3S2HI

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2hI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s2hI02
4MH4A 4A3CI 1Y1VI 4A3MI 3S1QI 1X3WA 2E2II 4A3JI 1ZB9A 4NBGA 2NVQI 1SFOI 3GTJI 5C44I 3HOWI 1I6HI 3PO2I 3PO3S 3EERA 1Y1VS 2DE7A 2JA8I 2R7ZI 1PFTA 3GCFA 2R92I 4A3II 2B63I 5FLMI 2E2JI 5C4XI 3S2DI 1NUIA 4A3DI 1TFIA 3HOZI 3ESWA 4A3KI 2KPIA 2JNYA 3LUSA 3S1RI 5C3EI 2F4OA 3HOXI 3VMIA 3GTGI 1RO4A 4NBEA 1WCMI 2HF1A 3CQZI 3S1NI 4NBFA 3PO3I 1L1OC 4A3GI 1K83I 3VMHA 1TWCI 2P3YA 3I4NI 3Q87A 2JS4A 3HOUI 1TWHI 1WW9A 4NOZA 2JA5I 4NB9A 1DL6A 4QTTA 1TWGI 1X3ZA 4X6AI 4NBAA 4BY1I 1YUAA 1TWFI 3GTMI 3S14I 3M3YI 3H3VJ 2NVXI 3GKQA 2E2HI 3S17I 4A3LI 1R9TI 1ML8A 1USPA 4NB8A 1ZB8A 2K5RA 1VLAA 5C4JI 3RZDI 3S1MI 1USPB 3M4OI 2AKLA 3GTQI 2NVTI 2DE5A 2PK7A 5CM2M 2R93I 3K7AI 3U50C 2RBLA 3HOYI 2YU9I 2DE6A 4A3EI 4QTUA 5IP7I 3VMGA 1N2FA 1RLYA 5IP9I 3S15I 3I4MI 4BBRI 3RZOI 3GTMS 4BXXI 4BY7I 2JA6I 3I07A 4NBCA 2BJOA 4XX2A 1I50I 3H0GI 3S2HI 1TWAI 2J6AA 2JA7I 4A3BI 4Y52I 4NBDA 2F4MA 1LQLA 1QYPA 3S16I 3VB9A 3HOVI 4A93I 4BBSI 2VUMI 4NBBA 3GTLI 2NVYI 3D6WA 4A3FI 3FKII 3GTPI 4Y7NI 2JR6A 1Y1WI 3GTKI 1I3QI 3GTOI 4NBHA
chains in the Genus database with same CATH superfamily
2LEXA 1X3WA 1ZB9A 1VQ51 1SFOI 1VQ5Z 1NP6A 1Y1VS 2JA8I 1YIT1 5A2Qb 3J81f 3GCFA 4A3II 1KQSZ 3I56Z 1NJI2 2B63I 1NJI1 1M1K1 3ESWA 4A3KI 2RT9A 1VQN1 2QEX1 4RVHA 2F4OA 3HOXI 3CC71 4RVGA 3CCLZ 2ZAEB 1RO2A 1S721 4A3GI 3CCE1 1Q822 3Q87A 2JS4A 3HOUI 1TWHI 4NOZA 2JA5I 4NB9A 3D2LA 2JIQA 5D1OA 2NAPA 2Y0SA 4MONA 1VQ71 3MZLB 3S14I 1JWHC 3CCQZ 2YADA 1W2BZ 1QVGY 1VQ91 3JAMf 3S1MI 2QREB 3CCJ1 1YJ9Z 1YUKA 2AKLA 3GTQI 1Q811 2NVTI 1VQLZ 2PK7A 5CM2M 2R93I 3K7AI 1VQNZ 1KQSY 3EEDA 2YU9I 2DE6A 1Q7Y2 1RLYA 2V3VA 3J81b 3S15I 1VQO1 1VQ6Z 4BBRI 3RZOI 3G4SZ 2E9HA 3I07A 1KC81 2OTLZ 3G71Z 4AYBA 4NBDA 3CD61 1LQLA 2VPZA 3S16I 2IZ3A 2VUMI 2WAQA 4E32A 2IV2X 2QA41 1K732 4Y7NI 2KI7B 3CC2Z 2LFUA 5LL6f 3CCSZ 1VQP1 1YHQ1 1ZB8A 4A3CI 3S1QI 2VF1A 1KD11 3NDJA 1K731 3GTJI 5C44I 3HOWI 3PO2I 4E2YA 1PFTA 2E7ZA 4NFRA 5FLMI 2E2JI 4DQYB 2IZ4A 1WZNA 1JJ2Z 3CCJZ 3QWUA 1QF8A 3HOZI 5IT9f 2KPIA 2OOXB 3OW2Z 3CD6Z 1Z02A 3GTGI 3F3PC 3CXCZ 4E33A 2I3CA 3PO3I 3CCL1 1FDIA 1RO0A 1K8A1 2VPXA 1X0TA 3I551 2W04A 3VMHA 3I4NI 2JIMA 3IF8A 2OTJZ 2HU9A 1DL6A 1Z03A 1VQ81 5T67A 4E30A 5A2Qf 2QR1B 4NBAA 4EWCA 1YJNZ 1VQMZ 4E2WA 1VQM1 2E2HI 3S17I 1KRLA 3CPWY 1Z01A 1R9TI 1USPA 4NB8A 1QVFZ 5C4JI 4MD7A 4RS4A 3TE5B 1VQL1 1Q862 2QRDB 3U50C 3CMA1 3HOYI 1VQK1 4QTUA 1Y8CA 2W03A 2P28A 2Q4ZA 1JJ2Y 2QRCB 1VQ61 3CCM1 3CCMZ 1P9NA 1YIJ1 3G4S1 2V8JA 1N8R2 2EGTA 1I50I 4Y52I 1YJN1 4HGZA 1QYPA 3MONA 3VB9A 4NBBA 3NFZA 3D6WA 3CMAZ 1QVFY 2OTJ1 3GTOI 3CPWZ 4MH4A 5FLXf 1M901 4A3MI 1VQ7Z 4NBGA 2V45A 2NVQI 3CXCY 1WJ2A 3EERA 5AN9F 3NH8A 1SIWA 3S2DI 3J80f 1NUIA 4A3DI 2PM9A 1TFIA 3G711 3HKZA 1YJW1 3S1RI 1M1K2 4DK1A 4NBEA 3CQZI 3IFUA 3BG0B 3IX0A 1K83I 3CCEZ 4RV9A 2P3YA 3KIFA 3T4NB 1Q7Y1 3F3FC 1K9M2 5T6BA 4QTTA 2VPWA 2VPYA 1RNIA 1YUAA 3GTMI 3CCQ1 3GKQA 3J80b 1ML8A 3I561 1W2BY 1QVGZ 1USPB 2H85A 4S1TA 4HGYA 2K3RA 3P5JB 3FQMA 2JIPA 4CL1A 1YJ91 2JIOA 2DE5A 3VTNA 3CC41 1YJWZ 3CCS1 5T64A 3NH4A 4NH1C 3CCVZ 4A3EI 5IP7I 3VMGA 3KIHA 1YI2Z 3BG1B 3I4MI 5IT9b 2PMZA 4BXXI 3GTMS 2JA6I 4NBCA 5FLXb 2BJOA 3IR7A 4E31A 3MZKB 2JA7I 4A3BI 2VUGA 2QEXZ 2F4MA 2O4HA 1K9M1 3CC7Z 3J7A4 3OW2Y 2JUBA 2GU2A 2QLVB 2NVYI 2R6MA 2QA4Z 3FKII 3CC4Z 3GTPI 3FQQA 1Y1WI 3GTKI 2Q51A 1I3QI 2JIRA 3CCUZ 1VQKZ 3CCU1 1K8A2 3CCR1 4DGLA 1VQ4Z 1Y1VI 2GTIA 1VQ41 1QXFA 2E2II 4A3JI 1RQFA 1WIIA 1I6HI 3PO3S 2DE7A 2LIYA 2V8IA 1VQ9Z 2R7ZI 2R92I 5C4XI 1KD12 2M6NA 2WB1A 2JNYA 3LUSA 2JMOA 5C3EI 3VMIA 3TDHB 1RO4A 1WCMI 2HF1A 2AYDA 1Q16A 3S1NI 4NBFA 2GTHA 1S72Z 1L1OC 2O53A 1VQOZ 2OOYB 1TWCI 1YIJZ 3CC21 5D1OB 1AA6A 1WW9A 3JAMb 4MRIA 3CMEZ 1VQ8Z 4MXUA 4E2ZA 2RHBA 1TWGI 1X3ZA 4X6AI 1N8R1 4RVDA 4BY1I 1TWFI 2G2KA 4HH4A 3M3YI 3NH5A 3H3VJ 2NVXI 1KC82 4A3LI 1YITZ 2K5RA 1VLAA 3RZDI 3M4OI 4MD8A 3G6E1 3G6EZ 2RBLA 2M48A 2OZKA 1YHQZ 1Q812 1N2FA 1YI21 5IP9I 4BY7I 4MD9A 1S7MA 4E2XA 4RVFA 1FDOA 2V8KA 1M902 1ZH1A 4XX2A 3H0GI 3D9XA 3S2HI 2OTL1 1TWAI 2J6AA 2RPRA 2RIQA 3NDIA 2QKDA 3HOVI 4A93I 4BBSI 1Q861 3GTLI 3I55Z 4A3FI 4TNUA 5D1PA 2JR6A 1VQPZ 1Q821 3CCV1 4NBHA 3CME1 3CCRZ
chains in the Genus database with same CATH topology
1X3WA 1ZB9A 1VQ51 1SFOI 1VQ5Z 1NP6A 1Y1VS 2JA8I 1YIT1 5A2Qb 3J81f 3GCFA 4A3II 1KQSZ 3I56Z 1NJI2 2B63I 1NJI1 1M1K1 3ESWA 4A3KI 2RT9A 1VQN1 2QEX1 4RVHA 2F4OA 3HOXI 3CC71 4RVGA 3CCLZ 2ZAEB 1RO2A 1S721 4A3GI 3CCE1 1Q822 3Q87A 2JS4A 3HOUI 1TWHI 4NOZA 2JA5I 4NB9A 5D1OA 2Y0SA 4MONA 1VQ71 3MZLB 3S14I 1JWHC 3CCQZ 2YADA 1W2BZ 1QVGY 1VQ91 3JAMf 3S1MI 2QREB 3CCJ1 1YJ9Z 1YUKA 2AKLA 3GTQI 1Q811 2NVTI 1VQLZ 2PK7A 5CM2M 2R93I 3K7AI 1VQNZ 1KQSY 3EEDA 2YU9I 2DE6A 1Q7Y2 1RLYA 3J81b 3S15I 1VQO1 1VQ6Z 4BBRI 3RZOI 3G4SZ 2E9HA 3I07A 1KC81 2OTLZ 3G71Z 4AYBA 4NBDA 3CD61 1LQLA 3S16I 2IZ3A 2VUMI 2WAQA 4E32A 2QA41 1K732 4Y7NI 2KI7B 3CC2Z 2LFUA 5LL6f 3CCSZ 1VQP1 1YHQ1 1ZB8A 4A3CI 3S1QI 2VF1A 1KD11 3NDJA 1K731 3GTJI 5C44I 3HOWI 3PO2I 4E2YA 1PFTA 4NFRA 5FLMI 2E2JI 4DQYB 2IZ4A 1JJ2Z 3CCJZ 3QWUA 1QF8A 3HOZI 5IT9f 2KPIA 2OOXB 3OW2Z 3CD6Z 1Z02A 3GTGI 3F3PC 3CXCZ 4E33A 2I3CA 3PO3I 3CCL1 1RO0A 1K8A1 1X0TA 3I551 2W04A 3VMHA 3I4NI 3IF8A 2OTJZ 2HU9A 1DL6A 1Z03A 1VQ81 5T67A 4E30A 5A2Qf 2QR1B 4NBAA 4EWCA 1YJNZ 1VQMZ 4E2WA 1VQM1 2E2HI 3S17I 1KRLA 3CPWY 1Z01A 1R9TI 1USPA 4NB8A 1QVFZ 5C4JI 4MD7A 4RS4A 3TE5B 1VQL1 1Q862 2QRDB 3U50C 3CMA1 3HOYI 1VQK1 4QTUA 2W03A 2P28A 2Q4ZA 1JJ2Y 2QRCB 1VQ61 3CCM1 3CCMZ 1P9NA 1YIJ1 3G4S1 2V8JA 1N8R2 2EGTA 1I50I 4Y52I 1YJN1 4HGZA 1QYPA 3MONA 3VB9A 4NBBA 3NFZA 3D6WA 3CMAZ 1QVFY 2OTJ1 3GTOI 3CPWZ 4MH4A 5FLXf 1M901 4A3MI 1VQ7Z 4NBGA 2NVQI 3CXCY 3EERA 5AN9F 3NH8A 3S2DI 3J80f 1NUIA 4A3DI 2PM9A 1TFIA 3G711 3HKZA 1YJW1 3S1RI 1M1K2 4DK1A 4NBEA 3CQZI 3IFUA 3BG0B 3IX0A 1K83I 3CCEZ 4RV9A 2P3YA 3KIFA 3T4NB 1Q7Y1 3F3FC 1K9M2 5T6BA 4QTTA 1RNIA 1YUAA 3GTMI 3CCQ1 3GKQA 3J80b 1ML8A 3I561 1W2BY 1QVGZ 1USPB 2H85A 4S1TA 4HGYA 2K3RA 3P5JB 3FQMA 4CL1A 1YJ91 2DE5A 3VTNA 3CC41 1YJWZ 3CCS1 5T64A 3NH4A 4NH1C 3CCVZ 4A3EI 5IP7I 3VMGA 3KIHA 1YI2Z 3BG1B 3I4MI 5IT9b 2PMZA 4BXXI 3GTMS 2JA6I 4NBCA 5FLXb 2BJOA 4E31A 3MZKB 2JA7I 4A3BI 2VUGA 2QEXZ 2F4MA 2O4HA 1K9M1 3CC7Z 3J7A4 3OW2Y 2JUBA 2GU2A 2QLVB 2NVYI 2R6MA 2QA4Z 3FKII 3CC4Z 3GTPI 3FQQA 1Y1WI 3GTKI 2Q51A 1I3QI 3CCUZ 1VQKZ 3CCU1 1K8A2 3CCR1 4DGLA 1VQ4Z 1Y1VI 2GTIA 1VQ41 2E2II 4A3JI 1RQFA 1WIIA 1I6HI 3PO3S 2DE7A 2LIYA 2V8IA 1VQ9Z 2R7ZI 2R92I 5C4XI 1KD12 2M6NA 2WB1A 2JNYA 3LUSA 2JMOA 5C3EI 3VMIA 3TDHB 1RO4A 1WCMI 2HF1A 3S1NI 4NBFA 2GTHA 1S72Z 1L1OC 2O53A 1VQOZ 2OOYB 1TWCI 1YIJZ 3CC21 5D1OB 1WW9A 3JAMb 4MRIA 3CMEZ 1VQ8Z 4MXUA 4E2ZA 2RHBA 1TWGI 1X3ZA 4X6AI 1N8R1 4RVDA 4BY1I 1TWFI 2G2KA 4HH4A 3M3YI 3NH5A 3H3VJ 2NVXI 1KC82 4A3LI 1YITZ 2K5RA 1VLAA 3RZDI 3M4OI 4MD8A 3G6E1 3G6EZ 2RBLA 2M48A 2OZKA 1YHQZ 1Q812 1N2FA 1YI21 5IP9I 4BY7I 4MD9A 1S7MA 4E2XA 4RVFA 2V8KA 1M902 1ZH1A 4XX2A 3H0GI 3D9XA 3S2HI 2OTL1 1TWAI 2J6AA 2RPRA 2RIQA 3NDIA 2QKDA 3HOVI 4A93I 4BBSI 1Q861 3GTLI 3I55Z 4A3FI 4TNUA 5D1PA 2JR6A 1VQPZ 1Q821 3CCV1 4NBHA 3CME1 3CCRZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MH4 A;  4A3C I;  1Y1V I;  4A3M I;  3S1Q I;  1X3W A;  2E2I I;  4A3J I;  1ZB9 A;  4NBG A;  2NVQ I;  1SFO I;  3GTJ I;  5C44 I;  3HOW I;  1I6H I;  3PO2 I;  3PO3 S;  3EER A;  1Y1V S;  2DE7 A;  2JA8 I;  2R7Z I;  1PFT A;  3GCF A;  2R92 I;  4A3I I;  2B63 I;  5FLM I;  2E2J I;  5C4X I;  3S2D I;  1NUI A;  4A3D I;  1TFI A;  3HOZ I;  3ESW A;  4A3K I;  2KPI A;  2JNY A;  3LUS A;  3S1R I;  5C3E I;  2F4O A;  3HOX I;  3VMI A;  3GTG I;  1RO4 A;  4NBE A;  1WCM I;  2HF1 A;  3CQZ I;  3S1N I;  4NBF A;  3PO3 I;  1L1O C;  4A3G I;  1K83 I;  3VMH A;  1TWC I;  2P3Y A;  3I4N I;  3Q87 A;  2JS4 A;  3HOU I;  1TWH I;  1WW9 A;  4NOZ A;  2JA5 I;  4NB9 A;  1DL6 A;  4QTT A;  1TWG I;  1X3Z A;  4X6A I;  4NBA A;  4BY1 I;  1YUA A;  1TWF I;  3GTM I;  3S14 I;  3M3Y I;  3H3V J;  2NVX I;  3GKQ A;  2E2H I;  3S17 I;  4A3L I;  1R9T I;  1ML8 A;  1USP A;  4NB8 A;  1ZB8 A;  2K5R A;  1VLA A;  5C4J I;  3RZD I;  3S1M I;  1USP B;  3M4O I;  2AKL A;  3GTQ I;  2NVT I;  2DE5 A;  2PK7 A;  5CM2 M;  2R93 I;  3K7A I;  3U50 C;  2RBL A;  3HOY I;  2YU9 I;  2DE6 A;  4A3E I;  4QTU A;  5IP7 I;  3VMG A;  1N2F A;  1RLY A;  5IP9 I;  3S15 I;  3I4M I;  4BBR I;  3RZO I;  3GTM S;  4BXX I;  4BY7 I;  2JA6 I;  3I07 A;  4NBC A;  2BJO A;  4XX2 A;  1I50 I;  3H0G I;  3S2H I;  1TWA I;  2J6A A;  2JA7 I;  4A3B I;  4Y52 I;  4NBD A;  2F4M A;  1LQL A;  1QYP A;  3S16 I;  3VB9 A;  3HOV I;  4A93 I;  4BBS I;  2VUM I;  4NBB A;  3GTL I;  2NVY I;  3D6W A;  4A3F I;  3FKI I;  3GTP I;  4Y7N I;  2JR6 A;  1Y1W I;  3GTK I;  1I3Q I;  3GTO I;  4NBH A; 
#chains in the Genus database with same CATH topology
 2LEX A;  1X3W A;  1ZB9 A;  1VQ5 1;  1SFO I;  1VQ5 Z;  1NP6 A;  1Y1V S;  2JA8 I;  1YIT 1;  5A2Q b;  3J81 f;  3GCF A;  4A3I I;  1KQS Z;  3I56 Z;  1NJI 2;  2B63 I;  1NJI 1;  1M1K 1;  3ESW A;  4A3K I;  2RT9 A;  1VQN 1;  2QEX 1;  4RVH A;  2F4O A;  3HOX I;  3CC7 1;  4RVG A;  3CCL Z;  2ZAE B;  1RO2 A;  1S72 1;  4A3G I;  3CCE 1;  1Q82 2;  3Q87 A;  2JS4 A;  3HOU I;  1TWH I;  4NOZ A;  2JA5 I;  4NB9 A;  3D2L A;  2JIQ A;  5D1O A;  2NAP A;  2Y0S A;  4MON A;  1VQ7 1;  3MZL B;  3S14 I;  1JWH C;  3CCQ Z;  2YAD A;  1W2B Z;  1QVG Y;  1VQ9 1;  3JAM f;  3S1M I;  2QRE B;  3CCJ 1;  1YJ9 Z;  1YUK A;  2AKL A;  3GTQ I;  1Q81 1;  2NVT I;  1VQL Z;  2PK7 A;  5CM2 M;  2R93 I;  3K7A I;  1VQN Z;  1KQS Y;  3EED A;  2YU9 I;  2DE6 A;  1Q7Y 2;  1RLY A;  2V3V A;  3J81 b;  3S15 I;  1VQO 1;  1VQ6 Z;  4BBR I;  3RZO I;  3G4S Z;  2E9H A;  3I07 A;  1KC8 1;  2OTL Z;  3G71 Z;  4AYB A;  4NBD A;  3CD6 1;  1LQL A;  2VPZ A;  3S16 I;  2IZ3 A;  2VUM I;  2WAQ A;  4E32 A;  2IV2 X;  2QA4 1;  1K73 2;  4Y7N I;  2KI7 B;  3CC2 Z;  2LFU A;  5LL6 f;  3CCS Z;  1VQP 1;  1YHQ 1;  1ZB8 A;  4A3C I;  3S1Q I;  2VF1 A;  1KD1 1;  3NDJ A;  1K73 1;  3GTJ I;  5C44 I;  3HOW I;  3PO2 I;  4E2Y A;  1PFT A;  2E7Z A;  4NFR A;  5FLM I;  2E2J I;  4DQY B;  2IZ4 A;  1WZN A;  1JJ2 Z;  3CCJ Z;  3QWU A;  1QF8 A;  3HOZ I;  5IT9 f;  2KPI A;  2OOX B;  3OW2 Z;  3CD6 Z;  1Z02 A;  3GTG I;  3F3P C;  3CXC Z;  4E33 A;  2I3C A;  3PO3 I;  3CCL 1;  1FDI A;  1RO0 A;  1K8A 1;  2VPX A;  1X0T A;  3I55 1;  2W04 A;  3VMH A;  3I4N I;  2JIM A;  3IF8 A;  2OTJ Z;  2HU9 A;  1DL6 A;  1Z03 A;  1VQ8 1;  5T67 A;  4E30 A;  5A2Q f;  2QR1 B;  4NBA A;  4EWC A;  1YJN Z;  1VQM Z;  4E2W A;  1VQM 1;  2E2H I;  3S17 I;  1KRL A;  3CPW Y;  1Z01 A;  1R9T I;  1USP A;  4NB8 A;  1QVF Z;  5C4J I;  4MD7 A;  4RS4 A;  3TE5 B;  1VQL 1;  1Q86 2;  2QRD B;  3U50 C;  3CMA 1;  3HOY I;  1VQK 1;  4QTU A;  1Y8C A;  2W03 A;  2P28 A;  2Q4Z A;  1JJ2 Y;  2QRC B;  1VQ6 1;  3CCM 1;  3CCM Z;  1P9N A;  1YIJ 1;  3G4S 1;  2V8J A;  1N8R 2;  2EGT A;  1I50 I;  4Y52 I;  1YJN 1;  4HGZ A;  1QYP A;  3MON A;  3VB9 A;  4NBB A;  3NFZ A;  3D6W A;  3CMA Z;  1QVF Y;  2OTJ 1;  3GTO I;  3CPW Z;  4MH4 A;  5FLX f;  1M90 1;  4A3M I;  1VQ7 Z;  4NBG A;  2V45 A;  2NVQ I;  3CXC Y;  1WJ2 A;  3EER A;  5AN9 F;  3NH8 A;  1SIW A;  3S2D I;  3J80 f;  1NUI A;  4A3D I;  2PM9 A;  1TFI A;  3G71 1;  3HKZ A;  1YJW 1;  3S1R I;  1M1K 2;  4DK1 A;  4NBE A;  3CQZ I;  3IFU A;  3BG0 B;  3IX0 A;  1K83 I;  3CCE Z;  4RV9 A;  2P3Y A;  3KIF A;  3T4N B;  1Q7Y 1;  3F3F C;  1K9M 2;  5T6B A;  4QTT A;  2VPW A;  2VPY A;  1RNI A;  1YUA A;  3GTM I;  3CCQ 1;  3GKQ A;  3J80 b;  1ML8 A;  3I56 1;  1W2B Y;  1QVG Z;  1USP B;  2H85 A;  4S1T A;  4HGY A;  2K3R A;  3P5J B;  3FQM A;  2JIP A;  4CL1 A;  1YJ9 1;  2JIO A;  2DE5 A;  3VTN A;  3CC4 1;  1YJW Z;  3CCS 1;  5T64 A;  3NH4 A;  4NH1 C;  3CCV Z;  4A3E I;  5IP7 I;  3VMG A;  3KIH A;  1YI2 Z;  3BG1 B;  3I4M I;  5IT9 b;  2PMZ A;  4BXX I;  3GTM S;  2JA6 I;  4NBC A;  5FLX b;  2BJO A;  3IR7 A;  4E31 A;  3MZK B;  2JA7 I;  4A3B I;  2VUG A;  2QEX Z;  2F4M A;  2O4H A;  1K9M 1;  3CC7 Z;  3J7A 4;  3OW2 Y;  2JUB A;  2GU2 A;  2QLV B;  2NVY I;  2R6M A;  2QA4 Z;  3FKI I;  3CC4 Z;  3GTP I;  3FQQ A;  1Y1W I;  3GTK I;  2Q51 A;  1I3Q I;  2JIR A;  3CCU Z;  1VQK Z;  3CCU 1;  1K8A 2;  3CCR 1;  4DGL A;  1VQ4 Z;  1Y1V I;  2GTI A;  1VQ4 1;  1QXF A;  2E2I I;  4A3J I;  1RQF A;  1WII A;  1I6H I;  3PO3 S;  2DE7 A;  2LIY A;  2V8I A;  1VQ9 Z;  2R7Z I;  2R92 I;  5C4X I;  1KD1 2;  2M6N A;  2WB1 A;  2JNY A;  3LUS A;  2JMO A;  5C3E I;  3VMI A;  3TDH B;  1RO4 A;  1WCM I;  2HF1 A;  2AYD A;  1Q16 A;  3S1N I;  4NBF A;  2GTH A;  1S72 Z;  1L1O C;  2O53 A;  1VQO Z;  2OOY B;  1TWC I;  1YIJ Z;  3CC2 1;  5D1O B;  1AA6 A;  1WW9 A;  3JAM b;  4MRI A;  3CME Z;  1VQ8 Z;  4MXU A;  4E2Z A;  2RHB A;  1TWG I;  1X3Z A;  4X6A I;  1N8R 1;  4RVD A;  4BY1 I;  1TWF I;  2G2K A;  4HH4 A;  3M3Y I;  3NH5 A;  3H3V J;  2NVX I;  1KC8 2;  4A3L I;  1YIT Z;  2K5R A;  1VLA A;  3RZD I;  3M4O I;  4MD8 A;  3G6E 1;  3G6E Z;  2RBL A;  2M48 A;  2OZK A;  1YHQ Z;  1Q81 2;  1N2F A;  1YI2 1;  5IP9 I;  4BY7 I;  4MD9 A;  1S7M A;  4E2X A;  4RVF A;  1FDO A;  2V8K A;  1M90 2;  1ZH1 A;  4XX2 A;  3H0G I;  3D9X A;  3S2H I;  2OTL 1;  1TWA I;  2J6A A;  2RPR A;  2RIQ A;  3NDI A;  2QKD A;  3HOV I;  4A93 I;  4BBS I;  1Q86 1;  3GTL I;  3I55 Z;  4A3F I;  4TNU A;  5D1P A;  2JR6 A;  1VQP Z;  1Q82 1;  3CCV 1;  4NBH A;  3CME 1;  3CCR Z; 
#chains in the Genus database with same CATH homology
 1X3W A;  1ZB9 A;  1VQ5 1;  1SFO I;  1VQ5 Z;  1NP6 A;  1Y1V S;  2JA8 I;  1YIT 1;  5A2Q b;  3J81 f;  3GCF A;  4A3I I;  1KQS Z;  3I56 Z;  1NJI 2;  2B63 I;  1NJI 1;  1M1K 1;  3ESW A;  4A3K I;  2RT9 A;  1VQN 1;  2QEX 1;  4RVH A;  2F4O A;  3HOX I;  3CC7 1;  4RVG A;  3CCL Z;  2ZAE B;  1RO2 A;  1S72 1;  4A3G I;  3CCE 1;  1Q82 2;  3Q87 A;  2JS4 A;  3HOU I;  1TWH I;  4NOZ A;  2JA5 I;  4NB9 A;  5D1O A;  2Y0S A;  4MON A;  1VQ7 1;  3MZL B;  3S14 I;  1JWH C;  3CCQ Z;  2YAD A;  1W2B Z;  1QVG Y;  1VQ9 1;  3JAM f;  3S1M I;  2QRE B;  3CCJ 1;  1YJ9 Z;  1YUK A;  2AKL A;  3GTQ I;  1Q81 1;  2NVT I;  1VQL Z;  2PK7 A;  5CM2 M;  2R93 I;  3K7A I;  1VQN Z;  1KQS Y;  3EED A;  2YU9 I;  2DE6 A;  1Q7Y 2;  1RLY A;  3J81 b;  3S15 I;  1VQO 1;  1VQ6 Z;  4BBR I;  3RZO I;  3G4S Z;  2E9H A;  3I07 A;  1KC8 1;  2OTL Z;  3G71 Z;  4AYB A;  4NBD A;  3CD6 1;  1LQL A;  3S16 I;  2IZ3 A;  2VUM I;  2WAQ A;  4E32 A;  2QA4 1;  1K73 2;  4Y7N I;  2KI7 B;  3CC2 Z;  2LFU A;  5LL6 f;  3CCS Z;  1VQP 1;  1YHQ 1;  1ZB8 A;  4A3C I;  3S1Q I;  2VF1 A;  1KD1 1;  3NDJ A;  1K73 1;  3GTJ I;  5C44 I;  3HOW I;  3PO2 I;  4E2Y A;  1PFT A;  4NFR A;  5FLM I;  2E2J I;  4DQY B;  2IZ4 A;  1JJ2 Z;  3CCJ Z;  3QWU A;  1QF8 A;  3HOZ I;  5IT9 f;  2KPI A;  2OOX B;  3OW2 Z;  3CD6 Z;  1Z02 A;  3GTG I;  3F3P C;  3CXC Z;  4E33 A;  2I3C A;  3PO3 I;  3CCL 1;  1RO0 A;  1K8A 1;  1X0T A;  3I55 1;  2W04 A;  3VMH A;  3I4N I;  3IF8 A;  2OTJ Z;  2HU9 A;  1DL6 A;  1Z03 A;  1VQ8 1;  5T67 A;  4E30 A;  5A2Q f;  2QR1 B;  4NBA A;  4EWC A;  1YJN Z;  1VQM Z;  4E2W A;  1VQM 1;  2E2H I;  3S17 I;  1KRL A;  3CPW Y;  1Z01 A;  1R9T I;  1USP A;  4NB8 A;  1QVF Z;  5C4J I;  4MD7 A;  4RS4 A;  3TE5 B;  1VQL 1;  1Q86 2;  2QRD B;  3U50 C;  3CMA 1;  3HOY I;  1VQK 1;  4QTU A;  2W03 A;  2P28 A;  2Q4Z A;  1JJ2 Y;  2QRC B;  1VQ6 1;  3CCM 1;  3CCM Z;  1P9N A;  1YIJ 1;  3G4S 1;  2V8J A;  1N8R 2;  2EGT A;  1I50 I;  4Y52 I;  1YJN 1;  4HGZ A;  1QYP A;  3MON A;  3VB9 A;  4NBB A;  3NFZ A;  3D6W A;  3CMA Z;  1QVF Y;  2OTJ 1;  3GTO I;  3CPW Z;  4MH4 A;  5FLX f;  1M90 1;  4A3M I;  1VQ7 Z;  4NBG A;  2NVQ I;  3CXC Y;  3EER A;  5AN9 F;  3NH8 A;  3S2D I;  3J80 f;  1NUI A;  4A3D I;  2PM9 A;  1TFI A;  3G71 1;  3HKZ A;  1YJW 1;  3S1R I;  1M1K 2;  4DK1 A;  4NBE A;  3CQZ I;  3IFU A;  3BG0 B;  3IX0 A;  1K83 I;  3CCE Z;  4RV9 A;  2P3Y A;  3KIF A;  3T4N B;  1Q7Y 1;  3F3F C;  1K9M 2;  5T6B A;  4QTT A;  1RNI A;  1YUA A;  3GTM I;  3CCQ 1;  3GKQ A;  3J80 b;  1ML8 A;  3I56 1;  1W2B Y;  1QVG Z;  1USP B;  2H85 A;  4S1T A;  4HGY A;  2K3R A;  3P5J B;  3FQM A;  4CL1 A;  1YJ9 1;  2DE5 A;  3VTN A;  3CC4 1;  1YJW Z;  3CCS 1;  5T64 A;  3NH4 A;  4NH1 C;  3CCV Z;  4A3E I;  5IP7 I;  3VMG A;  3KIH A;  1YI2 Z;  3BG1 B;  3I4M I;  5IT9 b;  2PMZ A;  4BXX I;  3GTM S;  2JA6 I;  4NBC A;  5FLX b;  2BJO A;  4E31 A;  3MZK B;  2JA7 I;  4A3B I;  2VUG A;  2QEX Z;  2F4M A;  2O4H A;  1K9M 1;  3CC7 Z;  3J7A 4;  3OW2 Y;  2JUB A;  2GU2 A;  2QLV B;  2NVY I;  2R6M A;  2QA4 Z;  3FKI I;  3CC4 Z;  3GTP I;  3FQQ A;  1Y1W I;  3GTK I;  2Q51 A;  1I3Q I;  3CCU Z;  1VQK Z;  3CCU 1;  1K8A 2;  3CCR 1;  4DGL A;  1VQ4 Z;  1Y1V I;  2GTI A;  1VQ4 1;  2E2I I;  4A3J I;  1RQF A;  1WII A;  1I6H I;  3PO3 S;  2DE7 A;  2LIY A;  2V8I A;  1VQ9 Z;  2R7Z I;  2R92 I;  5C4X I;  1KD1 2;  2M6N A;  2WB1 A;  2JNY A;  3LUS A;  2JMO A;  5C3E I;  3VMI A;  3TDH B;  1RO4 A;  1WCM I;  2HF1 A;  3S1N I;  4NBF A;  2GTH A;  1S72 Z;  1L1O C;  2O53 A;  1VQO Z;  2OOY B;  1TWC I;  1YIJ Z;  3CC2 1;  5D1O B;  1WW9 A;  3JAM b;  4MRI A;  3CME Z;  1VQ8 Z;  4MXU A;  4E2Z A;  2RHB A;  1TWG I;  1X3Z A;  4X6A I;  1N8R 1;  4RVD A;  4BY1 I;  1TWF I;  2G2K A;  4HH4 A;  3M3Y I;  3NH5 A;  3H3V J;  2NVX I;  1KC8 2;  4A3L I;  1YIT Z;  2K5R A;  1VLA A;  3RZD I;  3M4O I;  4MD8 A;  3G6E 1;  3G6E Z;  2RBL A;  2M48 A;  2OZK A;  1YHQ Z;  1Q81 2;  1N2F A;  1YI2 1;  5IP9 I;  4BY7 I;  4MD9 A;  1S7M A;  4E2X A;  4RVF A;  2V8K A;  1M90 2;  1ZH1 A;  4XX2 A;  3H0G I;  3D9X A;  3S2H I;  2OTL 1;  1TWA I;  2J6A A;  2RPR A;  2RIQ A;  3NDI A;  2QKD A;  3HOV I;  4A93 I;  4BBS I;  1Q86 1;  3GTL I;  3I55 Z;  4A3F I;  4TNU A;  5D1P A;  2JR6 A;  1VQP Z;  1Q82 1;  3CCV 1;  4NBH A;  3CME 1;  3CCR Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...