  3PO3 S;  3J7A 4;  4NBB A;  4E32 A;  3HOW I;  3I4M I;  2P3Y A;  3F3P C;  3FQQ A;  1VQM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...