3S1NI

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1nI02
2R92I 4NBHA 5IP7I 2F4MA 2PK7A 3VMHA 4A3II 4BY7I 4X6AI 3HOVI 1X3ZA 3HOZI 1RO4A 1TWAI 5C4XI 3RZOI 4A3BI 4QTTA 1USPA 3HOYI 1TWGI 3D6WA 4QTUA 2R93I 2DE6A 3GTMS 2JA7I 1N2FA 4A3FI 2VUMI 3VB9A 3GTLI 3ESWA 3FKII 2YU9I 2DE5A 4XX2A 1TWCI 2E2HI 1PFTA 1TFIA 4NB9A 2JS4A 4A3CI 1USPB 1ZB9A 1NUIA 2P3YA 5C44I 3S17I 3VMGA 4Y7NI 3H3VJ 3S1RI 4NBEA 2B63I 3K7AI 3S1MI 1X3WA 2DE7A 4BY1I 2NVYI 2E2JI 4NBGA 5FLMI 3VMIA 2HF1A 3I4NI 3S16I 3GTMI 4A3GI 1TWFI 3H0GI 2NVQI 5C4JI 4BBSI 1QYPA 4A3KI 3S14I 1L1OC 2NVXI 1WCMI 4A3JI 4MH4A 4A93I 3HOWI 1Y1VI 3S15I 3I4MI 3CQZI 3RZDI 1Y1WI 4NBAA 4Y52I 4NOZA 1LQLA 2JR6A 3GTGI 2RBLA 2JNYA 4A3MI 3HOXI 1WW9A 3Q87A 3PO3S 3GCFA 2AKLA 2J6AA 4NBFA 3GTOI 1SFOI 2JA8I 4BXXI 2JA5I 1Y1VS 2BJOA 5IP9I 3S2DI 2F4OA 1ZB8A 3EERA 3GTPI 3U50C 3S2HI 4A3LI 2E2II 5CM2M 2NVTI 1YUAA 3S1NI 3LUSA 4NBDA 3GTKI 2JA6I 3PO3I 2KPIA 3M4OI 3M3YI 3S1QI 1DL6A 3GKQA 1RLYA 1TWHI 3PO2I 4NB8A 1I3QI 2R7ZI 3GTJI 4BBRI 5C3EI 1VLAA 3HOUI 1K83I 4A3DI 3GTQI 4A3EI 1R9TI 4NBCA 3I07A 1ML8A 1I50I 2K5RA 1I6HI 4NBBA
chains in the Genus database with same CATH superfamily
3KIFA 2GTHA 2JIMA 4BY7I 1VQ41 3G4SZ 4A3BI 2IZ3A 2QREB 3IFUA 3I551 2VPWA 4E2ZA 1TWGI 4QTUA 3CCQ1 3GTMS 2JA7I 3VB9A 3ESWA 2QA4Z 1TWCI 2E2HI 1NJI2 4NB9A 2JS4A 4A3CI 3QWUA 1K8A2 1K9M2 3D9XA 2P3YA 4Y7NI 3FQMA 1S721 3VMIA 1VQNZ 1TWFI 3CME1 1YJNZ 3CCJ1 2PMZA 1VQ91 2VUGA 4MD8A 2YADA 1QYPA 1L1OC 3CCE1 1WCMI 4MH4A 2VPXA 3HOWI 3NDIA 4NFRA 5FLXf 2R6MA 3CQZI 1KD12 1K8A1 4NBAA 1M1K1 2JR6A 3PO3S 2W03A 4NBFA 3HKZA 3CCSZ 1Q821 2LEXA 1N8R1 5IT9b 1QVFY 3CCRZ 3CCLZ 2OTJ1 2IV2X 3CMA1 2BJOA 5IP9I 3CC4Z 3GTPI 3CCV1 1M902 3S2HI 5D1PA 1K732 3TDHB 3CCM1 2NVTI 1NP6A 1YUAA 3LUSA 3GTKI 2KPIA 1VQO1 2QEXZ 2GTIA 1VQMZ 2V8KA 1Q811 3CC2Z 1TWHI 1QVFZ 5IT9f 4NB8A 4BBRI 3J7A4 3G711 4A3DI 4E31A 1VQP1 2JIPA 4AYBA 2V8JA 2WAQA 1VQ71 2K5RA 2OTLZ 3I56Z 3IX0A 4NBBA 2R92I 1YHQ1 4NBHA 1VQLZ 2W04A 3VMHA 5A2Qf 3HOVI 1X3ZA 3RZOI 4MD7A 2EGTA 4E32A 1USPA 2E9HA 2V3VA 3EEDA 4MD9A 1QXFA 5LL6f 2DE6A 3JAMf 2JMOA 4E33A 2VUMI 2HU9A 1Y8CA 1W2BZ 2YU9I 1VQ51 2DE5A 4XX2A 3VTNA 1YIJ1 3KIHA 4TNUA 5C44I 3S17I 4S1TA 3H3VJ 4NBEA 3CD6Z 3CC71 2B63I 4BY1I 2IZ4A 2E2JI 2QA41 4NBGA 2OOXB 4A3GI 2JIRA 1W2BY 2NVQI 4A3KI 3J80f 1S72Z 3F3FC 4A93I 2QR1B 1JWHC 3S15I 3I4MI 1YITZ 3CMEZ 1YJN1 4NOZA 1VQ9Z 2RBLA 2H85A 1YI21 1RO0A 4A3MI 1YJW1 2V8IA 1S7MA 3GCFA 2AKLA 3CCU1 4DGLA 4NH1C 2O4HA 2M48A 3JAMb 1QVGZ 3D2LA 2QLVB 3NH4A 1SFOI 2JA5I 4BXXI 5FLXb 4HGZA 1ZB8A 3NH5A 4E2WA 1WIIA 1Q7Y2 1VQ61 2QRDB 3CCL1 3BG0B 3CC41 3G6EZ 1QVGY 3NH8A 1YJ9Z 1P9NA 1QF8A 3CPWZ 1M901 3HOUI 1K83I 3G4S1 3GTQI 1VQ8Z 4NBCA 1ML8A 1I50I 2QEX1 1VQM1 1VQOZ 3CXCY 2M6NA 1I6HI 5IP7I 3P5JB 5T64A 2PK7A 3CCQZ 4X6AI 1TWAI 5C4XI 1ZH1A 2VPYA 1VQPZ 1Q7Y1 2VPZA 2QKDA 2PM9A 2OTL1 4QTTA 3CPWY 1Z01A 3D6WA 3NFZA 1WJ2A 2RIQA 2R93I 2ZAEB 1RO2A 2O53A 1NJI1 3CXCZ 4A3FI 1VQ4Z 1K9M1 2JIQA 1JJ2Y 3FKII 2I3CA 3OW2Z 1TFIA 2RT9A 4E2XA 1USPB 1ZB9A 3IF8A 4MRIA 3CCJZ 3T4NB 3VMGA 3S1RI 3K7AI 2DE7A 3CCEZ 4E30A 2RPRA 3S16I 4MONA 1JJ2Z 3OW2Y 1YIJZ 4BBSI 3CD61 3CC7Z 2NVXI 4A3JI 5T6BA 2WB1A 1VQN1 1VQK1 3J81f 3CCS1 3IR7A 4Y52I 2QRCB 2GU2A 1Q822 1N8R2 3GTGI 3CCR1 3HOXI 2OTJZ 3Q87A 1M1K2 3CCMZ 2JA8I 1K731 1YI2Z 1KQSZ 3BG1B 3CCUZ 1Y1VS 3CC21 3U50C 3J80b 4MXUA 2E2II 5CM2M 3FQQA 3S1NI 3MZLB 4NBDA 2JA6I 1VQ7Z 3M3YI 3S1QI 2P28A 3CMAZ 3GKQA 3I561 1YUKA 1RLYA 4RS4A 1KQSY 2G2KA 2R7ZI 3GTJI 4RVFA 2E7ZA 3MONA 1SIWA 1VQ6Z 4A3EI 3I55Z 3I07A 4RVDA 2K3RA 4CL1A 2F4MA 4A3II 3HOZI 1RO4A 4RVGA 1AA6A 1VQ81 1X0TA 1Z03A 3HOYI 1N2FA 2VF1A 3GTLI 1FDOA 5D1OB 1KC82 4HGYA 1Q861 1PFTA 5D1OA 4DK1A 1NUIA 2JUBA 3S1MI 5A2Qb 1X3WA 2NVYI 1VQ5Z 5FLMI 2HF1A 2Q4ZA 3F3PC 4RVHA 3I4NI 3GTMI 3H0GI 2NAPA 2OOYB 5C4JI 3S14I 1KC81 1Y1VI 1KD11 1Q862 3RZDI 1Y1WI 1RNIA 4HH4A 1Z02A 1LQLA 2Y0SA 2V45A 2JNYA 1WW9A 2JIOA 2Q51A 3NDJA 2J6AA 3CCVZ 1VQKZ 1YIT1 1RQFA 3GTOI 2AYDA 1KRLA 1Q812 3J81b 1YJWZ 2OZKA 1WZNA 5T67A 3S2DI 2F4OA 2LIYA 3EERA 3G6E1 1YJ91 4A3LI 5AN9F 2LFUA 2RHBA 3G71Z 3PO3I 1Q16A 3M4OI 1DL6A 1YHQZ 4RV9A 3PO2I 4EWCA 1I3QI 2KI7B 4DQYB 1VQL1 3MZKB 5C3EI 1FDIA 1VLAA 3TE5B 4E2YA 1R9TI
chains in the Genus database with same CATH topology
3KIFA 2GTHA 4BY7I 1VQ41 3G4SZ 4A3BI 2IZ3A 2QREB 3IFUA 3I551 4E2ZA 1TWGI 4QTUA 3CCQ1 3GTMS 2JA7I 3VB9A 3ESWA 2QA4Z 1TWCI 2E2HI 1NJI2 4NB9A 2JS4A 4A3CI 3QWUA 1K8A2 1K9M2 3D9XA 2P3YA 4Y7NI 3FQMA 1S721 3VMIA 1VQNZ 1TWFI 3CME1 1YJNZ 3CCJ1 2PMZA 1VQ91 2VUGA 4MD8A 2YADA 1QYPA 1L1OC 3CCE1 1WCMI 4MH4A 3HOWI 3NDIA 4NFRA 5FLXf 2R6MA 3CQZI 1KD12 1K8A1 4NBAA 1M1K1 2JR6A 3PO3S 2W03A 4NBFA 3HKZA 3CCSZ 1Q821 1N8R1 5IT9b 1QVFY 3CCRZ 3CCLZ 2OTJ1 3CMA1 2BJOA 5IP9I 3CC4Z 3GTPI 3CCV1 1M902 3S2HI 5D1PA 1K732 3TDHB 3CCM1 2NVTI 1NP6A 1YUAA 3LUSA 3GTKI 2KPIA 1VQO1 2QEXZ 2GTIA 1VQMZ 2V8KA 1Q811 3CC2Z 1TWHI 1QVFZ 5IT9f 4NB8A 4BBRI 3J7A4 3G711 4A3DI 4E31A 1VQP1 4AYBA 2V8JA 2WAQA 1VQ71 2K5RA 2OTLZ 3I56Z 3IX0A 4NBBA 2R92I 1YHQ1 4NBHA 1VQLZ 2W04A 3VMHA 5A2Qf 3HOVI 1X3ZA 3RZOI 4MD7A 2EGTA 4E32A 1USPA 2E9HA 3EEDA 4MD9A 5LL6f 2DE6A 3JAMf 2JMOA 4E33A 2VUMI 2HU9A 1W2BZ 2YU9I 1VQ51 2DE5A 4XX2A 3VTNA 1YIJ1 3KIHA 4TNUA 5C44I 3S17I 4S1TA 3H3VJ 4NBEA 3CD6Z 3CC71 2B63I 4BY1I 2IZ4A 2E2JI 2QA41 4NBGA 2OOXB 4A3GI 1W2BY 2NVQI 4A3KI 3J80f 1S72Z 3F3FC 4A93I 2QR1B 1JWHC 3S15I 3I4MI 1YITZ 3CMEZ 1YJN1 4NOZA 1VQ9Z 2RBLA 2H85A 1YI21 1YJW1 1RO0A 4A3MI 2V8IA 1S7MA 3GCFA 2AKLA 3CCU1 4DGLA 4NH1C 2O4HA 2M48A 3JAMb 1QVGZ 1SFOI 2QLVB 3NH4A 4BXXI 2JA5I 5FLXb 4HGZA 1ZB8A 3NH5A 4E2WA 1WIIA 1Q7Y2 1VQ61 2QRDB 3CCL1 3BG0B 3CC41 3G6EZ 1QVGY 3NH8A 1YJ9Z 1P9NA 1QF8A 3CPWZ 1M901 3HOUI 1K83I 3G4S1 3GTQI 1VQ8Z 4NBCA 1ML8A 1I50I 2QEX1 1VQM1 1VQOZ 3CXCY 2M6NA 1I6HI 5IP7I 3P5JB 5T64A 2PK7A 3CCQZ 4X6AI 1TWAI 5C4XI 1ZH1A 1VQPZ 1Q7Y1 2QKDA 2PM9A 2OTL1 4QTTA 3CPWY 1Z01A 3D6WA 3NFZA 2RIQA 2R93I 2ZAEB 1RO2A 2O53A 1NJI1 3CXCZ 4A3FI 1VQ4Z 1K9M1 1JJ2Y 3FKII 2I3CA 3OW2Z 1TFIA 2RT9A 4E2XA 1USPB 1ZB9A 3IF8A 4MRIA 3CCJZ 3T4NB 3VMGA 3S1RI 3K7AI 2DE7A 3CCEZ 4E30A 2RPRA 3S16I 4MONA 1JJ2Z 3OW2Y 1YIJZ 4BBSI 3CD61 3CC7Z 2NVXI 4A3JI 5T6BA 2WB1A 1VQN1 1VQK1 3J81f 3CCS1 4Y52I 2QRCB 2GU2A 1Q822 1N8R2 3GTGI 3CCR1 3HOXI 2OTJZ 3Q87A 1M1K2 3CCMZ 2JA8I 1K731 1YI2Z 1KQSZ 3BG1B 3CCUZ 1Y1VS 3CC21 3U50C 3J80b 4MXUA 2E2II 5CM2M 3FQQA 3S1NI 3MZLB 4NBDA 2JA6I 1VQ7Z 3M3YI 3S1QI 2P28A 3CMAZ 3GKQA 3I561 1YUKA 1RLYA 4RS4A 1KQSY 2G2KA 2R7ZI 3GTJI 4RVFA 3MONA 1VQ6Z 4A3EI 3I55Z 3I07A 4RVDA 2K3RA 4CL1A 2F4MA 4A3II 3HOZI 1RO4A 4RVGA 1VQ81 1X0TA 1Z03A 3HOYI 1N2FA 2VF1A 3GTLI 5D1OB 1KC82 4HGYA 1Q861 1PFTA 5D1OA 4DK1A 1NUIA 2JUBA 3S1MI 5A2Qb 1X3WA 2NVYI 1VQ5Z 5FLMI 2HF1A 2Q4ZA 3F3PC 4RVHA 3I4NI 3GTMI 3H0GI 2OOYB 5C4JI 3S14I 1KC81 1Y1VI 1KD11 1Q862 3RZDI 1Y1WI 1RNIA 4HH4A 1Z02A 1LQLA 2Y0SA 2JNYA 1WW9A 2Q51A 3NDJA 2J6AA 3CCVZ 1VQKZ 1YIT1 1RQFA 3GTOI 1KRLA 1Q812 3J81b 1YJWZ 2OZKA 5T67A 3S2DI 2F4OA 2LIYA 3EERA 3G6E1 1YJ91 4A3LI 5AN9F 2LFUA 2RHBA 3G71Z 3PO3I 3M4OI 1DL6A 1YHQZ 4RV9A 3PO2I 4EWCA 1I3QI 2KI7B 4DQYB 1VQL1 3MZKB 5C3EI 1VLAA 3TE5B 4E2YA 1R9TI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 I;  4NBH A;  5IP7 I;  2F4M A;  2PK7 A;  3VMH A;  4A3I I;  4BY7 I;  4X6A I;  3HOV I;  1X3Z A;  3HOZ I;  1RO4 A;  1TWA I;  5C4X I;  3RZO I;  4A3B I;  4QTT A;  1USP A;  3HOY I;  1TWG I;  3D6W A;  4QTU A;  2R93 I;  2DE6 A;  3GTM S;  2JA7 I;  1N2F A;  4A3F I;  2VUM I;  3VB9 A;  3GTL I;  3ESW A;  3FKI I;  2YU9 I;  2DE5 A;  4XX2 A;  1TWC I;  2E2H I;  1PFT A;  1TFI A;  4NB9 A;  2JS4 A;  4A3C I;  1USP B;  1ZB9 A;  1NUI A;  2P3Y A;  5C44 I;  3S17 I;  3VMG A;  4Y7N I;  3H3V J;  3S1R I;  4NBE A;  2B63 I;  3K7A I;  3S1M I;  1X3W A;  2DE7 A;  4BY1 I;  2NVY I;  2E2J I;  4NBG A;  5FLM I;  3VMI A;  2HF1 A;  3I4N I;  3S16 I;  3GTM I;  4A3G I;  1TWF I;  3H0G I;  2NVQ I;  5C4J I;  4BBS I;  1QYP A;  4A3K I;  3S14 I;  1L1O C;  2NVX I;  1WCM I;  4A3J I;  4MH4 A;  4A93 I;  3HOW I;  1Y1V I;  3S15 I;  3I4M I;  3CQZ I;  3RZD I;  1Y1W I;  4NBA A;  4Y52 I;  4NOZ A;  1LQL A;  2JR6 A;  3GTG I;  2RBL A;  2JNY A;  4A3M I;  3HOX I;  1WW9 A;  3Q87 A;  3PO3 S;  3GCF A;  2AKL A;  2J6A A;  4NBF A;  3GTO I;  1SFO I;  2JA8 I;  4BXX I;  2JA5 I;  1Y1V S;  2BJO A;  5IP9 I;  3S2D I;  2F4O A;  1ZB8 A;  3EER A;  3GTP I;  3U50 C;  3S2H I;  4A3L I;  2E2I I;  5CM2 M;  2NVT I;  1YUA A;  3S1N I;  3LUS A;  4NBD A;  3GTK I;  2JA6 I;  3PO3 I;  2KPI A;  3M4O I;  3M3Y I;  3S1Q I;  1DL6 A;  3GKQ A;  1RLY A;  1TWH I;  3PO2 I;  4NB8 A;  1I3Q I;  2R7Z I;  3GTJ I;  4BBR I;  5C3E I;  1VLA A;  3HOU I;  1K83 I;  4A3D I;  3GTQ I;  4A3E I;  1R9T I;  4NBC A;  3I07 A;  1ML8 A;  1I50 I;  2K5R A;  1I6H I;  4NBB A; 
#chains in the Genus database with same CATH topology
 3KIF A;  2GTH A;  2JIM A;  4BY7 I;  1VQ4 1;  3G4S Z;  4A3B I;  2IZ3 A;  2QRE B;  3IFU A;  3I55 1;  2VPW A;  4E2Z A;  1TWG I;  4QTU A;  3CCQ 1;  3GTM S;  2JA7 I;  3VB9 A;  3ESW A;  2QA4 Z;  1TWC I;  2E2H I;  1NJI 2;  4NB9 A;  2JS4 A;  4A3C I;  3QWU A;  1K8A 2;  1K9M 2;  3D9X A;  2P3Y A;  4Y7N I;  3FQM A;  1S72 1;  3VMI A;  1VQN Z;  1TWF I;  3CME 1;  1YJN Z;  3CCJ 1;  2PMZ A;  1VQ9 1;  2VUG A;  4MD8 A;  2YAD A;  1QYP A;  1L1O C;  3CCE 1;  1WCM I;  4MH4 A;  2VPX A;  3HOW I;  3NDI A;  4NFR A;  5FLX f;  2R6M A;  3CQZ I;  1KD1 2;  1K8A 1;  4NBA A;  1M1K 1;  2JR6 A;  3PO3 S;  2W03 A;  4NBF A;  3HKZ A;  3CCS Z;  1Q82 1;  2LEX A;  1N8R 1;  5IT9 b;  1QVF Y;  3CCR Z;  3CCL Z;  2OTJ 1;  2IV2 X;  3CMA 1;  2BJO A;  5IP9 I;  3CC4 Z;  3GTP I;  3CCV 1;  1M90 2;  3S2H I;  5D1P A;  1K73 2;  3TDH B;  3CCM 1;  2NVT I;  1NP6 A;  1YUA A;  3LUS A;  3GTK I;  2KPI A;  1VQO 1;  2QEX Z;  2GTI A;  1VQM Z;  2V8K A;  1Q81 1;  3CC2 Z;  1TWH I;  1QVF Z;  5IT9 f;  4NB8 A;  4BBR I;  3J7A 4;  3G71 1;  4A3D I;  4E31 A;  1VQP 1;  2JIP A;  4AYB A;  2V8J A;  2WAQ A;  1VQ7 1;  2K5R A;  2OTL Z;  3I56 Z;  3IX0 A;  4NBB A;  2R92 I;  1YHQ 1;  4NBH A;  1VQL Z;  2W04 A;  3VMH A;  5A2Q f;  3HOV I;  1X3Z A;  3RZO I;  4MD7 A;  2EGT A;  4E32 A;  1USP A;  2E9H A;  2V3V A;  3EED A;  4MD9 A;  1QXF A;  5LL6 f;  2DE6 A;  3JAM f;  2JMO A;  4E33 A;  2VUM I;  2HU9 A;  1Y8C A;  1W2B Z;  2YU9 I;  1VQ5 1;  2DE5 A;  4XX2 A;  3VTN A;  1YIJ 1;  3KIH A;  4TNU A;  5C44 I;  3S17 I;  4S1T A;  3H3V J;  4NBE A;  3CD6 Z;  3CC7 1;  2B63 I;  4BY1 I;  2IZ4 A;  2E2J I;  2QA4 1;  4NBG A;  2OOX B;  4A3G I;  2JIR A;  1W2B Y;  2NVQ I;  4A3K I;  3J80 f;  1S72 Z;  3F3F C;  4A93 I;  2QR1 B;  1JWH C;  3S15 I;  3I4M I;  1YIT Z;  3CME Z;  1YJN 1;  4NOZ A;  1VQ9 Z;  2RBL A;  2H85 A;  1YI2 1;  1RO0 A;  4A3M I;  1YJW 1;  2V8I A;  1S7M A;  3GCF A;  2AKL A;  3CCU 1;  4DGL A;  4NH1 C;  2O4H A;  2M48 A;  3JAM b;  1QVG Z;  3D2L A;  2QLV B;  3NH4 A;  1SFO I;  2JA5 I;  4BXX I;  5FLX b;  4HGZ A;  1ZB8 A;  3NH5 A;  4E2W A;  1WII A;  1Q7Y 2;  1VQ6 1;  2QRD B;  3CCL 1;  3BG0 B;  3CC4 1;  3G6E Z;  1QVG Y;  3NH8 A;  1YJ9 Z;  1P9N A;  1QF8 A;  3CPW Z;  1M90 1;  3HOU I;  1K83 I;  3G4S 1;  3GTQ I;  1VQ8 Z;  4NBC A;  1ML8 A;  1I50 I;  2QEX 1;  1VQM 1;  1VQO Z;  3CXC Y;  2M6N A;  1I6H I;  5IP7 I;  3P5J B;  5T64 A;  2PK7 A;  3CCQ Z;  4X6A I;  1TWA I;  5C4X I;  1ZH1 A;  2VPY A;  1VQP Z;  1Q7Y 1;  2VPZ A;  2QKD A;  2PM9 A;  2OTL 1;  4QTT A;  3CPW Y;  1Z01 A;  3D6W A;  3NFZ A;  1WJ2 A;  2RIQ A;  2R93 I;  2ZAE B;  1RO2 A;  2O53 A;  1NJI 1;  3CXC Z;  4A3F I;  1VQ4 Z;  1K9M 1;  2JIQ A;  1JJ2 Y;  3FKI I;  2I3C A;  3OW2 Z;  1TFI A;  2RT9 A;  4E2X A;  1USP B;  1ZB9 A;  3IF8 A;  4MRI A;  3CCJ Z;  3T4N B;  3VMG A;  3S1R I;  3K7A I;  2DE7 A;  3CCE Z;  4E30 A;  2RPR A;  3S16 I;  4MON A;  1JJ2 Z;  3OW2 Y;  1YIJ Z;  4BBS I;  3CD6 1;  3CC7 Z;  2NVX I;  4A3J I;  5T6B A;  2WB1 A;  1VQN 1;  1VQK 1;  3J81 f;  3CCS 1;  3IR7 A;  4Y52 I;  2QRC B;  2GU2 A;  1Q82 2;  1N8R 2;  3GTG I;  3CCR 1;  3HOX I;  2OTJ Z;  3Q87 A;  1M1K 2;  3CCM Z;  2JA8 I;  1K73 1;  1YI2 Z;  1KQS Z;  3BG1 B;  3CCU Z;  1Y1V S;  3CC2 1;  3U50 C;  3J80 b;  4MXU A;  2E2I I;  5CM2 M;  3FQQ A;  3S1N I;  3MZL B;  4NBD A;  2JA6 I;  1VQ7 Z;  3M3Y I;  3S1Q I;  2P28 A;  3CMA Z;  3GKQ A;  3I56 1;  1YUK A;  1RLY A;  4RS4 A;  1KQS Y;  2G2K A;  2R7Z I;  3GTJ I;  4RVF A;  2E7Z A;  3MON A;  1SIW A;  1VQ6 Z;  4A3E I;  3I55 Z;  3I07 A;  4RVD A;  2K3R A;  4CL1 A;  2F4M A;  4A3I I;  3HOZ I;  1RO4 A;  4RVG A;  1AA6 A;  1VQ8 1;  1X0T A;  1Z03 A;  3HOY I;  1N2F A;  2VF1 A;  3GTL I;  1FDO A;  5D1O B;  1KC8 2;  4HGY A;  1Q86 1;  1PFT A;  5D1O A;  4DK1 A;  1NUI A;  2JUB A;  3S1M I;  5A2Q b;  1X3W A;  2NVY I;  1VQ5 Z;  5FLM I;  2HF1 A;  2Q4Z A;  3F3P C;  4RVH A;  3I4N I;  3GTM I;  3H0G I;  2NAP A;  2OOY B;  5C4J I;  3S14 I;  1KC8 1;  1Y1V I;  1KD1 1;  1Q86 2;  3RZD I;  1Y1W I;  1RNI A;  4HH4 A;  1Z02 A;  1LQL A;  2Y0S A;  2V45 A;  2JNY A;  1WW9 A;  2JIO A;  2Q51 A;  3NDJ A;  2J6A A;  3CCV Z;  1VQK Z;  1YIT 1;  1RQF A;  3GTO I;  2AYD A;  1KRL A;  1Q81 2;  3J81 b;  1YJW Z;  2OZK A;  1WZN A;  5T67 A;  3S2D I;  2F4O A;  2LIY A;  3EER A;  3G6E 1;  1YJ9 1;  4A3L I;  5AN9 F;  2LFU A;  2RHB A;  3G71 Z;  3PO3 I;  1Q16 A;  3M4O I;  1DL6 A;  1YHQ Z;  4RV9 A;  3PO2 I;  4EWC A;  1I3Q I;  2KI7 B;  4DQY B;  1VQL 1;  3MZK B;  5C3E I;  1FDI A;  1VLA A;  3TE5 B;  4E2Y A;  1R9T I; 
#chains in the Genus database with same CATH homology
 3KIF A;  2GTH A;  4BY7 I;  1VQ4 1;  3G4S Z;  4A3B I;  2IZ3 A;  2QRE B;  3IFU A;  3I55 1;  4E2Z A;  1TWG I;  4QTU A;  3CCQ 1;  3GTM S;  2JA7 I;  3VB9 A;  3ESW A;  2QA4 Z;  1TWC I;  2E2H I;  1NJI 2;  4NB9 A;  2JS4 A;  4A3C I;  3QWU A;  1K8A 2;  1K9M 2;  3D9X A;  2P3Y A;  4Y7N I;  3FQM A;  1S72 1;  3VMI A;  1VQN Z;  1TWF I;  3CME 1;  1YJN Z;  3CCJ 1;  2PMZ A;  1VQ9 1;  2VUG A;  4MD8 A;  2YAD A;  1QYP A;  1L1O C;  3CCE 1;  1WCM I;  4MH4 A;  3HOW I;  3NDI A;  4NFR A;  5FLX f;  2R6M A;  3CQZ I;  1KD1 2;  1K8A 1;  4NBA A;  1M1K 1;  2JR6 A;  3PO3 S;  2W03 A;  4NBF A;  3HKZ A;  3CCS Z;  1Q82 1;  1N8R 1;  5IT9 b;  1QVF Y;  3CCR Z;  3CCL Z;  2OTJ 1;  3CMA 1;  2BJO A;  5IP9 I;  3CC4 Z;  3GTP I;  3CCV 1;  1M90 2;  3S2H I;  5D1P A;  1K73 2;  3TDH B;  3CCM 1;  2NVT I;  1NP6 A;  1YUA A;  3LUS A;  3GTK I;  2KPI A;  1VQO 1;  2QEX Z;  2GTI A;  1VQM Z;  2V8K A;  1Q81 1;  3CC2 Z;  1TWH I;  1QVF Z;  5IT9 f;  4NB8 A;  4BBR I;  3J7A 4;  3G71 1;  4A3D I;  4E31 A;  1VQP 1;  4AYB A;  2V8J A;  2WAQ A;  1VQ7 1;  2K5R A;  2OTL Z;  3I56 Z;  3IX0 A;  4NBB A;  2R92 I;  1YHQ 1;  4NBH A;  1VQL Z;  2W04 A;  3VMH A;  5A2Q f;  3HOV I;  1X3Z A;  3RZO I;  4MD7 A;  2EGT A;  4E32 A;  1USP A;  2E9H A;  3EED A;  4MD9 A;  5LL6 f;  2DE6 A;  3JAM f;  2JMO A;  4E33 A;  2VUM I;  2HU9 A;  1W2B Z;  2YU9 I;  1VQ5 1;  2DE5 A;  4XX2 A;  3VTN A;  1YIJ 1;  3KIH A;  4TNU A;  5C44 I;  3S17 I;  4S1T A;  3H3V J;  4NBE A;  3CD6 Z;  3CC7 1;  2B63 I;  4BY1 I;  2IZ4 A;  2E2J I;  2QA4 1;  4NBG A;  2OOX B;  4A3G I;  1W2B Y;  2NVQ I;  4A3K I;  3J80 f;  1S72 Z;  3F3F C;  4A93 I;  2QR1 B;  1JWH C;  3S15 I;  3I4M I;  1YIT Z;  3CME Z;  1YJN 1;  4NOZ A;  1VQ9 Z;  2RBL A;  2H85 A;  1YI2 1;  1YJW 1;  1RO0 A;  4A3M I;  2V8I A;  1S7M A;  3GCF A;  2AKL A;  3CCU 1;  4DGL A;  4NH1 C;  2O4H A;  2M48 A;  3JAM b;  1QVG Z;  1SFO I;  2QLV B;  3NH4 A;  4BXX I;  2JA5 I;  5FLX b;  4HGZ A;  1ZB8 A;  3NH5 A;  4E2W A;  1WII A;  1Q7Y 2;  1VQ6 1;  2QRD B;  3CCL 1;  3BG0 B;  3CC4 1;  3G6E Z;  1QVG Y;  3NH8 A;  1YJ9 Z;  1P9N A;  1QF8 A;  3CPW Z;  1M90 1;  3HOU I;  1K83 I;  3G4S 1;  3GTQ I;  1VQ8 Z;  4NBC A;  1ML8 A;  1I50 I;  2QEX 1;  1VQM 1;  1VQO Z;  3CXC Y;  2M6N A;  1I6H I;  5IP7 I;  3P5J B;  5T64 A;  2PK7 A;  3CCQ Z;  4X6A I;  1TWA I;  5C4X I;  1ZH1 A;  1VQP Z;  1Q7Y 1;  2QKD A;  2PM9 A;  2OTL 1;  4QTT A;  3CPW Y;  1Z01 A;  3D6W A;  3NFZ A;  2RIQ A;  2R93 I;  2ZAE B;  1RO2 A;  2O53 A;  1NJI 1;  3CXC Z;  4A3F I;  1VQ4 Z;  1K9M 1;  1JJ2 Y;  3FKI I;  2I3C A;  3OW2 Z;  1TFI A;  2RT9 A;  4E2X A;  1USP B;  1ZB9 A;  3IF8 A;  4MRI A;  3CCJ Z;  3T4N B;  3VMG A;  3S1R I;  3K7A I;  2DE7 A;  3CCE Z;  4E30 A;  2RPR A;  3S16 I;  4MON A;  1JJ2 Z;  3OW2 Y;  1YIJ Z;  4BBS I;  3CD6 1;  3CC7 Z;  2NVX I;  4A3J I;  5T6B A;  2WB1 A;  1VQN 1;  1VQK 1;  3J81 f;  3CCS 1;  4Y52 I;  2QRC B;  2GU2 A;  1Q82 2;  1N8R 2;  3GTG I;  3CCR 1;  3HOX I;  2OTJ Z;  3Q87 A;  1M1K 2;  3CCM Z;  2JA8 I;  1K73 1;  1YI2 Z;  1KQS Z;  3BG1 B;  3CCU Z;  1Y1V S;  3CC2 1;  3U50 C;  3J80 b;  4MXU A;  2E2I I;  5CM2 M;  3FQQ A;  3S1N I;  3MZL B;  4NBD A;  2JA6 I;  1VQ7 Z;  3M3Y I;  3S1Q I;  2P28 A;  3CMA Z;  3GKQ A;  3I56 1;  1YUK A;  1RLY A;  4RS4 A;  1KQS Y;  2G2K A;  2R7Z I;  3GTJ I;  4RVF A;  3MON A;  1VQ6 Z;  4A3E I;  3I55 Z;  3I07 A;  4RVD A;  2K3R A;  4CL1 A;  2F4M A;  4A3I I;  3HOZ I;  1RO4 A;  4RVG A;  1VQ8 1;  1X0T A;  1Z03 A;  3HOY I;  1N2F A;  2VF1 A;  3GTL I;  5D1O B;  1KC8 2;  4HGY A;  1Q86 1;  1PFT A;  5D1O A;  4DK1 A;  1NUI A;  2JUB A;  3S1M I;  5A2Q b;  1X3W A;  2NVY I;  1VQ5 Z;  5FLM I;  2HF1 A;  2Q4Z A;  3F3P C;  4RVH A;  3I4N I;  3GTM I;  3H0G I;  2OOY B;  5C4J I;  3S14 I;  1KC8 1;  1Y1V I;  1KD1 1;  1Q86 2;  3RZD I;  1Y1W I;  1RNI A;  4HH4 A;  1Z02 A;  1LQL A;  2Y0S A;  2JNY A;  1WW9 A;  2Q51 A;  3NDJ A;  2J6A A;  3CCV Z;  1VQK Z;  1YIT 1;  1RQF A;  3GTO I;  1KRL A;  1Q81 2;  3J81 b;  1YJW Z;  2OZK A;  5T67 A;  3S2D I;  2F4O A;  2LIY A;  3EER A;  3G6E 1;  1YJ9 1;  4A3L I;  5AN9 F;  2LFU A;  2RHB A;  3G71 Z;  3PO3 I;  3M4O I;  1DL6 A;  1YHQ Z;  4RV9 A;  3PO2 I;  4EWC A;  1I3Q I;  2KI7 B;  4DQY B;  1VQL 1;  3MZK B;  5C3E I;  1VLA A;  3TE5 B;  4E2Y A;  1R9T I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...