1A7XA

Fkbp12-fk1012 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP12
publication title Chemical inducers of dimerization: the atomic structure of FKBP12-FK1012A-FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1a7xA00
1JNTA 1PINA 1B6CA 3CGNA 3FAPA 3WH0A 2RUCA 5DIVA 2UZ5A 3O5KA 3KACA 1A7XA 1ROUA 2KO7A 4IPXA 2JZVA 1FKGA 1NSGA 2XP8A 4ODPA 3GPKA 2MNTA 1NMWA 4NNRA 3O5DA 3IKDA 3VAWA 2LJ4A 4W9OA 4G2PA 1FKJA 4ODRA 5J6EA 2DG4A 5HWBA 2XP9A 5BXJA 3UI5A 4J4OA 3PRBA 1Y0OA 1HXVA 1FKTA 3UI4A 4U86A 1Q6HA 4DROA 1QPLA 4LAWA 3PRDA 1F8AB 2VN1A 3UQBA 3O5FA 3UF8A 2VCDA 1EYMA 4GGQA 4DT4A 1D7IA 2OFNA 2F4EA 3NTPA 5HKGA 1PBKA 4JYSA 2XP7A 3I6CA 3O5QA 1Q1CA 3EY6A 3JYJA 5GPGA 2PPOA 4DRKA 3O5LA 3KAGA 4TYOA 5HW7A 1FKBA 3KAIA 1D6OA 2PBCA 2RUDA 1JNSA 3MDYB 2FKEA 5HTGA 3JYMA 4IQ2A 3KAFA 1R9HA 5HW6A 2PV3A 4DRHA 2XP6A 2AWGA 2ZR4A 3TC5A 4DRMA 4DZ2A 2ZQUA 4N19A 4R0XA 3RFWA 1C9HA 4DIPA 3JXVA 2XPAA 2PV1A 3KADA 3O5JA 4JFIA 4FAPA 2RSEA 4TX0A 3PA7A 2RQSA 1FJDA 2KGJA 3NI6A 3O5IA 1T11A 2XP4A 4QIBA 4GIVA 2MLZA 4QT2A 4W9PA 2K8IA 4DRQA 1KT1A 4JFKA 4ODQA 1BKFA 1FKDA 5HUAA 5HW8A 3O5MA 2Y78A 4ITZA 1J4HA 3KCEA 1M5YA 4LAYA 2N87A 1FKKA 1YATA 2XP5A 3TCZA 5DITA 4ODOA 1QPFA 3UI6A 3RGCA 4JFJA 3NRKA 3ODKA 1FKHA 1QZ2A 2KR7A 4J4NA 1Q6IA 1J4RA 2Q5AA 2KE0A 1KT0A 2ZR6A 3IKGA 2F21A 4ODKA 4W9QA 5DIUA 3CGMA 4TNSA 3KZ7A 1N1AA 2PPNA 2M1IA 2L2SA 4LAXA 2MLYA 4DZ3A 4BF8A 2LPVA 4TW6A 4ODMA 4DRNA 2LKNA 2PPPA 4TW7A 4U84A 1FKIA 5I98A 3O5EA 2PV2A 3O5OA 3TDBA 3IK8A 1F40A 2ZQVA 2XPBA 1FKFA 2MPHA 4DRIA 1FKSA 2RUQA 3OOBA 4LAVA 2DG9A 2XP3A 3IHZA 1D7JA 3LUOA 5HWCA 4ODNA 5B8IC 1Q6UA 2ZQTA 2DG3A 3H9RB 2ITKA 4MGVA 1TCOC 2FAPA 2MLXA 4G50A 4FN2A 4TW8A 1L1PA 2LGOA 2F2DA 4JFMA 1FD9A 2ZQSA 2M2AA 3O5PA 2KI3A 2D9FA 1P5QA 2ZR5A 4IQCA 3O5GA 2RURA 3UQIA 1U79A 1J6YA 3KABA 3O5RA 4O2TA 3UQAA 5D75A 1FKLA 1ZK6A 2M08A 1BL4A 1FAPA 4U85A 2MF9A 4JFLA 1D7HA 1ZCNA 1YW5A 2IF4A 1J4IA 4ODLA 4QT3A 1JVWA 1ROTA 3B7XA 1EQ3A 1NMVA 3KAHA 5HT1A 4C02B 2KFWA 1W26A 4DRPA 1FKRA 4MSPA 4DRJA 4DH0A
chains in the Genus database with same CATH superfamily
1JNTA 5DIVA 3KACA 4TW7A 1ROUA 2JZVA 1GPFA 3O5DA 3IKDA 1FKJA 4ODRA 2DG4A 2G41A 2XP9A 1OGBA 4J4OA 3PRBA 1Y0OA 4L72B 1JCHB 3UI4A 4U86A 1Q6HA 1E6NA 1ZBVA 1RD6A 1HKMA 2VN1A 3O5FA 3UF8A 2VCDA 3AS2A 1EYMA 1D2KA 1NWUA 3G6MA 4DT4A 4Z2JA 2ESCA 1ZB5A 3NTPA 2O92A 5HKGA 1W1YA 2PN0A 4DRKA 3O5LA 4Q7NA 5HW7A 1ZBWA 1FKBA 3KAIA 2RUDA 1H0GA 3WD4A 5HTGA 1R9HA 4WKAA 1E6RA 2IUZA 3WQVA 2A3CA 4DZ2A 4N19A 3RFWA 4DIPA 4QIBA 3AROA 1T11A 3WIJA 4DRQA 5GPRA 3G6LA 1BKFA 3RM8A 3O5MA 1W9UA 3KCEA 2WM0A 3PRAA 2XP5A 1YATA 1TFVA 4Z2IA 5DF0A 4JFJA 1FKHA 1Q6IA 5DIUA 3CGMA 4MPKA 2L2SA 4XAKA 1HKKA 3WD3A 1CTNA 2LKNA 4NZCA 2ZQVA 4DRIA 2PI6A 3OOBA 1NWSA 2XP3A 1D7JA 1W1TA 1ZL1A 4MNLA 5HWCA 2DG3A 1HJWA 4S3JA 2LGOA 4Z2KA 2M2AA 3O5PA 3WD2A 2D9FA 1EIBA 4DWSB 2RURA 4O2TA 3O5RA 4Q22A 1FKLA 4P8UA 4JFLA 1D7HA 1ZCNA 4MAVA 1NMVA 1W26A 1W1VA 4MSPA 1E9LA 3AS1A 1B6CA 4Z2HA 4IT4A 4WKHA 4IPXA 4P8XA 1FKGA 3GPKA 4HBEA 1HKJA 2LJ4A 4ML4A 1W9PA 3ARUA 1QPLA 3PRDA 1O6IA 2QF8A 1D7IA 2OFNA 4QZVB 3ARQA 3ARPA 3EY6A 2OLHA 2PPOA 4WJXA 1D6OA 3ALGA 3MDYB 3JYMA 3KAFA 2YBUA 2PV3A 2XP6A 3TC5A 1LL6A 3BXWA 4R0XA 3JXVA 2PV1A 1LG2A 3PA7A 2DPEA 4GIVA 1NWRA 4ODQA 4WKFA 1FKDA 3GTYX 1OWQA 2DSVA 1K9TA 4LAYA 1GOIA 1QPFA 3ODKA 4J4NA 2KR7A 4W9QA 1LL7A 2PPNA 2M1IA 2F23A 4BF8A 4TW6A 1WAWA 3CHFA 1E6PA 4U84A 1FKIA 3CZ8A 3O5OA 1F40A 3RM4A 2DG9A 1WB0A 5B8IC 2ZQTA 2DSWA 3ARRA 4MGVA 4Z2GA 4G50A 3RM9A 1JNEA 2F2DA 3WL0A 2B31A 1JNDA 3ARWA 3ARYA 1J6YA 3KABA 2M08A 4U85A 2MF9A 4URIA 2YBTA 1NWTA 2EULA 1FKRA 1PINA 2A3BA 3FAPA 4P8WA 2WK2A 1A7XA 2KO7A 1NSGA 2MNTA 1ZU8A 5J6EA 4W9OA 1E44A 3ARSA 5BXJA 3UI5A 2DT3A 1HXVA 1FKTA 1GUVA 1XHGA 2FDMA 1FFQA 1LG1A 4LAWA 5HBFA 1GRJA 1F8AB 3GU0A 4GGQA 2WLYA 1PBKA 2XP7A 1NH6A 3O5QA 1ITXA 3JYJA 4ZPWR 5GPGA 3KAGA 4TYOA 2DSUA 2FKEA 4IQ2A 5HW6A 3CH9A 2DT0A 4DRHA 1VF8A 2AWGA 2A3EA 4P8VA 2DSZA 4DRMA 3AS0A 1C9HA 3KADA 3O5JA 4FAPA 2RQSA 2KGJA 3NI6A 2WLZA 2MLZA 4W9PA 2K8IA 5HW8A 2Y78A 4ITZA 3ARXA 4MNJA 2N87A 1FKKA 3TCZA 4ODOA 1E6ZA 4UDMA 3UI6A 3NRKA 4AY1A 2ZR6A 1J4RA 2Q5AA 4ODKA 5I98A 3IKGA 2F21A 3FY1A 4HBOA 3AQUA 4DWSA 4TNSA 5GQBA 3KZ7A 1N1AA 3ARVA 4DZ3A 2MLYA 3WD1A 2B5UB 4ODMA 4ZPTR 1H0IA 4DRNA 3O5EA 4HARA 2PV2A 3B8SA 3IK8A 4WIWA 2XPBA 1FKSA 1EHNA 1EDQA 3IHZA 1Q6UA 3WQWA 1TCOC 2MLXA 4TW8A 2ZQSA 1HJVA 1OGGA 2ZR5A 4IQCA 3O5GA 1U79A 1ZBKA 3UQAA 1ZK6A 2ETNA 1BL4A 3BMBA 4KQZA 2IF4A 4ZPVR 1J4IA 4QT3A 3AS3A 3EIPA 1JVWA 1ROTA 4ZS6A 5HT1A 3CHDA 3W4RA 2KFWA 4C02B 1UR9A 1IX5A 4DH0A 3CGNA 3WH0A 2DT1A 2RUCA 3B9EA 2UZ5A 3ARTA 3O5KA 5DO2A 4ODPA 2XP8A 4DWSC 1NMWA 4NNRA 3VAWA 4G2PA 1SYTA 4DWSD 4L3NA 4PTMA 5HWBA 1X6NA 2AOSA 4DROA 4NSBA 3UQBA 5JH8A 2F4EA 2DT2A 4LGXA 4JYSA 3B9DA 3I6CA 1FFRA 1X6LA 3WKZA 2A3AA 1Q1CA 5DEZA 2PBCA 1JNSA 1SR0A 2P4VA 2ZR4A 2ZQUA 2XPAA 4JFIA 2RSEA 4TX0A 4MNMA 4R5EA 1FJDA 3O5IA 2XP4A 4QT2A 4Z2LA 2O9OA 1KT1A 1UR8A 4JFKA 1HKIA 5HUAA 1J4HA 1M5YA 1HJXA 3ARZA 5DITA 1ZBCA 3PR9A 3RGCA 1QZ2A 1KFWA 2G8ZA 4DRPA 2KE0A 1KT0A 4KR0B 3RMEA 4IT6A 4W5UA 1W9VA 3ALFA 4LAXA 4MTVA 1XRVA 4MNKA 2LPVA 1LQ0A 2PPPA 3WD0A 3CHEA 3QOKA 3TDBA 1FKFA 2MPHA 2RUQA 3CHCA 4LAVA 3LUOA 4S3KA 4ODNA 3H9RB 2ITKA 2FAPA 4FN2A 1L1PA 4JFMA 1FD9A 1W1PA 3FXYA 3OA5A 2KI3A 1P5QA 3B9AA 3UQIA 5D75A 4WK9A 1FAPA 3WL1A 1YW5A 1LL4A 4ODLA 3B7XA 1EQ3A 3KAHA 1E15A 1WNOA 1LJYA 4DRJA
chains in the Genus database with same CATH topology
1JNTA 5DIVA 3KACA 4TW7A 1ROUA 2JZVA 1GPFA 3O5DA 3IKDA 1FKJA 4ODRA 2DG4A 2G41A 2XP9A 1OGBA 4J4OA 3PRBA 1Y0OA 4L72B 3UI4A 4U86A 1Q6HA 1E6NA 1ZBVA 1RD6A 1HKMA 2VN1A 3O5FA 3UF8A 2VCDA 3AS2A 1EYMA 1D2KA 1NWUA 3G6MA 4DT4A 4Z2JA 2ESCA 1ZB5A 3NTPA 2O92A 5HKGA 1W1YA 4DRKA 3O5LA 4Q7NA 5HW7A 1ZBWA 1FKBA 3KAIA 2RUDA 1H0GA 3WD4A 5HTGA 1R9HA 4WKAA 1E6RA 2IUZA 3WQVA 2A3CA 4DZ2A 4N19A 3RFWA 4DIPA 4QIBA 3AROA 1T11A 3WIJA 4DRQA 5GPRA 3G6LA 1BKFA 3RM8A 3O5MA 1W9UA 3KCEA 2WM0A 3PRAA 2XP5A 1YATA 1TFVA 4Z2IA 5DF0A 4JFJA 1FKHA 1Q6IA 5DIUA 3CGMA 4MPKA 2L2SA 4XAKA 1HKKA 3WD3A 1CTNA 2LKNA 4NZCA 2ZQVA 4DRIA 2PI6A 3OOBA 1NWSA 2XP3A 1D7JA 1W1TA 1ZL1A 4MNLA 5HWCA 2DG3A 1HJWA 4S3JA 2LGOA 4Z2KA 2M2AA 3O5PA 3WD2A 2D9FA 1EIBA 4DWSB 2RURA 4O2TA 3O5RA 4Q22A 1FKLA 4P8UA 4JFLA 1D7HA 1ZCNA 4MAVA 1NMVA 1W26A 1W1VA 4MSPA 1E9LA 3AS1A 1B6CA 4Z2HA 4IT4A 4WKHA 4IPXA 4P8XA 1FKGA 3GPKA 4HBEA 1HKJA 2LJ4A 4ML4A 1W9PA 3ARUA 1QPLA 3PRDA 1O6IA 2QF8A 1D7IA 2OFNA 4QZVB 3ARQA 3ARPA 3EY6A 2OLHA 2PPOA 4WJXA 1D6OA 3ALGA 3MDYB 3JYMA 3KAFA 2YBUA 2PV3A 2XP6A 3TC5A 1LL6A 3BXWA 4R0XA 3JXVA 2PV1A 1LG2A 3PA7A 2DPEA 4GIVA 1NWRA 4ODQA 4WKFA 1FKDA 1OWQA 2DSVA 1K9TA 4LAYA 1GOIA 1QPFA 3ODKA 4J4NA 2KR7A 4W9QA 1LL7A 2PPNA 2M1IA 4BF8A 4TW6A 1WAWA 3CHFA 1E6PA 4U84A 1FKIA 3CZ8A 3O5OA 1F40A 3RM4A 2DG9A 1WB0A 5B8IC 2ZQTA 2DSWA 3ARRA 4MGVA 4Z2GA 4G50A 3RM9A 1JNEA 2F2DA 3WL0A 2B31A 1JNDA 3ARWA 3ARYA 1J6YA 3KABA 2M08A 4U85A 2MF9A 4URIA 2YBTA 1NWTA 1FKRA 1PINA 2A3BA 3FAPA 4P8WA 2WK2A 1A7XA 2KO7A 1NSGA 2MNTA 1ZU8A 5J6EA 4W9OA 3ARSA 5BXJA 3UI5A 2DT3A 1HXVA 1FKTA 1GUVA 1XHGA 2FDMA 1FFQA 1LG1A 4LAWA 5HBFA 1F8AB 4GGQA 2WLYA 1PBKA 2XP7A 1NH6A 3O5QA 1ITXA 3JYJA 4ZPWR 5GPGA 3KAGA 4TYOA 2DSUA 2FKEA 4IQ2A 5HW6A 3CH9A 2DT0A 4DRHA 1VF8A 2AWGA 2A3EA 4P8VA 2DSZA 4DRMA 3AS0A 1C9HA 3KADA 3O5JA 4FAPA 2RQSA 2KGJA 3NI6A 2WLZA 2MLZA 4W9PA 2K8IA 5HW8A 2Y78A 4ITZA 3ARXA 4MNJA 2N87A 1FKKA 3TCZA 4ODOA 1E6ZA 3UI6A 3NRKA 4AY1A 2ZR6A 1J4RA 2Q5AA 4ODKA 5I98A 3IKGA 2F21A 3FY1A 4HBOA 3AQUA 4DWSA 4TNSA 5GQBA 3KZ7A 1N1AA 3ARVA 4DZ3A 2MLYA 3WD1A 4ODMA 4ZPTR 1H0IA 4DRNA 3O5EA 4HARA 2PV2A 3B8SA 3IK8A 4WIWA 2XPBA 1FKSA 1EHNA 1EDQA 3IHZA 1Q6UA 3WQWA 1TCOC 2MLXA 4TW8A 2ZQSA 1HJVA 1OGGA 2ZR5A 4IQCA 3O5GA 1U79A 1ZBKA 3UQAA 1ZK6A 1BL4A 4KQZA 2IF4A 4ZPVR 1J4IA 4QT3A 3AS3A 1JVWA 1ROTA 4ZS6A 5HT1A 3CHDA 3W4RA 2KFWA 4C02B 1UR9A 1IX5A 4DH0A 3CGNA 3WH0A 2DT1A 2RUCA 3B9EA 2UZ5A 3ARTA 3O5KA 5DO2A 4ODPA 2XP8A 4DWSC 1NMWA 4NNRA 3VAWA 4G2PA 1SYTA 4DWSD 4L3NA 4PTMA 5HWBA 1X6NA 2AOSA 4DROA 4NSBA 3UQBA 5JH8A 2F4EA 2DT2A 4LGXA 4JYSA 3B9DA 3I6CA 1FFRA 1X6LA 3WKZA 2A3AA 1Q1CA 5DEZA 2PBCA 1JNSA 1SR0A 2ZR4A 2ZQUA 2XPAA 4JFIA 2RSEA 4TX0A 4MNMA 4R5EA 1FJDA 3O5IA 2XP4A 4QT2A 4Z2LA 2O9OA 1KT1A 1UR8A 4JFKA 1HKIA 5HUAA 1J4HA 1M5YA 1HJXA 3ARZA 5DITA 1ZBCA 3PR9A 3RGCA 1QZ2A 1KFWA 2G8ZA 4DRPA 2KE0A 1KT0A 4KR0B 3RMEA 4IT6A 4W5UA 1W9VA 3ALFA 4LAXA 4MTVA 1XRVA 4MNKA 2LPVA 1LQ0A 2PPPA 3WD0A 3CHEA 3QOKA 3TDBA 1FKFA 2MPHA 2RUQA 3CHCA 4LAVA 3LUOA 4S3KA 4ODNA 3H9RB 2ITKA 2FAPA 4FN2A 1L1PA 4JFMA 1FD9A 1W1PA 3FXYA 3OA5A 2KI3A 1P5QA 3B9AA 3UQIA 5D75A 4WK9A 1FAPA 3WL1A 1YW5A 1LL4A 4ODLA 3B7XA 1EQ3A 3KAHA 1E15A 1WNOA 1LJYA 4DRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNT A;  1PIN A;  1B6C A;  3CGN A;  3FAP A;  3WH0 A;  2RUC A;  5DIV A;  2UZ5 A;  3O5K A;  3KAC A;  1A7X A;  1ROU A;  2KO7 A;  4IPX A;  2JZV A;  1FKG A;  1NSG A;  2XP8 A;  4ODP A;  3GPK A;  2MNT A;  1NMW A;  4NNR A;  3O5D A;  3IKD A;  3VAW A;  2LJ4 A;  4W9O A;  4G2P A;  1FKJ A;  4ODR A;  5J6E A;  2DG4 A;  5HWB A;  2XP9 A;  5BXJ A;  3UI5 A;  4J4O A;  3PRB A;  1Y0O A;  1HXV A;  1FKT A;  3UI4 A;  4U86 A;  1Q6H A;  4DRO A;  1QPL A;  4LAW A;  3PRD A;  1F8A B;  2VN1 A;  3UQB A;  3O5F A;  3UF8 A;  2VCD A;  1EYM A;  4GGQ A;  4DT4 A;  1D7I A;  2OFN A;  2F4E A;  3NTP A;  5HKG A;  1PBK A;  4JYS A;  2XP7 A;  3I6C A;  3O5Q A;  1Q1C A;  3EY6 A;  3JYJ A;  5GPG A;  2PPO A;  4DRK A;  3O5L A;  3KAG A;  4TYO A;  5HW7 A;  1FKB A;  3KAI A;  1D6O A;  2PBC A;  2RUD A;  1JNS A;  3MDY B;  2FKE A;  5HTG A;  3JYM A;  4IQ2 A;  3KAF A;  1R9H A;  5HW6 A;  2PV3 A;  4DRH A;  2XP6 A;  2AWG A;  2ZR4 A;  3TC5 A;  4DRM A;  4DZ2 A;  2ZQU A;  4N19 A;  4R0X A;  3RFW A;  1C9H A;  4DIP A;  3JXV A;  2XPA A;  2PV1 A;  3KAD A;  3O5J A;  4JFI A;  4FAP A;  2RSE A;  4TX0 A;  3PA7 A;  2RQS A;  1FJD A;  2KGJ A;  3NI6 A;  3O5I A;  1T11 A;  2XP4 A;  4QIB A;  4GIV A;  2MLZ A;  4QT2 A;  4W9P A;  2K8I A;  4DRQ A;  1KT1 A;  4JFK A;  4ODQ A;  1BKF A;  1FKD A;  5HUA A;  5HW8 A;  3O5M A;  2Y78 A;  4ITZ A;  1J4H A;  3KCE A;  1M5Y A;  4LAY A;  2N87 A;  1FKK A;  1YAT A;  2XP5 A;  3TCZ A;  5DIT A;  4ODO A;  1QPF A;  3UI6 A;  3RGC A;  4JFJ A;  3NRK A;  3ODK A;  1FKH A;  1QZ2 A;  2KR7 A;  4J4N A;  1Q6I A;  1J4R A;  2Q5A A;  2KE0 A;  1KT0 A;  2ZR6 A;  3IKG A;  2F21 A;  4ODK A;  4W9Q A;  5DIU A;  3CGM A;  4TNS A;  3KZ7 A;  1N1A A;  2PPN A;  2M1I A;  2L2S A;  4LAX A;  2MLY A;  4DZ3 A;  4BF8 A;  2LPV A;  4TW6 A;  4ODM A;  4DRN A;  2LKN A;  2PPP A;  4TW7 A;  4U84 A;  1FKI A;  5I98 A;  3O5E A;  2PV2 A;  3O5O A;  3TDB A;  3IK8 A;  1F40 A;  2ZQV A;  2XPB A;  1FKF A;  2MPH A;  4DRI A;  1FKS A;  2RUQ A;  3OOB A;  4LAV A;  2DG9 A;  2XP3 A;  3IHZ A;  1D7J A;  3LUO A;  5HWC A;  4ODN A;  5B8I C;  1Q6U A;  2ZQT A;  2DG3 A;  3H9R B;  2ITK A;  4MGV A;  1TCO C;  2FAP A;  2MLX A;  4G50 A;  4FN2 A;  4TW8 A;  1L1P A;  2LGO A;  2F2D A;  4JFM A;  1FD9 A;  2ZQS A;  2M2A A;  3O5P A;  2KI3 A;  2D9F A;  1P5Q A;  2ZR5 A;  4IQC A;  3O5G A;  2RUR A;  3UQI A;  1U79 A;  1J6Y A;  3KAB A;  3O5R A;  4O2T A;  3UQA A;  5D75 A;  1FKL A;  1ZK6 A;  2M08 A;  1BL4 A;  1FAP A;  4U85 A;  2MF9 A;  4JFL A;  1D7H A;  1ZCN A;  1YW5 A;  2IF4 A;  1J4I A;  4ODL A;  4QT3 A;  1JVW A;  1ROT A;  3B7X A;  1EQ3 A;  1NMV A;  3KAH A;  5HT1 A;  4C02 B;  2KFW A;  1W26 A;  4DRP A;  1FKR A;  4MSP A;  4DRJ A;  4DH0 A; 
#chains in the Genus database with same CATH topology
 1JNT A;  5DIV A;  3KAC A;  4TW7 A;  1ROU A;  2JZV A;  1GPF A;  3O5D A;  3IKD A;  1FKJ A;  4ODR A;  2DG4 A;  2G41 A;  2XP9 A;  1OGB A;  4J4O A;  3PRB A;  1Y0O A;  4L72 B;  1JCH B;  3UI4 A;  4U86 A;  1Q6H A;  1E6N A;  1ZBV A;  1RD6 A;  1HKM A;  2VN1 A;  3O5F A;  3UF8 A;  2VCD A;  3AS2 A;  1EYM A;  1D2K A;  1NWU A;  3G6M A;  4DT4 A;  4Z2J A;  2ESC A;  1ZB5 A;  3NTP A;  2O92 A;  5HKG A;  1W1Y A;  2PN0 A;  4DRK A;  3O5L A;  4Q7N A;  5HW7 A;  1ZBW A;  1FKB A;  3KAI A;  2RUD A;  1H0G A;  3WD4 A;  5HTG A;  1R9H A;  4WKA A;  1E6R A;  2IUZ A;  3WQV A;  2A3C A;  4DZ2 A;  4N19 A;  3RFW A;  4DIP A;  4QIB A;  3ARO A;  1T11 A;  3WIJ A;  4DRQ A;  5GPR A;  3G6L A;  1BKF A;  3RM8 A;  3O5M A;  1W9U A;  3KCE A;  2WM0 A;  3PRA A;  2XP5 A;  1YAT A;  1TFV A;  4Z2I A;  5DF0 A;  4JFJ A;  1FKH A;  1Q6I A;  5DIU A;  3CGM A;  4MPK A;  2L2S A;  4XAK A;  1HKK A;  3WD3 A;  1CTN A;  2LKN A;  4NZC A;  2ZQV A;  4DRI A;  2PI6 A;  3OOB A;  1NWS A;  2XP3 A;  1D7J A;  1W1T A;  1ZL1 A;  4MNL A;  5HWC A;  2DG3 A;  1HJW A;  4S3J A;  2LGO A;  4Z2K A;  2M2A A;  3O5P A;  3WD2 A;  2D9F A;  1EIB A;  4DWS B;  2RUR A;  4O2T A;  3O5R A;  4Q22 A;  1FKL A;  4P8U A;  4JFL A;  1D7H A;  1ZCN A;  4MAV A;  1NMV A;  1W26 A;  1W1V A;  4MSP A;  1E9L A;  3AS1 A;  1B6C A;  4Z2H A;  4IT4 A;  4WKH A;  4IPX A;  4P8X A;  1FKG A;  3GPK A;  4HBE A;  1HKJ A;  2LJ4 A;  4ML4 A;  1W9P A;  3ARU A;  1QPL A;  3PRD A;  1O6I A;  2QF8 A;  1D7I A;  2OFN A;  4QZV B;  3ARQ A;  3ARP A;  3EY6 A;  2OLH A;  2PPO A;  4WJX A;  1D6O A;  3ALG A;  3MDY B;  3JYM A;  3KAF A;  2YBU A;  2PV3 A;  2XP6 A;  3TC5 A;  1LL6 A;  3BXW A;  4R0X A;  3JXV A;  2PV1 A;  1LG2 A;  3PA7 A;  2DPE A;  4GIV A;  1NWR A;  4ODQ A;  4WKF A;  1FKD A;  3GTY X;  1OWQ A;  2DSV A;  1K9T A;  4LAY A;  1GOI A;  1QPF A;  3ODK A;  4J4N A;  2KR7 A;  4W9Q A;  1LL7 A;  2PPN A;  2M1I A;  2F23 A;  4BF8 A;  4TW6 A;  1WAW A;  3CHF A;  1E6P A;  4U84 A;  1FKI A;  3CZ8 A;  3O5O A;  1F40 A;  3RM4 A;  2DG9 A;  1WB0 A;  5B8I C;  2ZQT A;  2DSW A;  3ARR A;  4MGV A;  4Z2G A;  4G50 A;  3RM9 A;  1JNE A;  2F2D A;  3WL0 A;  2B31 A;  1JND A;  3ARW A;  3ARY A;  1J6Y A;  3KAB A;  2M08 A;  4U85 A;  2MF9 A;  4URI A;  2YBT A;  1NWT A;  2EUL A;  1FKR A;  1PIN A;  2A3B A;  3FAP A;  4P8W A;  2WK2 A;  1A7X A;  2KO7 A;  1NSG A;  2MNT A;  1ZU8 A;  5J6E A;  4W9O A;  1E44 A;  3ARS A;  5BXJ A;  3UI5 A;  2DT3 A;  1HXV A;  1FKT A;  1GUV A;  1XHG A;  2FDM A;  1FFQ A;  1LG1 A;  4LAW A;  5HBF A;  1GRJ A;  1F8A B;  3GU0 A;  4GGQ A;  2WLY A;  1PBK A;  2XP7 A;  1NH6 A;  3O5Q A;  1ITX A;  3JYJ A;  4ZPW R;  5GPG A;  3KAG A;  4TYO A;  2DSU A;  2FKE A;  4IQ2 A;  5HW6 A;  3CH9 A;  2DT0 A;  4DRH A;  1VF8 A;  2AWG A;  2A3E A;  4P8V A;  2DSZ A;  4DRM A;  3AS0 A;  1C9H A;  3KAD A;  3O5J A;  4FAP A;  2RQS A;  2KGJ A;  3NI6 A;  2WLZ A;  2MLZ A;  4W9P A;  2K8I A;  5HW8 A;  2Y78 A;  4ITZ A;  3ARX A;  4MNJ A;  2N87 A;  1FKK A;  3TCZ A;  4ODO A;  1E6Z A;  4UDM A;  3UI6 A;  3NRK A;  4AY1 A;  2ZR6 A;  1J4R A;  2Q5A A;  4ODK A;  5I98 A;  3IKG A;  2F21 A;  3FY1 A;  4HBO A;  3AQU A;  4DWS A;  4TNS A;  5GQB A;  3KZ7 A;  1N1A A;  3ARV A;  4DZ3 A;  2MLY A;  3WD1 A;  2B5U B;  4ODM A;  4ZPT R;  1H0I A;  4DRN A;  3O5E A;  4HAR A;  2PV2 A;  3B8S A;  3IK8 A;  4WIW A;  2XPB A;  1FKS A;  1EHN A;  1EDQ A;  3IHZ A;  1Q6U A;  3WQW A;  1TCO C;  2MLX A;  4TW8 A;  2ZQS A;  1HJV A;  1OGG A;  2ZR5 A;  4IQC A;  3O5G A;  1U79 A;  1ZBK A;  3UQA A;  1ZK6 A;  2ETN A;  1BL4 A;  3BMB A;  4KQZ A;  2IF4 A;  4ZPV R;  1J4I A;  4QT3 A;  3AS3 A;  3EIP A;  1JVW A;  1ROT A;  4ZS6 A;  5HT1 A;  3CHD A;  3W4R A;  2KFW A;  4C02 B;  1UR9 A;  1IX5 A;  4DH0 A;  3CGN A;  3WH0 A;  2DT1 A;  2RUC A;  3B9E A;  2UZ5 A;  3ART A;  3O5K A;  5DO2 A;  4ODP A;  2XP8 A;  4DWS C;  1NMW A;  4NNR A;  3VAW A;  4G2P A;  1SYT A;  4DWS D;  4L3N A;  4PTM A;  5HWB A;  1X6N A;  2AOS A;  4DRO A;  4NSB A;  3UQB A;  5JH8 A;  2F4E A;  2DT2 A;  4LGX A;  4JYS A;  3B9D A;  3I6C A;  1FFR A;  1X6L A;  3WKZ A;  2A3A A;  1Q1C A;  5DEZ A;  2PBC A;  1JNS A;  1SR0 A;  2P4V A;  2ZR4 A;  2ZQU A;  2XPA A;  4JFI A;  2RSE A;  4TX0 A;  4MNM A;  4R5E A;  1FJD A;  3O5I A;  2XP4 A;  4QT2 A;  4Z2L A;  2O9O A;  1KT1 A;  1UR8 A;  4JFK A;  1HKI A;  5HUA A;  1J4H A;  1M5Y A;  1HJX A;  3ARZ A;  5DIT A;  1ZBC A;  3PR9 A;  3RGC A;  1QZ2 A;  1KFW A;  2G8Z A;  4DRP A;  2KE0 A;  1KT0 A;  4KR0 B;  3RME A;  4IT6 A;  4W5U A;  1W9V A;  3ALF A;  4LAX A;  4MTV A;  1XRV A;  4MNK A;  2LPV A;  1LQ0 A;  2PPP A;  3WD0 A;  3CHE A;  3QOK A;  3TDB A;  1FKF A;  2MPH A;  2RUQ A;  3CHC A;  4LAV A;  3LUO A;  4S3K A;  4ODN A;  3H9R B;  2ITK A;  2FAP A;  4FN2 A;  1L1P A;  4JFM A;  1FD9 A;  1W1P A;  3FXY A;  3OA5 A;  2KI3 A;  1P5Q A;  3B9A A;  3UQI A;  5D75 A;  4WK9 A;  1FAP A;  3WL1 A;  1YW5 A;  1LL4 A;  4ODL A;  3B7X A;  1EQ3 A;  3KAH A;  1E15 A;  1WNO A;  1LJY A;  4DRJ A; 
#chains in the Genus database with same CATH homology
 1JNT A;  5DIV A;  3KAC A;  4TW7 A;  1ROU A;  2JZV A;  1GPF A;  3O5D A;  3IKD A;  1FKJ A;  4ODR A;  2DG4 A;  2G41 A;  2XP9 A;  1OGB A;  4J4O A;  3PRB A;  1Y0O A;  4L72 B;  3UI4 A;  4U86 A;  1Q6H A;  1E6N A;  1ZBV A;  1RD6 A;  1HKM A;  2VN1 A;  3O5F A;  3UF8 A;  2VCD A;  3AS2 A;  1EYM A;  1D2K A;  1NWU A;  3G6M A;  4DT4 A;  4Z2J A;  2ESC A;  1ZB5 A;  3NTP A;  2O92 A;  5HKG A;  1W1Y A;  4DRK A;  3O5L A;  4Q7N A;  5HW7 A;  1ZBW A;  1FKB A;  3KAI A;  2RUD A;  1H0G A;  3WD4 A;  5HTG A;  1R9H A;  4WKA A;  1E6R A;  2IUZ A;  3WQV A;  2A3C A;  4DZ2 A;  4N19 A;  3RFW A;  4DIP A;  4QIB A;  3ARO A;  1T11 A;  3WIJ A;  4DRQ A;  5GPR A;  3G6L A;  1BKF A;  3RM8 A;  3O5M A;  1W9U A;  3KCE A;  2WM0 A;  3PRA A;  2XP5 A;  1YAT A;  1TFV A;  4Z2I A;  5DF0 A;  4JFJ A;  1FKH A;  1Q6I A;  5DIU A;  3CGM A;  4MPK A;  2L2S A;  4XAK A;  1HKK A;  3WD3 A;  1CTN A;  2LKN A;  4NZC A;  2ZQV A;  4DRI A;  2PI6 A;  3OOB A;  1NWS A;  2XP3 A;  1D7J A;  1W1T A;  1ZL1 A;  4MNL A;  5HWC A;  2DG3 A;  1HJW A;  4S3J A;  2LGO A;  4Z2K A;  2M2A A;  3O5P A;  3WD2 A;  2D9F A;  1EIB A;  4DWS B;  2RUR A;  4O2T A;  3O5R A;  4Q22 A;  1FKL A;  4P8U A;  4JFL A;  1D7H A;  1ZCN A;  4MAV A;  1NMV A;  1W26 A;  1W1V A;  4MSP A;  1E9L A;  3AS1 A;  1B6C A;  4Z2H A;  4IT4 A;  4WKH A;  4IPX A;  4P8X A;  1FKG A;  3GPK A;  4HBE A;  1HKJ A;  2LJ4 A;  4ML4 A;  1W9P A;  3ARU A;  1QPL A;  3PRD A;  1O6I A;  2QF8 A;  1D7I A;  2OFN A;  4QZV B;  3ARQ A;  3ARP A;  3EY6 A;  2OLH A;  2PPO A;  4WJX A;  1D6O A;  3ALG A;  3MDY B;  3JYM A;  3KAF A;  2YBU A;  2PV3 A;  2XP6 A;  3TC5 A;  1LL6 A;  3BXW A;  4R0X A;  3JXV A;  2PV1 A;  1LG2 A;  3PA7 A;  2DPE A;  4GIV A;  1NWR A;  4ODQ A;  4WKF A;  1FKD A;  1OWQ A;  2DSV A;  1K9T A;  4LAY A;  1GOI A;  1QPF A;  3ODK A;  4J4N A;  2KR7 A;  4W9Q A;  1LL7 A;  2PPN A;  2M1I A;  4BF8 A;  4TW6 A;  1WAW A;  3CHF A;  1E6P A;  4U84 A;  1FKI A;  3CZ8 A;  3O5O A;  1F40 A;  3RM4 A;  2DG9 A;  1WB0 A;  5B8I C;  2ZQT A;  2DSW A;  3ARR A;  4MGV A;  4Z2G A;  4G50 A;  3RM9 A;  1JNE A;  2F2D A;  3WL0 A;  2B31 A;  1JND A;  3ARW A;  3ARY A;  1J6Y A;  3KAB A;  2M08 A;  4U85 A;  2MF9 A;  4URI A;  2YBT A;  1NWT A;  1FKR A;  1PIN A;  2A3B A;  3FAP A;  4P8W A;  2WK2 A;  1A7X A;  2KO7 A;  1NSG A;  2MNT A;  1ZU8 A;  5J6E A;  4W9O A;  3ARS A;  5BXJ A;  3UI5 A;  2DT3 A;  1HXV A;  1FKT A;  1GUV A;  1XHG A;  2FDM A;  1FFQ A;  1LG1 A;  4LAW A;  5HBF A;  1F8A B;  4GGQ A;  2WLY A;  1PBK A;  2XP7 A;  1NH6 A;  3O5Q A;  1ITX A;  3JYJ A;  4ZPW R;  5GPG A;  3KAG A;  4TYO A;  2DSU A;  2FKE A;  4IQ2 A;  5HW6 A;  3CH9 A;  2DT0 A;  4DRH A;  1VF8 A;  2AWG A;  2A3E A;  4P8V A;  2DSZ A;  4DRM A;  3AS0 A;  1C9H A;  3KAD A;  3O5J A;  4FAP A;  2RQS A;  2KGJ A;  3NI6 A;  2WLZ A;  2MLZ A;  4W9P A;  2K8I A;  5HW8 A;  2Y78 A;  4ITZ A;  3ARX A;  4MNJ A;  2N87 A;  1FKK A;  3TCZ A;  4ODO A;  1E6Z A;  3UI6 A;  3NRK A;  4AY1 A;  2ZR6 A;  1J4R A;  2Q5A A;  4ODK A;  5I98 A;  3IKG A;  2F21 A;  3FY1 A;  4HBO A;  3AQU A;  4DWS A;  4TNS A;  5GQB A;  3KZ7 A;  1N1A A;  3ARV A;  4DZ3 A;  2MLY A;  3WD1 A;  4ODM A;  4ZPT R;  1H0I A;  4DRN A;  3O5E A;  4HAR A;  2PV2 A;  3B8S A;  3IK8 A;  4WIW A;  2XPB A;  1FKS A;  1EHN A;  1EDQ A;  3IHZ A;  1Q6U A;  3WQW A;  1TCO C;  2MLX A;  4TW8 A;  2ZQS A;  1HJV A;  1OGG A;  2ZR5 A;  4IQC A;  3O5G A;  1U79 A;  1ZBK A;  3UQA A;  1ZK6 A;  1BL4 A;  4KQZ A;  2IF4 A;  4ZPV R;  1J4I A;  4QT3 A;  3AS3 A;  1JVW A;  1ROT A;  4ZS6 A;  5HT1 A;  3CHD A;  3W4R A;  2KFW A;  4C02 B;  1UR9 A;  1IX5 A;  4DH0 A;  3CGN A;  3WH0 A;  2DT1 A;  2RUC A;  3B9E A;  2UZ5 A;  3ART A;  3O5K A;  5DO2 A;  4ODP A;  2XP8 A;  4DWS C;  1NMW A;  4NNR A;  3VAW A;  4G2P A;  1SYT A;  4DWS D;  4L3N A;  4PTM A;  5HWB A;  1X6N A;  2AOS A;  4DRO A;  4NSB A;  3UQB A;  5JH8 A;  2F4E A;  2DT2 A;  4LGX A;  4JYS A;  3B9D A;  3I6C A;  1FFR A;  1X6L A;  3WKZ A;  2A3A A;  1Q1C A;  5DEZ A;  2PBC A;  1JNS A;  1SR0 A;  2ZR4 A;  2ZQU A;  2XPA A;  4JFI A;  2RSE A;  4TX0 A;  4MNM A;  4R5E A;  1FJD A;  3O5I A;  2XP4 A;  4QT2 A;  4Z2L A;  2O9O A;  1KT1 A;  1UR8 A;  4JFK A;  1HKI A;  5HUA A;  1J4H A;  1M5Y A;  1HJX A;  3ARZ A;  5DIT A;  1ZBC A;  3PR9 A;  3RGC A;  1QZ2 A;  1KFW A;  2G8Z A;  4DRP A;  2KE0 A;  1KT0 A;  4KR0 B;  3RME A;  4IT6 A;  4W5U A;  1W9V A;  3ALF A;  4LAX A;  4MTV A;  1XRV A;  4MNK A;  2LPV A;  1LQ0 A;  2PPP A;  3WD0 A;  3CHE A;  3QOK A;  3TDB A;  1FKF A;  2MPH A;  2RUQ A;  3CHC A;  4LAV A;  3LUO A;  4S3K A;  4ODN A;  3H9R B;  2ITK A;  2FAP A;  4FN2 A;  1L1P A;  4JFM A;  1FD9 A;  1W1P A;  3FXY A;  3OA5 A;  2KI3 A;  1P5Q A;  3B9A A;  3UQI A;  5D75 A;  4WK9 A;  1FAP A;  3WL1 A;  1YW5 A;  1LL4 A;  4ODL A;  3B7X A;  1EQ3 A;  3KAH A;  1E15 A;  1WNO A;  1LJY A;  4DRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...