1A7XA

Fkbp12-fk1012 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP12
publication title Chemical inducers of dimerization: the atomic structure of FKBP12-FK1012A-FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1a7xA00
5HWCA 2OFNA 2ZQVA 3UQAA 4R0XA 1C9HA 3ODKA 4LAXA 5GPGA 5I98A 2RQSA 1EYMA 2VCDA 3TCZA 1Q1CA 4GGQA 1P5QA 4W9OA 2MPHA 1J4RA 4G2PA 1ZCNA 1PBKA 5D75A 4JFLA 1FD9A 2PV1A 3O5JA 2UZ5A 3O5GA 1HXVA 2JZVA 1T11A 3IKGA 2RUDA 1FKBA 3O5DA 4DRHA 2F21A 1D7HA 4IPXA 3NTPA 4TNSA 5HT1A 4DROA 2F4EA 2M2AA 4U84A 3O5QA 2M08A 5DITA 3RGCA 2XP9A 2XP7A 3PA7A 5HW7A 2K8IA 4DH0A 2KI3A 2KR7A 2ZQSA 2ITKA 3EY6A 4DZ2A 4DRIA 1JVWA 3I6CA 4TYOA 2KO7A 4QIBA 1FKKA 3KABA 1TCOC 2ZQTA 3KAFA 5HW6A 3O5OA 4DRJA 1QPFA 3UQIA 2ZR6A 4ODPA 3IKDA 1QPLA 4TW7A 2PBCA 1L1PA 1FKTA 3CGMA 4FN2A 4QT3A 1FKJA 3KCEA 1A7XA 4ODNA 2MLYA 4LAWA 1FKHA 3H9RB 2F2DA 2D9FA 1N1AA 2PPOA 4ODRA 4ODQA 3O5KA 2M1IA 1JNSA 3NI6A 5DIVA 2KE0A 2DG9A 1FKSA 3RFWA 3JXVA 3KAGA 4DRNA 4GIVA 3JYMA 1ROTA 1ZK6A 2AWGA 1W26A 2L2SA 2LJ4A 2DG4A 4JFMA 2XPBA 3TC5A 4O2TA 3IHZA 3O5LA 4ODLA 4N19A 1JNTA 4C02B 3CGNA 4DIPA 1FKGA 4MSPA 3LUOA 3B7XA 4ITZA 5DIUA 1B6CA 1Q6UA 3UI6A 2XPAA 1F40A 3TDBA 4TW6A 1D7JA 4TW8A 1M5YA 2KGJA 2MNTA 4JFKA 3KAIA 4DRPA 4U85A 5HTGA 1PINA 3UQBA 4G50A 2MLXA 4U86A 1J6YA 3O5IA 1NSGA 1Q6HA 1U79A 3KZ7A 2PPNA 3KADA 2XP3A 1FKDA 2MLZA 2Q5AA 2MF9A 1FAPA 3FAPA 3O5PA 4JYSA 1EQ3A 2DG3A 2VN1A 1BKFA 3WH0A 4W9PA 2PPPA 1BL4A 4BF8A 1FKRA 3MDYB 1J4IA 1F8AB 1YW5A 1D7IA 1NMVA 3PRDA 4NNRA 4DRMA 5J6EA 2RURA 3PRBA 3UI5A 1Y0OA 2PV3A 1J4HA 1KT0A 3KAHA 5HKGA 2PV2A 1FJDA 1FKFA 1YATA 3NRKA 3OOBA 2RSEA 5HUAA 2ZR5A 2FAPA 2FKEA 5HW8A 1ROUA 4LAVA 3O5FA 1FKIA 1R9HA 4ODMA 4W9QA 1Q6IA 3GPKA 2XP5A 4DRKA 2RUCA 4IQCA 1QZ2A 1D6OA 3JYJA 2IF4A 2ZQUA 3O5EA 1NMWA 4JFIA 2RUQA 4JFJA 4IQ2A 4QT2A 3VAWA 2KFWA 4LAYA 2LGOA 3UI4A 2LPVA 4DRQA 2ZR4A 4DT4A 5BXJA 1KT1A 5HWBA 4J4OA 2XP6A 4MGVA 2N87A 3IK8A 2XP4A 4ODKA 3UF8A 2LKNA 3O5RA 5B8IC 3KACA 4TX0A 4J4NA 4ODOA 1FKLA 4DZ3A 4FAPA 2XP8A 3O5MA 2Y78A
chains in the Genus database with same CATH superfamily
5HWCA 3UQAA 3ARTA 3ARQA 4LAXA 3GU0A 5GQBA 2ESCA 1NWTA 1OGBA 2VCDA 3TCZA 1ZBWA 4W9OA 2MPHA 3FXYA 5D75A 3RM4A 2WLZA 4ML4A 2PV1A 3FY1A 1ITXA 1HKMA 1FKBA 3WKZA 4DRHA 2F21A 1D7HA 4IPXA 1EIBA 5HT1A 4DROA 1HKKA 2M2AA 1ZU8A 2XP9A 3PA7A 2KI3A 4P8UA 4LGXA 1O6IA 2ITKA 1JVWA 3I6CA 2KO7A 4QIBA 4L3NA 2ZQTA 3WD0A 1QPFA 4NSBA 1W1TA 2DT3A 3UQIA 3ARWA 2PBCA 1L1PA 3CGMA 4FN2A 2B5UB 3ARSA 3CHCA 1A7XA 2A3AA 2DPEA 1JNDA 3AS3A 3CZ8A 3ARXA 1N1AA 4QZVB 1IX5A 2EULA 1ZBVA 1JNSA 5DIVA 4KQZA 1CTNA 2DG9A 4WK9A 4DRNA 1ROTA 1W26A 2DG4A 2DT2A 4WIWA 1E6NA 3CGNA 4Z2GA 4P8XA 1NWSA 1F40A 5DIUA 1B6CA 1NH6A 3TDBA 4TW6A 1D7JA 1UR9A 4U86A 4ZPWR 3RM9A 1Q6HA 1U79A 2PPNA 4Z2JA 2XP3A 1FKDA 2MLZA 1JCHB 3FAPA 4IT4A 4JYSA 3WL0A 2G41A 3WH0A 4W9PA 3ARUA 3ALFA 4WKAA 1FKRA 3PRAA 2PI6A 1F8AB 5J6EA 5DO2A 1NMVA 2DSUA 4NNRA 3PRBA 1ZBCA 3UI5A 3OA5A 2PV2A 1H0IA 5HUAA 2RSEA 1R9HA 1VF8A 4DRKA 4HBOA 3ARPA 3WD1A 3O5EA 1D6OA 4JFJA 4MGVA 4Z2IA 3UQBA 2RUQA 3VAWA 3EIPA 1XRVA 2DT0A 3G6MA 2A3BA 4J4OA 4MTVA 1ZB5A 3UF8A 2LKNA 5B8IC 2ETNA 1OGGA 2AOSA 4R0XA 1C9HA 4Z2LA 3GTYX 4G2PA 1ZCNA 1PBKA 1HXVA 1LG1A 3IKGA 2RUDA 4S3KA 4L72B 4TNSA 3NTPA 2B31A 3PR9A 4ZPVR 2K8IA 4DWSB 4WJXA 2DSVA 4DWSC 3WD3A 2ZQSA 3CHFA 4DZ2A 1FKKA 3ARYA 1TCOC 3KAFA 3O5OA 4DRJA 2ZR6A 4ODPA 4AY1A 1FKTA 3KCEA 3WIJA 4ODNA 2MLYA 4LAWA 1FKHA 3WL1A 3H9RB 2D9FA 1ZL1A 3O5KA 2M1IA 3NI6A 1HJWA 4MNLA 4MNMA 1FKSA 3RFWA 3JXVA 1RD6A 1WAWA 1ZK6A 2L2SA 5DEZA 4IT6A 4JFMA 3TC5A 3QOKA 3IHZA 4O2TA 1LQ0A 1JNTA 1Q6UA 5JH8A 1M5YA 4Z2KA 4PTMA 1J6YA 1W1PA 2DSZA 1LL7A 4KR0B 2Q5AA 1EQ3A 3O5PA 3AQUA 1LG2A 2VN1A 4ZPTR 1BL4A 4BF8A 3MDYB 1J4IA 1HKIA 1D7IA 1KFWA 2RURA 3B9DA 3CHDA 4Q7NA 3KAHA 5HKGA 3NRKA 2ZR5A 1SYTA 2FAPA 2FKEA 5HW8A 3O5FA 3RM8A 1FKIA 2A3CA 4W9QA 2O9OA 1JNEA 1NMWA 4IQ2A 2LGOA 1LL6A 5HWBA 4ODKA 4ODOA 4URIA 1FKLA 3O5QA 3ARVA 2OFNA 2ZQVA 3ODKA 1EYMA 1SR0A 4GGQA 2FDMA 1J4RA 1UR8A 1D2KA 4JFLA 3O5JA 3O5GA 2JZVA 2O92A 1W1VA 2F4EA 4MAVA 5DITA 3CHEA 3AS1A 4DH0A 3B8SA 4HARA 4DRIA 5HW6A 3KABA 3IKDA 1E6ZA 1FKJA 4R5EA 4P8VA 2F2DA 3G6LA 4ODRA 3AS0A 4S3JA 2KE0A 1NWRA 3KAGA 4GIVA 1E15A 2LJ4A 3AROA 2XPBA 4ODLA 3O5LA 4C02B 1E6RA 1FKGA 3LUOA 4WKHA 3B7XA 1LJYA 1NWUA 1HJXA 4TW8A 2MNTA 2KGJA 1EDQA 4DRPA 4U85A 4G50A 3O5IA 1NSGA 2G8ZA 3WD4A 4DWSA 1BKFA 1W9VA 1FFQA 3PRDA 4DRMA 1E9LA 1WB0A 1Y0OA 2PV3A 1HKJA 1KT0A 1FJDA 1FFRA 1YATA 3B9AA 3OOBA 1HJVA 4Z2HA 4UDMA 1E44A 1Q6IA 3GPKA 2P4VA 4IQCA 1QZ2A 3JYJA 2IF4A 2ZQUA 4JFIA 5BXJA 2KFWA 3UI4A 2ZR4A 1KT1A 1GRJA 2N87A 2XP4A 2DT1A 1GPFA 3O5RA 4ZS6A 3KACA 1TFVA 4J4NA 4DZ3A 4FAPA 3O5MA 2Y78A 2A3EA 5GPGA 5I98A 4MPKA 2RQSA 1Q1CA 1WNOA 1P5QA 4P8WA 1FD9A 2UZ5A 1T11A 3O5DA 4U84A 2M08A 3RGCA 2QF8A 2XP7A 4Q22A 5HW7A 3WQVA 3ARRA 3CH9A 2KR7A 3BXWA 3EY6A 4TYOA 3WD2A 2PN0A 1E6PA 4MNJA 4NZCA 1QPLA 4TW7A 4HBEA 1H0GA 1X6LA 4QT3A 2F23A 1XHGA 3AS2A 1W1YA 3ALGA 1W9UA 4MNKA 2PPOA 4ODQA 1K9TA 3JYMA 2AWGA 4N19A 4WKFA 1ZBKA 2WM0A 4DIPA 4MSPA 5HBFA 4ITZA 3UI6A 2XPAA 4JFKA 3KAIA 3BMBA 5GPRA 2OLHA 5HTGA 1PINA 2DSWA 2IUZA 2MLXA 2WLYA 3KZ7A 3KADA 2MF9A 1FAPA 3RMEA 1LL4A 2DG3A 2PPPA 4DWSD 1W9PA 2YBTA 4XAKA 1YW5A 1EHNA 1X6NA 1GOIA 1J4HA 1GUVA 1FKFA 1OWQA 2WK2A 3W4RA 4W5UA 1ROUA 4LAVA 4ODMA 2YBUA 3B9EA 2XP5A 3ARZA 2RUCA 5DF0A 4QT2A 4LAYA 4DRQA 4DT4A 2LPVA 2XP6A 3IK8A 4TX0A 3WQWA 2XP8A
chains in the Genus database with same CATH topology
5HWCA 3UQAA 3ARTA 3ARQA 4LAXA 5GQBA 2ESCA 1NWTA 1OGBA 2VCDA 3TCZA 1ZBWA 4W9OA 2MPHA 3FXYA 5D75A 3RM4A 2WLZA 4ML4A 2PV1A 3FY1A 1ITXA 1HKMA 1FKBA 3WKZA 4DRHA 2F21A 1D7HA 4IPXA 1EIBA 5HT1A 4DROA 1HKKA 2M2AA 1ZU8A 2XP9A 3PA7A 2KI3A 4P8UA 4LGXA 1O6IA 2ITKA 1JVWA 3I6CA 2KO7A 4QIBA 4L3NA 2ZQTA 3WD0A 1QPFA 4NSBA 1W1TA 2DT3A 3UQIA 3ARWA 2PBCA 1L1PA 3CGMA 4FN2A 3CHCA 3ARSA 1A7XA 2A3AA 2DPEA 1JNDA 3AS3A 3CZ8A 3ARXA 1N1AA 4QZVB 1IX5A 1ZBVA 1JNSA 5DIVA 4KQZA 1CTNA 2DG9A 4WK9A 4DRNA 1ROTA 1W26A 2DG4A 2DT2A 4WIWA 1E6NA 3CGNA 4Z2GA 4P8XA 1NWSA 1F40A 5DIUA 1B6CA 1NH6A 3TDBA 4TW6A 1D7JA 1UR9A 4U86A 4ZPWR 3RM9A 1Q6HA 1U79A 2PPNA 4Z2JA 2XP3A 1FKDA 2MLZA 3FAPA 4IT4A 4JYSA 3WL0A 2G41A 3WH0A 4W9PA 3ARUA 3ALFA 4WKAA 1FKRA 3PRAA 2PI6A 1F8AB 5J6EA 5DO2A 1NMVA 2DSUA 4NNRA 3PRBA 1ZBCA 3UI5A 3OA5A 2PV2A 1H0IA 5HUAA 2RSEA 1R9HA 1VF8A 4DRKA 4HBOA 3ARPA 3WD1A 3O5EA 1D6OA 4JFJA 4MGVA 4Z2IA 3UQBA 2RUQA 3VAWA 1XRVA 2DT0A 3G6MA 2A3BA 4J4OA 4MTVA 1ZB5A 3UF8A 2LKNA 5B8IC 1OGGA 2AOSA 4R0XA 1C9HA 4Z2LA 4G2PA 1ZCNA 1PBKA 1HXVA 1LG1A 3IKGA 2RUDA 4S3KA 4L72B 4TNSA 3NTPA 2B31A 3PR9A 4ZPVR 2K8IA 4DWSB 4WJXA 2DSVA 4DWSC 3WD3A 2ZQSA 3CHFA 4DZ2A 1FKKA 3ARYA 1TCOC 3KAFA 3O5OA 4DRJA 2ZR6A 4ODPA 4AY1A 1FKTA 3KCEA 3WIJA 4ODNA 2MLYA 4LAWA 1FKHA 3WL1A 3H9RB 2D9FA 1ZL1A 3O5KA 2M1IA 3NI6A 1HJWA 4MNLA 4MNMA 1FKSA 3RFWA 3JXVA 1RD6A 1WAWA 1ZK6A 2L2SA 5DEZA 4IT6A 4JFMA 3TC5A 3QOKA 3IHZA 4O2TA 1LQ0A 1JNTA 1Q6UA 5JH8A 1M5YA 4Z2KA 4PTMA 1J6YA 1W1PA 2DSZA 1LL7A 4KR0B 2Q5AA 1EQ3A 3O5PA 3AQUA 1LG2A 2VN1A 4ZPTR 1BL4A 4BF8A 3MDYB 1J4IA 1HKIA 1D7IA 1KFWA 2RURA 3B9DA 3CHDA 4Q7NA 3KAHA 5HKGA 3NRKA 2ZR5A 1SYTA 2FAPA 2FKEA 5HW8A 3O5FA 3RM8A 1FKIA 2A3CA 4W9QA 2O9OA 1JNEA 1NMWA 4IQ2A 2LGOA 1LL6A 5HWBA 4ODKA 4ODOA 4URIA 1FKLA 3O5QA 3ARVA 2OFNA 2ZQVA 3ODKA 1EYMA 1SR0A 4GGQA 2FDMA 1J4RA 1UR8A 1D2KA 4JFLA 3O5JA 3O5GA 2JZVA 2O92A 1W1VA 2F4EA 4MAVA 5DITA 3CHEA 3AS1A 4DH0A 3B8SA 4HARA 4DRIA 5HW6A 3KABA 3IKDA 1E6ZA 1FKJA 4R5EA 4P8VA 2F2DA 3G6LA 4ODRA 3AS0A 4S3JA 2KE0A 1NWRA 3KAGA 4GIVA 1E15A 2LJ4A 3AROA 2XPBA 4ODLA 3O5LA 4C02B 1E6RA 1FKGA 3LUOA 4WKHA 3B7XA 1LJYA 1NWUA 1HJXA 4TW8A 2MNTA 2KGJA 1EDQA 4DRPA 4U85A 4G50A 3O5IA 1NSGA 2G8ZA 3WD4A 4DWSA 1BKFA 1W9VA 1FFQA 3PRDA 4DRMA 1E9LA 1WB0A 1Y0OA 2PV3A 1HKJA 1KT0A 1FJDA 1FFRA 1YATA 3B9AA 3OOBA 1HJVA 4Z2HA 1Q6IA 3GPKA 4IQCA 1QZ2A 3JYJA 2IF4A 2ZQUA 4JFIA 5BXJA 2KFWA 3UI4A 2ZR4A 1KT1A 2N87A 2XP4A 2DT1A 1GPFA 3O5RA 4ZS6A 3KACA 1TFVA 4J4NA 4DZ3A 4FAPA 3O5MA 2Y78A 2A3EA 5GPGA 5I98A 4MPKA 2RQSA 1Q1CA 1WNOA 1P5QA 4P8WA 1FD9A 2UZ5A 1T11A 3O5DA 4U84A 2M08A 3RGCA 2QF8A 2XP7A 4Q22A 5HW7A 3WQVA 3ARRA 3CH9A 2KR7A 3BXWA 3EY6A 4TYOA 3WD2A 1E6PA 4MNJA 4NZCA 1QPLA 4TW7A 4HBEA 1H0GA 1X6LA 4QT3A 1XHGA 3AS2A 1W1YA 3ALGA 1W9UA 4MNKA 2PPOA 4ODQA 1K9TA 3JYMA 2AWGA 4N19A 4WKFA 1ZBKA 2WM0A 4DIPA 4MSPA 5HBFA 4ITZA 3UI6A 2XPAA 4JFKA 3KAIA 5GPRA 2OLHA 5HTGA 1PINA 2DSWA 2IUZA 2MLXA 2WLYA 3KZ7A 3KADA 2MF9A 1FAPA 3RMEA 1LL4A 2DG3A 2PPPA 4DWSD 1W9PA 2YBTA 4XAKA 1YW5A 1EHNA 1X6NA 1GOIA 1J4HA 1GUVA 1FKFA 1OWQA 2WK2A 3W4RA 4W5UA 1ROUA 4LAVA 4ODMA 2YBUA 3B9EA 2XP5A 3ARZA 2RUCA 5DF0A 4QT2A 4LAYA 4DRQA 4DT4A 2LPVA 2XP6A 3IK8A 4TX0A 3WQWA 2XP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWC A;  2OFN A;  2ZQV A;  3UQA A;  4R0X A;  1C9H A;  3ODK A;  4LAX A;  5GPG A;  5I98 A;  2RQS A;  1EYM A;  2VCD A;  3TCZ A;  1Q1C A;  4GGQ A;  1P5Q A;  4W9O A;  2MPH A;  1J4R A;  4G2P A;  1ZCN A;  1PBK A;  5D75 A;  4JFL A;  1FD9 A;  2PV1 A;  3O5J A;  2UZ5 A;  3O5G A;  1HXV A;  2JZV A;  1T11 A;  3IKG A;  2RUD A;  1FKB A;  3O5D A;  4DRH A;  2F21 A;  1D7H A;  4IPX A;  3NTP A;  4TNS A;  5HT1 A;  4DRO A;  2F4E A;  2M2A A;  4U84 A;  3O5Q A;  2M08 A;  5DIT A;  3RGC A;  2XP9 A;  2XP7 A;  3PA7 A;  5HW7 A;  2K8I A;  4DH0 A;  2KI3 A;  2KR7 A;  2ZQS A;  2ITK A;  3EY6 A;  4DZ2 A;  4DRI A;  1JVW A;  3I6C A;  4TYO A;  2KO7 A;  4QIB A;  1FKK A;  3KAB A;  1TCO C;  2ZQT A;  3KAF A;  5HW6 A;  3O5O A;  4DRJ A;  1QPF A;  3UQI A;  2ZR6 A;  4ODP A;  3IKD A;  1QPL A;  4TW7 A;  2PBC A;  1L1P A;  1FKT A;  3CGM A;  4FN2 A;  4QT3 A;  1FKJ A;  3KCE A;  1A7X A;  4ODN A;  2MLY A;  4LAW A;  1FKH A;  3H9R B;  2F2D A;  2D9F A;  1N1A A;  2PPO A;  4ODR A;  4ODQ A;  3O5K A;  2M1I A;  1JNS A;  3NI6 A;  5DIV A;  2KE0 A;  2DG9 A;  1FKS A;  3RFW A;  3JXV A;  3KAG A;  4DRN A;  4GIV A;  3JYM A;  1ROT A;  1ZK6 A;  2AWG A;  1W26 A;  2L2S A;  2LJ4 A;  2DG4 A;  4JFM A;  2XPB A;  3TC5 A;  4O2T A;  3IHZ A;  3O5L A;  4ODL A;  4N19 A;  1JNT A;  4C02 B;  3CGN A;  4DIP A;  1FKG A;  4MSP A;  3LUO A;  3B7X A;  4ITZ A;  5DIU A;  1B6C A;  1Q6U A;  3UI6 A;  2XPA A;  1F40 A;  3TDB A;  4TW6 A;  1D7J A;  4TW8 A;  1M5Y A;  2KGJ A;  2MNT A;  4JFK A;  3KAI A;  4DRP A;  4U85 A;  5HTG A;  1PIN A;  3UQB A;  4G50 A;  2MLX A;  4U86 A;  1J6Y A;  3O5I A;  1NSG A;  1Q6H A;  1U79 A;  3KZ7 A;  2PPN A;  3KAD A;  2XP3 A;  1FKD A;  2MLZ A;  2Q5A A;  2MF9 A;  1FAP A;  3FAP A;  3O5P A;  4JYS A;  1EQ3 A;  2DG3 A;  2VN1 A;  1BKF A;  3WH0 A;  4W9P A;  2PPP A;  1BL4 A;  4BF8 A;  1FKR A;  3MDY B;  1J4I A;  1F8A B;  1YW5 A;  1D7I A;  1NMV A;  3PRD A;  4NNR A;  4DRM A;  5J6E A;  2RUR A;  3PRB A;  3UI5 A;  1Y0O A;  2PV3 A;  1J4H A;  1KT0 A;  3KAH A;  5HKG A;  2PV2 A;  1FJD A;  1FKF A;  1YAT A;  3NRK A;  3OOB A;  2RSE A;  5HUA A;  2ZR5 A;  2FAP A;  2FKE A;  5HW8 A;  1ROU A;  4LAV A;  3O5F A;  1FKI A;  1R9H A;  4ODM A;  4W9Q A;  1Q6I A;  3GPK A;  2XP5 A;  4DRK A;  2RUC A;  4IQC A;  1QZ2 A;  1D6O A;  3JYJ A;  2IF4 A;  2ZQU A;  3O5E A;  1NMW A;  4JFI A;  2RUQ A;  4JFJ A;  4IQ2 A;  4QT2 A;  3VAW A;  2KFW A;  4LAY A;  2LGO A;  3UI4 A;  2LPV A;  4DRQ A;  2ZR4 A;  4DT4 A;  5BXJ A;  1KT1 A;  5HWB A;  4J4O A;  2XP6 A;  4MGV A;  2N87 A;  3IK8 A;  2XP4 A;  4ODK A;  3UF8 A;  2LKN A;  3O5R A;  5B8I C;  3KAC A;  4TX0 A;  4J4N A;  4ODO A;  1FKL A;  4DZ3 A;  4FAP A;  2XP8 A;  3O5M A;  2Y78 A; 
#chains in the Genus database with same CATH topology
 5HWC A;  3UQA A;  3ART A;  3ARQ A;  4LAX A;  3GU0 A;  5GQB A;  2ESC A;  1NWT A;  1OGB A;  2VCD A;  3TCZ A;  1ZBW A;  4W9O A;  2MPH A;  3FXY A;  5D75 A;  3RM4 A;  2WLZ A;  4ML4 A;  2PV1 A;  3FY1 A;  1ITX A;  1HKM A;  1FKB A;  3WKZ A;  4DRH A;  2F21 A;  1D7H A;  4IPX A;  1EIB A;  5HT1 A;  4DRO A;  1HKK A;  2M2A A;  1ZU8 A;  2XP9 A;  3PA7 A;  2KI3 A;  4P8U A;  4LGX A;  1O6I A;  2ITK A;  1JVW A;  3I6C A;  2KO7 A;  4QIB A;  4L3N A;  2ZQT A;  3WD0 A;  1QPF A;  4NSB A;  1W1T A;  2DT3 A;  3UQI A;  3ARW A;  2PBC A;  1L1P A;  3CGM A;  4FN2 A;  2B5U B;  3ARS A;  3CHC A;  1A7X A;  2A3A A;  2DPE A;  1JND A;  3AS3 A;  3CZ8 A;  3ARX A;  1N1A A;  4QZV B;  1IX5 A;  2EUL A;  1ZBV A;  1JNS A;  5DIV A;  4KQZ A;  1CTN A;  2DG9 A;  4WK9 A;  4DRN A;  1ROT A;  1W26 A;  2DG4 A;  2DT2 A;  4WIW A;  1E6N A;  3CGN A;  4Z2G A;  4P8X A;  1NWS A;  1F40 A;  5DIU A;  1B6C A;  1NH6 A;  3TDB A;  4TW6 A;  1D7J A;  1UR9 A;  4U86 A;  4ZPW R;  3RM9 A;  1Q6H A;  1U79 A;  2PPN A;  4Z2J A;  2XP3 A;  1FKD A;  2MLZ A;  1JCH B;  3FAP A;  4IT4 A;  4JYS A;  3WL0 A;  2G41 A;  3WH0 A;  4W9P A;  3ARU A;  3ALF A;  4WKA A;  1FKR A;  3PRA A;  2PI6 A;  1F8A B;  5J6E A;  5DO2 A;  1NMV A;  2DSU A;  4NNR A;  3PRB A;  1ZBC A;  3UI5 A;  3OA5 A;  2PV2 A;  1H0I A;  5HUA A;  2RSE A;  1R9H A;  1VF8 A;  4DRK A;  4HBO A;  3ARP A;  3WD1 A;  3O5E A;  1D6O A;  4JFJ A;  4MGV A;  4Z2I A;  3UQB A;  2RUQ A;  3VAW A;  3EIP A;  1XRV A;  2DT0 A;  3G6M A;  2A3B A;  4J4O A;  4MTV A;  1ZB5 A;  3UF8 A;  2LKN A;  5B8I C;  2ETN A;  1OGG A;  2AOS A;  4R0X A;  1C9H A;  4Z2L A;  3GTY X;  4G2P A;  1ZCN A;  1PBK A;  1HXV A;  1LG1 A;  3IKG A;  2RUD A;  4S3K A;  4L72 B;  4TNS A;  3NTP A;  2B31 A;  3PR9 A;  4ZPV R;  2K8I A;  4DWS B;  4WJX A;  2DSV A;  4DWS C;  3WD3 A;  2ZQS A;  3CHF A;  4DZ2 A;  1FKK A;  3ARY A;  1TCO C;  3KAF A;  3O5O A;  4DRJ A;  2ZR6 A;  4ODP A;  4AY1 A;  1FKT A;  3KCE A;  3WIJ A;  4ODN A;  2MLY A;  4LAW A;  1FKH A;  3WL1 A;  3H9R B;  2D9F A;  1ZL1 A;  3O5K A;  2M1I A;  3NI6 A;  1HJW A;  4MNL A;  4MNM A;  1FKS A;  3RFW A;  3JXV A;  1RD6 A;  1WAW A;  1ZK6 A;  2L2S A;  5DEZ A;  4IT6 A;  4JFM A;  3TC5 A;  3QOK A;  3IHZ A;  4O2T A;  1LQ0 A;  1JNT A;  1Q6U A;  5JH8 A;  1M5Y A;  4Z2K A;  4PTM A;  1J6Y A;  1W1P A;  2DSZ A;  1LL7 A;  4KR0 B;  2Q5A A;  1EQ3 A;  3O5P A;  3AQU A;  1LG2 A;  2VN1 A;  4ZPT R;  1BL4 A;  4BF8 A;  3MDY B;  1J4I A;  1HKI A;  1D7I A;  1KFW A;  2RUR A;  3B9D A;  3CHD A;  4Q7N A;  3KAH A;  5HKG A;  3NRK A;  2ZR5 A;  1SYT A;  2FAP A;  2FKE A;  5HW8 A;  3O5F A;  3RM8 A;  1FKI A;  2A3C A;  4W9Q A;  2O9O A;  1JNE A;  1NMW A;  4IQ2 A;  2LGO A;  1LL6 A;  5HWB A;  4ODK A;  4ODO A;  4URI A;  1FKL A;  3O5Q A;  3ARV A;  2OFN A;  2ZQV A;  3ODK A;  1EYM A;  1SR0 A;  4GGQ A;  2FDM A;  1J4R A;  1UR8 A;  1D2K A;  4JFL A;  3O5J A;  3O5G A;  2JZV A;  2O92 A;  1W1V A;  2F4E A;  4MAV A;  5DIT A;  3CHE A;  3AS1 A;  4DH0 A;  3B8S A;  4HAR A;  4DRI A;  5HW6 A;  3KAB A;  3IKD A;  1E6Z A;  1FKJ A;  4R5E A;  4P8V A;  2F2D A;  3G6L A;  4ODR A;  3AS0 A;  4S3J A;  2KE0 A;  1NWR A;  3KAG A;  4GIV A;  1E15 A;  2LJ4 A;  3ARO A;  2XPB A;  4ODL A;  3O5L A;  4C02 B;  1E6R A;  1FKG A;  3LUO A;  4WKH A;  3B7X A;  1LJY A;  1NWU A;  1HJX A;  4TW8 A;  2MNT A;  2KGJ A;  1EDQ A;  4DRP A;  4U85 A;  4G50 A;  3O5I A;  1NSG A;  2G8Z A;  3WD4 A;  4DWS A;  1BKF A;  1W9V A;  1FFQ A;  3PRD A;  4DRM A;  1E9L A;  1WB0 A;  1Y0O A;  2PV3 A;  1HKJ A;  1KT0 A;  1FJD A;  1FFR A;  1YAT A;  3B9A A;  3OOB A;  1HJV A;  4Z2H A;  4UDM A;  1E44 A;  1Q6I A;  3GPK A;  2P4V A;  4IQC A;  1QZ2 A;  3JYJ A;  2IF4 A;  2ZQU A;  4JFI A;  5BXJ A;  2KFW A;  3UI4 A;  2ZR4 A;  1KT1 A;  1GRJ A;  2N87 A;  2XP4 A;  2DT1 A;  1GPF A;  3O5R A;  4ZS6 A;  3KAC A;  1TFV A;  4J4N A;  4DZ3 A;  4FAP A;  3O5M A;  2Y78 A;  2A3E A;  5GPG A;  5I98 A;  4MPK A;  2RQS A;  1Q1C A;  1WNO A;  1P5Q A;  4P8W A;  1FD9 A;  2UZ5 A;  1T11 A;  3O5D A;  4U84 A;  2M08 A;  3RGC A;  2QF8 A;  2XP7 A;  4Q22 A;  5HW7 A;  3WQV A;  3ARR A;  3CH9 A;  2KR7 A;  3BXW A;  3EY6 A;  4TYO A;  3WD2 A;  2PN0 A;  1E6P A;  4MNJ A;  4NZC A;  1QPL A;  4TW7 A;  4HBE A;  1H0G A;  1X6L A;  4QT3 A;  2F23 A;  1XHG A;  3AS2 A;  1W1Y A;  3ALG A;  1W9U A;  4MNK A;  2PPO A;  4ODQ A;  1K9T A;  3JYM A;  2AWG A;  4N19 A;  4WKF A;  1ZBK A;  2WM0 A;  4DIP A;  4MSP A;  5HBF A;  4ITZ A;  3UI6 A;  2XPA A;  4JFK A;  3KAI A;  3BMB A;  5GPR A;  2OLH A;  5HTG A;  1PIN A;  2DSW A;  2IUZ A;  2MLX A;  2WLY A;  3KZ7 A;  3KAD A;  2MF9 A;  1FAP A;  3RME A;  1LL4 A;  2DG3 A;  2PPP A;  4DWS D;  1W9P A;  2YBT A;  4XAK A;  1YW5 A;  1EHN A;  1X6N A;  1GOI A;  1J4H A;  1GUV A;  1FKF A;  1OWQ A;  2WK2 A;  3W4R A;  4W5U A;  1ROU A;  4LAV A;  4ODM A;  2YBU A;  3B9E A;  2XP5 A;  3ARZ A;  2RUC A;  5DF0 A;  4QT2 A;  4LAY A;  4DRQ A;  4DT4 A;  2LPV A;  2XP6 A;  3IK8 A;  4TX0 A;  3WQW A;  2XP8 A; 
#chains in the Genus database with same CATH homology
 5HWC A;  3UQA A;  3ART A;  3ARQ A;  4LAX A;  5GQB A;  2ESC A;  1NWT A;  1OGB A;  2VCD A;  3TCZ A;  1ZBW A;  4W9O A;  2MPH A;  3FXY A;  5D75 A;  3RM4 A;  2WLZ A;  4ML4 A;  2PV1 A;  3FY1 A;  1ITX A;  1HKM A;  1FKB A;  3WKZ A;  4DRH A;  2F21 A;  1D7H A;  4IPX A;  1EIB A;  5HT1 A;  4DRO A;  1HKK A;  2M2A A;  1ZU8 A;  2XP9 A;  3PA7 A;  2KI3 A;  4P8U A;  4LGX A;  1O6I A;  2ITK A;  1JVW A;  3I6C A;  2KO7 A;  4QIB A;  4L3N A;  2ZQT A;  3WD0 A;  1QPF A;  4NSB A;  1W1T A;  2DT3 A;  3UQI A;  3ARW A;  2PBC A;  1L1P A;  3CGM A;  4FN2 A;  3CHC A;  3ARS A;  1A7X A;  2A3A A;  2DPE A;  1JND A;  3AS3 A;  3CZ8 A;  3ARX A;  1N1A A;  4QZV B;  1IX5 A;  1ZBV A;  1JNS A;  5DIV A;  4KQZ A;  1CTN A;  2DG9 A;  4WK9 A;  4DRN A;  1ROT A;  1W26 A;  2DG4 A;  2DT2 A;  4WIW A;  1E6N A;  3CGN A;  4Z2G A;  4P8X A;  1NWS A;  1F40 A;  5DIU A;  1B6C A;  1NH6 A;  3TDB A;  4TW6 A;  1D7J A;  1UR9 A;  4U86 A;  4ZPW R;  3RM9 A;  1Q6H A;  1U79 A;  2PPN A;  4Z2J A;  2XP3 A;  1FKD A;  2MLZ A;  3FAP A;  4IT4 A;  4JYS A;  3WL0 A;  2G41 A;  3WH0 A;  4W9P A;  3ARU A;  3ALF A;  4WKA A;  1FKR A;  3PRA A;  2PI6 A;  1F8A B;  5J6E A;  5DO2 A;  1NMV A;  2DSU A;  4NNR A;  3PRB A;  1ZBC A;  3UI5 A;  3OA5 A;  2PV2 A;  1H0I A;  5HUA A;  2RSE A;  1R9H A;  1VF8 A;  4DRK A;  4HBO A;  3ARP A;  3WD1 A;  3O5E A;  1D6O A;  4JFJ A;  4MGV A;  4Z2I A;  3UQB A;  2RUQ A;  3VAW A;  1XRV A;  2DT0 A;  3G6M A;  2A3B A;  4J4O A;  4MTV A;  1ZB5 A;  3UF8 A;  2LKN A;  5B8I C;  1OGG A;  2AOS A;  4R0X A;  1C9H A;  4Z2L A;  4G2P A;  1ZCN A;  1PBK A;  1HXV A;  1LG1 A;  3IKG A;  2RUD A;  4S3K A;  4L72 B;  4TNS A;  3NTP A;  2B31 A;  3PR9 A;  4ZPV R;  2K8I A;  4DWS B;  4WJX A;  2DSV A;  4DWS C;  3WD3 A;  2ZQS A;  3CHF A;  4DZ2 A;  1FKK A;  3ARY A;  1TCO C;  3KAF A;  3O5O A;  4DRJ A;  2ZR6 A;  4ODP A;  4AY1 A;  1FKT A;  3KCE A;  3WIJ A;  4ODN A;  2MLY A;  4LAW A;  1FKH A;  3WL1 A;  3H9R B;  2D9F A;  1ZL1 A;  3O5K A;  2M1I A;  3NI6 A;  1HJW A;  4MNL A;  4MNM A;  1FKS A;  3RFW A;  3JXV A;  1RD6 A;  1WAW A;  1ZK6 A;  2L2S A;  5DEZ A;  4IT6 A;  4JFM A;  3TC5 A;  3QOK A;  3IHZ A;  4O2T A;  1LQ0 A;  1JNT A;  1Q6U A;  5JH8 A;  1M5Y A;  4Z2K A;  4PTM A;  1J6Y A;  1W1P A;  2DSZ A;  1LL7 A;  4KR0 B;  2Q5A A;  1EQ3 A;  3O5P A;  3AQU A;  1LG2 A;  2VN1 A;  4ZPT R;  1BL4 A;  4BF8 A;  3MDY B;  1J4I A;  1HKI A;  1D7I A;  1KFW A;  2RUR A;  3B9D A;  3CHD A;  4Q7N A;  3KAH A;  5HKG A;  3NRK A;  2ZR5 A;  1SYT A;  2FAP A;  2FKE A;  5HW8 A;  3O5F A;  3RM8 A;  1FKI A;  2A3C A;  4W9Q A;  2O9O A;  1JNE A;  1NMW A;  4IQ2 A;  2LGO A;  1LL6 A;  5HWB A;  4ODK A;  4ODO A;  4URI A;  1FKL A;  3O5Q A;  3ARV A;  2OFN A;  2ZQV A;  3ODK A;  1EYM A;  1SR0 A;  4GGQ A;  2FDM A;  1J4R A;  1UR8 A;  1D2K A;  4JFL A;  3O5J A;  3O5G A;  2JZV A;  2O92 A;  1W1V A;  2F4E A;  4MAV A;  5DIT A;  3CHE A;  3AS1 A;  4DH0 A;  3B8S A;  4HAR A;  4DRI A;  5HW6 A;  3KAB A;  3IKD A;  1E6Z A;  1FKJ A;  4R5E A;  4P8V A;  2F2D A;  3G6L A;  4ODR A;  3AS0 A;  4S3J A;  2KE0 A;  1NWR A;  3KAG A;  4GIV A;  1E15 A;  2LJ4 A;  3ARO A;  2XPB A;  4ODL A;  3O5L A;  4C02 B;  1E6R A;  1FKG A;  3LUO A;  4WKH A;  3B7X A;  1LJY A;  1NWU A;  1HJX A;  4TW8 A;  2MNT A;  2KGJ A;  1EDQ A;  4DRP A;  4U85 A;  4G50 A;  3O5I A;  1NSG A;  2G8Z A;  3WD4 A;  4DWS A;  1BKF A;  1W9V A;  1FFQ A;  3PRD A;  4DRM A;  1E9L A;  1WB0 A;  1Y0O A;  2PV3 A;  1HKJ A;  1KT0 A;  1FJD A;  1FFR A;  1YAT A;  3B9A A;  3OOB A;  1HJV A;  4Z2H A;  1Q6I A;  3GPK A;  4IQC A;  1QZ2 A;  3JYJ A;  2IF4 A;  2ZQU A;  4JFI A;  5BXJ A;  2KFW A;  3UI4 A;  2ZR4 A;  1KT1 A;  2N87 A;  2XP4 A;  2DT1 A;  1GPF A;  3O5R A;  4ZS6 A;  3KAC A;  1TFV A;  4J4N A;  4DZ3 A;  4FAP A;  3O5M A;  2Y78 A;  2A3E A;  5GPG A;  5I98 A;  4MPK A;  2RQS A;  1Q1C A;  1WNO A;  1P5Q A;  4P8W A;  1FD9 A;  2UZ5 A;  1T11 A;  3O5D A;  4U84 A;  2M08 A;  3RGC A;  2QF8 A;  2XP7 A;  4Q22 A;  5HW7 A;  3WQV A;  3ARR A;  3CH9 A;  2KR7 A;  3BXW A;  3EY6 A;  4TYO A;  3WD2 A;  1E6P A;  4MNJ A;  4NZC A;  1QPL A;  4TW7 A;  4HBE A;  1H0G A;  1X6L A;  4QT3 A;  1XHG A;  3AS2 A;  1W1Y A;  3ALG A;  1W9U A;  4MNK A;  2PPO A;  4ODQ A;  1K9T A;  3JYM A;  2AWG A;  4N19 A;  4WKF A;  1ZBK A;  2WM0 A;  4DIP A;  4MSP A;  5HBF A;  4ITZ A;  3UI6 A;  2XPA A;  4JFK A;  3KAI A;  5GPR A;  2OLH A;  5HTG A;  1PIN A;  2DSW A;  2IUZ A;  2MLX A;  2WLY A;  3KZ7 A;  3KAD A;  2MF9 A;  1FAP A;  3RME A;  1LL4 A;  2DG3 A;  2PPP A;  4DWS D;  1W9P A;  2YBT A;  4XAK A;  1YW5 A;  1EHN A;  1X6N A;  1GOI A;  1J4H A;  1GUV A;  1FKF A;  1OWQ A;  2WK2 A;  3W4R A;  4W5U A;  1ROU A;  4LAV A;  4ODM A;  2YBU A;  3B9E A;  2XP5 A;  3ARZ A;  2RUC A;  5DF0 A;  4QT2 A;  4LAY A;  4DRQ A;  4DT4 A;  2LPV A;  2XP6 A;  3IK8 A;  4TX0 A;  3WQW A;  2XP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...