1A7XA

Fkbp12-fk1012 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FKBP12
publication title Chemical inducers of dimerization: the atomic structure of FKBP12-FK1012A-FKBP12.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1a7xA00
3FAPA 1KT1A 3KADA 3O5EA 4ODOA 3NTPA 4C02B 4DZ3A 4GIVA 1FKSA 3TC5A 4DIPA 2M08A 4ODMA 2XPBA 2KI3A 2ZQSA 3CGNA 2ITKA 2ZQUA 4LAWA 2Q5AA 1FKIA 2MLYA 2KGJA 4JFIA 3H9RB 1NSGA 2AWGA 2RUDA 2PV2A 3PRDA 5HWBA 4BF8A 2PPOA 2UZ5A 3MDYB 2XPAA 2PV3A 5BXJA 2K8IA 1TCOC 2KFWA 4U84A 1QPFA 1JVWA 3KAGA 1Q1CA 3UF8A 1J4IA 3UQBA 2FKEA 3CGMA 3RGCA 2DG3A 5GPGA 1L1PA 1F40A 2ZR4A 5HW6A 4QT2A 4R0XA 1PINA 3NI6A 1FKKA 1J4RA 1NMVA 2RUCA 3O5JA 1QZ2A 4DRHA 1QPLA 2LGOA 1B6CA 2LJ4A 2IF4A 4ODRA 4DRJA 3JXVA 5J6EA 4LAYA 5HWCA 3O5GA 2XP8A 1JNTA 3EY6A 3KACA 4FN2A 1FD9A 4DH0A 1FKHA 2VCDA 1HXVA 1JNSA 2XP9A 2LKNA 1N1AA 4QIBA 1FKRA 2FAPA 5DITA 5B8IC 2VN1A 2JZVA 2XP7A 2XP5A 1ROTA 2XP3A 4IQCA 3O5RA 3PA7A 1YW5A 4NNRA 2PPNA 5HTGA 5HKGA 4JFLA 4MSPA 2MPHA 4U85A 3KZ7A 1KT0A 4J4OA 1FJDA 4GGQA 4LAXA 4ODNA 5DIVA 3OOBA 4DZ2A 4TNSA 3WH0A 5HW7A 1ZCNA 4TW8A 4JFMA 5I98A 3O5QA 1YATA 3O5FA 2MLXA 2ZQTA 2PBCA 4W9QA 3O5IA 3IKDA 1EYMA 2XP6A 2MF9A 4ITZA 4TYOA 2ZQVA 2F4EA 3KAFA 5HT1A 1J6YA 3O5OA 4FAPA 2N87A 1FKBA 2RSEA 3UI5A 2L2SA 4QT3A 3JYMA 4ODQA 2ZR5A 3UQAA 4U86A 1ZK6A 2RURA 4TW7A 2DG9A 4W9OA 1NMWA 3UI6A 3VAWA 3RFWA 2LPVA 2DG4A 1C9HA 2PV1A 3LUOA 4IQ2A 4DRKA 3KCEA 5D75A 1FKFA 4DRNA 2XP4A 1T11A 5DIUA 1PBKA 4IPXA 4MGVA 4JFJA 1D7HA 1FKDA 3TDBA 2MNTA 1U79A 2KE0A 1R9HA 3GPKA 2M1IA 2D9FA 4JFKA 4DRPA 1Y0OA 3I6CA 3IHZA 4G2PA 4TW6A 1BL4A 3ODKA 4G50A 3UQIA 1Q6IA 2F21A 2RQSA 5HW8A 3TCZA 2KR7A 5HUAA 4LAVA 4DT4A 1FKLA 2ZR6A 3B7XA 2MLZA 1Q6HA 3KABA 4O2TA 1M5YA 1W26A 4DRIA 4DRMA 4ODKA 3IK8A 1F8AB 3PRBA 3O5PA 4DROA 1D7JA 4DRQA 4J4NA 2F2DA 1Q6UA 3NRKA 3O5DA 1P5QA 2KO7A 3KAHA 3O5KA 4ODPA 1EQ3A 1FAPA 4ODLA 1A7XA 3UI4A 2PPPA 2RUQA 3JYJA 1BKFA 1D6OA 3IKGA 4W9PA 1ROUA 3O5MA 3O5LA 4N19A 2OFNA 3KAIA 2M2AA 1FKJA 4TX0A 1FKTA 4JYSA 1J4HA 2Y78A 1D7IA 1FKGA
chains in the Genus database with same CATH superfamily
1KFWA 3RM8A 2DT0A 1E6PA 4DIPA 3TC5A 1E6NA 2KI3A 3QOKA 4LAWA 2Q5AA 2WLYA 1UR9A 3PRDA 2PPOA 2XPAA 1TCOC 1QPFA 3ARZA 3UQBA 1LL6A 3RGCA 5GPGA 1PINA 1GRJA 1FKKA 3O5JA 2QF8A 1QPLA 1HKMA 1B6CA 2LGOA 3FXYA 1LG1A 4Z2LA 1XRVA 1GOIA 2JZVA 2B5UB 4IT6A 2XP3A 4IQCA 1YW5A 3ALGA 5HKGA 4P8UA 3KZ7A 1X6NA 3WH0A 1ZCNA 4JFMA 2DSZA 3O5QA 2G41A 3BXWA 2PBCA 2XP6A 3O5OA 4FAPA 2RSEA 3UI5A 1GUVA 3WD1A 3WL0A 4DWSD 1ZK6A 2PI6A 2DG9A 3B9AA 2DG4A 3WD0A 3KCEA 4DRNA 3ARWA 2XP4A 1WNOA 4MGVA 4JFJA 3TDBA 1U79A 3CH9A 1LG2A 3I6CA 4G2PA 1BL4A 4G50A 3AS3A 1LJYA 1ZBWA 1Q6IA 5JH8A 1JNEA 3B8SA 1NWTA 3KABA 4O2TA 1Q6HA 2WLZA 3CZ8A 1W26A 3G6LA 1LQ0A 3PRBA 2ETNA 3O5PA 5GPRA 3GTYX 3NRKA 2KO7A 4ODPA 4P8VA 2DT3A 1E44A 1BKFA 1ROUA 4L3NA 4N19A 4AY1A 2OFNA 1H0GA 2DT2A 1NH6A 4L72B 2OLHA 3FY1A 1FKGA 3FAPA 1KT1A 4ODOA 4HBEA 4DZ3A 1SYTA 4GIVA 3CGNA 2ZQUA 4Z2JA 1FKIA 1NWRA 2KGJA 2MLYA 4JFIA 1W1TA 1NSGA 1W1VA 2RUDA 4ZPWR 2UZ5A 4WKAA 3G6MA 4Z2HA 5BXJA 4U84A 1Q1CA 3ARXA 2FKEA 2ZR4A 3WQWA 1JNDA 4XAKA 4DWSA 1NMVA 3RM9A 2FDMA 2IF4A 4MTVA 3O5GA 1EIBA 3EY6A 4FN2A 1K9TA 1JNSA 2XP9A 2LKNA 1N1AA 1E6RA 2FAPA 5DITA 3W4RA 5B8IC 3WIJA 2XP7A 3PA7A 1W9PA 2MPHA 3AS0A 1HJWA 4J4OA 5DIVA 4W5UA 3OOBA 1HKJA 4TW8A 5I98A 3CHFA 1YATA 2ZQTA 4NSBA 1HKKA 4QT3A 3B9DA 4Z2IA 2RURA 4Z2GA 3WD4A 4W9OA 1NMWA 3VAWA 2A3AA 2LPVA 2A3BA 4R5EA 4IQ2A 1JCHB 1FKFA 3WKZA 1D7HA 1SR0A 2MNTA 2G8ZA 1E15A 2KR7A 1ZL1A 2ZR6A 2A3EA 2MLZA 1ZBKA 1M5YA 4DRIA 1EHNA 1W9UA 4DRMA 3IK8A 1D7JA 4P8XA 1P5QA 4DWSB 1HJVA 1ZBVA 4PTMA 3UI4A 1FFRA 1D6OA 4ZPVR 2YBTA 3KAIA 3WQVA 2M2AA 2DT1A 4TX0A 4JYSA 4IT4A 3O5EA 3KADA 3NTPA 3GU0A 4C02B 4UDMA 2M08A 2XPBA 1UR8A 2ITKA 4MNKA 2AWGA 4ZS6A 5HWBA 4BF8A 1ZB5A 2DSWA 1LL4A 2K8IA 2KFWA 4WIWA 1W1PA 1JVWA 3CHEA 4WKHA 1VF8A 3CGMA 1F40A 1HKIA 5DF0A 4MPKA 2LJ4A 3JXVA 4LAYA 2XP8A 1JNTA 3KACA 1FD9A 2VCDA 1X6LA 1ZU8A 4QZVB 3WD2A 2IUZA 1ROTA 3ARRA 3O5RA 2WK2A 4NNRA 2PPNA 5HTGA 2P4VA 4MSPA 1W1YA 4GGQA 4LAXA 4ODNA 4DZ2A 4TNSA 4WJXA 1NWUA 3O5FA 2MLXA 2O9OA 4W9QA 3IKDA 1EYMA 2MF9A 4ITZA 4TYOA 4Q22A 2N87A 1FKBA 3JYMA 4ODQA 2ZR5A 4MNJA 3UQAA 3UI6A 3RFWA 1C9HA 2PV1A 1E9LA 5D75A 4S3KA 1OGGA 3AROA 1FKDA 2D9FA 2PN0A 4MAVA 3ARSA 2RQSA 3ARUA 1OWQA 1FKLA 3B7XA 4ZPTR 4ODKA 3WL1A 1F8AB 1Q6UA 3RMEA 3O5DA 1EQ3A 2ESCA 4ODLA 1A7XA 4KR0B 2PPPA 3JYJA 1EDQA 2RUQA 4W9PA 3CHDA 1HJXA 3O5MA 3RM4A 5HBFA 3AS2A 1J4HA 4DRKA 2DPEA 2B31A 3ARVA 2O92A 1H0IA 1FKSA 4DWSC 4ODMA 2ZQSA 4P8WA 4MNMA 2AOSA 2WM0A 2PV2A 4S3JA 3MDYB 2PV3A 2DSUA 3ALFA 3KAGA 3UF8A 1J4IA 1O6IA 5GQBA 3CHCA 2DG3A 1L1PA 1D2KA 5HW6A 4QT2A 4R0XA 3NI6A 1J4RA 2RUCA 2YBUA 1QZ2A 4DRHA 4ODRA 4DRJA 1XHGA 5J6EA 5HWCA 4DH0A 1FKHA 2A3CA 1HXVA 3AS1A 4QIBA 1FKRA 1W9VA 2VN1A 3OA5A 2XP5A 2EULA 4MNLA 1ZBCA 1FFQA 4JFLA 4U85A 1KT0A 1FJDA 3ARPA 5HW7A 1CTNA 3O5IA 1J6YA 2ZQVA 2F4EA 3KAFA 5HT1A 3PR9A 4URIA 1LL7A 2L2SA 1NWSA 4U86A 1D7IA 3ARTA 4TW7A 4LGXA 3LUOA 3ARYA 1WAWA 4Q7NA 4WKFA 1T11A 5DIUA 1PBKA 4IPXA 1RD6A 3GPKA 2KE0A 1R9HA 4JFKA 2M1IA 4WK9A 4DRPA 1Y0OA 3IHZA 1E6ZA 4TW6A 3ODKA 1IX5A 4Z2KA 4ML4A 3UQIA 2F21A 1GPFA 3WD3A 5HW8A 3TCZA 3ARQA 5HUAA 2F23A 3EIPA 4LAVA 4DT4A 1WB0A 3AQUA 3B9EA 5DEZA 3PRAA 4DROA 4DRQA 4J4NA 4NZCA 1TFVA 2F2DA 4HARA 4HBOA 3O5KA 3KAHA 1FAPA 1ITXA 3IKGA 5DO2A 3O5LA 3BMBA 1OGBA 1FKJA 2DSVA 1FKTA 2Y78A 3H9RB 4KQZA
chains in the Genus database with same CATH topology
1KFWA 3RM8A 2DT0A 1E6PA 4DIPA 3TC5A 1E6NA 2KI3A 3QOKA 4LAWA 2Q5AA 2WLYA 1UR9A 3PRDA 2PPOA 2XPAA 1TCOC 1QPFA 3ARZA 3UQBA 1LL6A 3RGCA 5GPGA 1PINA 1FKKA 3O5JA 2QF8A 1QPLA 1HKMA 1B6CA 2LGOA 3FXYA 1LG1A 4Z2LA 1XRVA 1GOIA 2JZVA 4IT6A 2XP3A 4IQCA 1YW5A 3ALGA 5HKGA 4P8UA 3KZ7A 1X6NA 3WH0A 1ZCNA 4JFMA 2DSZA 3O5QA 2G41A 3BXWA 2PBCA 2XP6A 3O5OA 4FAPA 2RSEA 3UI5A 1GUVA 3WD1A 3WL0A 4DWSD 1ZK6A 2PI6A 2DG9A 3B9AA 2DG4A 3WD0A 3KCEA 4DRNA 3ARWA 2XP4A 1WNOA 4MGVA 4JFJA 3TDBA 1U79A 3CH9A 1LG2A 3I6CA 4G2PA 1BL4A 4G50A 3AS3A 1LJYA 1ZBWA 1Q6IA 5JH8A 1JNEA 3B8SA 1NWTA 3KABA 4O2TA 1Q6HA 2WLZA 3CZ8A 1W26A 3G6LA 1LQ0A 3PRBA 3O5PA 5GPRA 3NRKA 2KO7A 4ODPA 4P8VA 2DT3A 1BKFA 1ROUA 4L3NA 4N19A 4AY1A 2OFNA 1H0GA 2DT2A 1NH6A 4L72B 2OLHA 3FY1A 1FKGA 3FAPA 1KT1A 4ODOA 4HBEA 4DZ3A 1SYTA 4GIVA 3CGNA 2ZQUA 4Z2JA 1FKIA 1NWRA 2KGJA 2MLYA 4JFIA 1W1TA 1NSGA 1W1VA 2RUDA 4ZPWR 2UZ5A 4WKAA 3G6MA 4Z2HA 5BXJA 4U84A 1Q1CA 3ARXA 2FKEA 2ZR4A 3WQWA 1JNDA 4XAKA 4DWSA 1NMVA 3RM9A 2FDMA 2IF4A 4MTVA 3O5GA 1EIBA 3EY6A 4FN2A 1K9TA 1JNSA 2XP9A 2LKNA 1N1AA 1E6RA 2FAPA 5DITA 3W4RA 5B8IC 3WIJA 2XP7A 3PA7A 1W9PA 2MPHA 3AS0A 1HJWA 4J4OA 5DIVA 4W5UA 3OOBA 1HKJA 4TW8A 5I98A 3CHFA 1YATA 2ZQTA 4NSBA 1HKKA 4QT3A 3B9DA 4Z2IA 2RURA 4Z2GA 3WD4A 4W9OA 1NMWA 3VAWA 2A3AA 2LPVA 2A3BA 4R5EA 4IQ2A 1FKFA 3WKZA 1D7HA 1SR0A 2MNTA 2G8ZA 1E15A 2KR7A 1ZL1A 2ZR6A 2A3EA 2MLZA 1ZBKA 1M5YA 4DRIA 1EHNA 1W9UA 4DRMA 3IK8A 1D7JA 4P8XA 1P5QA 4DWSB 1HJVA 1ZBVA 4PTMA 3UI4A 1FFRA 1D6OA 4ZPVR 2YBTA 3KAIA 3WQVA 2M2AA 2DT1A 4TX0A 4JYSA 4IT4A 3O5EA 3KADA 3NTPA 4C02B 2M08A 2XPBA 1UR8A 2ITKA 4MNKA 2AWGA 4ZS6A 5HWBA 4BF8A 1ZB5A 2DSWA 1LL4A 2K8IA 2KFWA 4WIWA 1W1PA 1JVWA 3CHEA 4WKHA 1VF8A 3CGMA 1F40A 1HKIA 5DF0A 4MPKA 2LJ4A 3JXVA 4LAYA 2XP8A 1JNTA 3KACA 1FD9A 2VCDA 1X6LA 1ZU8A 4QZVB 3WD2A 2IUZA 1ROTA 3ARRA 3O5RA 2WK2A 4NNRA 2PPNA 5HTGA 4MSPA 1W1YA 4GGQA 4LAXA 4ODNA 4DZ2A 4TNSA 4WJXA 1NWUA 3O5FA 2MLXA 2O9OA 4W9QA 3IKDA 1EYMA 2MF9A 4ITZA 4TYOA 4Q22A 2N87A 1FKBA 3JYMA 4ODQA 2ZR5A 4MNJA 3UQAA 3UI6A 3RFWA 1C9HA 2PV1A 1E9LA 5D75A 4S3KA 1OGGA 3AROA 1FKDA 2D9FA 4MAVA 3ARSA 2RQSA 3ARUA 1OWQA 1FKLA 3B7XA 4ZPTR 4ODKA 3WL1A 1F8AB 1Q6UA 3RMEA 3O5DA 1EQ3A 2ESCA 4ODLA 1A7XA 4KR0B 2PPPA 3JYJA 1EDQA 2RUQA 4W9PA 3CHDA 1HJXA 3O5MA 3RM4A 5HBFA 3AS2A 1J4HA 4DRKA 2DPEA 2B31A 3ARVA 2O92A 1H0IA 1FKSA 4DWSC 4ODMA 2ZQSA 4P8WA 4MNMA 2AOSA 2WM0A 2PV2A 4S3JA 3MDYB 2PV3A 2DSUA 3ALFA 3KAGA 3UF8A 1J4IA 1O6IA 5GQBA 3CHCA 2DG3A 1L1PA 1D2KA 5HW6A 4QT2A 4R0XA 3NI6A 1J4RA 2RUCA 2YBUA 1QZ2A 4DRHA 4ODRA 4DRJA 1XHGA 5J6EA 5HWCA 4DH0A 1FKHA 2A3CA 1HXVA 3AS1A 4QIBA 1FKRA 1W9VA 2VN1A 3OA5A 2XP5A 4MNLA 1ZBCA 1FFQA 4JFLA 4U85A 1KT0A 1FJDA 3ARPA 5HW7A 1CTNA 3O5IA 1J6YA 2ZQVA 2F4EA 3KAFA 5HT1A 3PR9A 4URIA 1LL7A 2L2SA 1NWSA 4U86A 1D7IA 3ARTA 4TW7A 4LGXA 3LUOA 3ARYA 1WAWA 4Q7NA 4WKFA 1T11A 5DIUA 1PBKA 4IPXA 1RD6A 3GPKA 2KE0A 1R9HA 4JFKA 2M1IA 4WK9A 4DRPA 1Y0OA 3IHZA 1E6ZA 4TW6A 3ODKA 1IX5A 4Z2KA 4ML4A 3UQIA 2F21A 1GPFA 3WD3A 5HW8A 3TCZA 3ARQA 5HUAA 4LAVA 4DT4A 1WB0A 3AQUA 3B9EA 5DEZA 3PRAA 4DROA 4DRQA 4J4NA 4NZCA 1TFVA 2F2DA 4HARA 4HBOA 3O5KA 3KAHA 1FAPA 1ITXA 3IKGA 5DO2A 3O5LA 1OGBA 1FKJA 2DSVA 1FKTA 2Y78A 3H9RB 4KQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAP A;  1KT1 A;  3KAD A;  3O5E A;  4ODO A;  3NTP A;  4C02 B;  4DZ3 A;  4GIV A;  1FKS A;  3TC5 A;  4DIP A;  2M08 A;  4ODM A;  2XPB A;  2KI3 A;  2ZQS A;  3CGN A;  2ITK A;  2ZQU A;  4LAW A;  2Q5A A;  1FKI A;  2MLY A;  2KGJ A;  4JFI A;  3H9R B;  1NSG A;  2AWG A;  2RUD A;  2PV2 A;  3PRD A;  5HWB A;  4BF8 A;  2PPO A;  2UZ5 A;  3MDY B;  2XPA A;  2PV3 A;  5BXJ A;  2K8I A;  1TCO C;  2KFW A;  4U84 A;  1QPF A;  1JVW A;  3KAG A;  1Q1C A;  3UF8 A;  1J4I A;  3UQB A;  2FKE A;  3CGM A;  3RGC A;  2DG3 A;  5GPG A;  1L1P A;  1F40 A;  2ZR4 A;  5HW6 A;  4QT2 A;  4R0X A;  1PIN A;  3NI6 A;  1FKK A;  1J4R A;  1NMV A;  2RUC A;  3O5J A;  1QZ2 A;  4DRH A;  1QPL A;  2LGO A;  1B6C A;  2LJ4 A;  2IF4 A;  4ODR A;  4DRJ A;  3JXV A;  5J6E A;  4LAY A;  5HWC A;  3O5G A;  2XP8 A;  1JNT A;  3EY6 A;  3KAC A;  4FN2 A;  1FD9 A;  4DH0 A;  1FKH A;  2VCD A;  1HXV A;  1JNS A;  2XP9 A;  2LKN A;  1N1A A;  4QIB A;  1FKR A;  2FAP A;  5DIT A;  5B8I C;  2VN1 A;  2JZV A;  2XP7 A;  2XP5 A;  1ROT A;  2XP3 A;  4IQC A;  3O5R A;  3PA7 A;  1YW5 A;  4NNR A;  2PPN A;  5HTG A;  5HKG A;  4JFL A;  4MSP A;  2MPH A;  4U85 A;  3KZ7 A;  1KT0 A;  4J4O A;  1FJD A;  4GGQ A;  4LAX A;  4ODN A;  5DIV A;  3OOB A;  4DZ2 A;  4TNS A;  3WH0 A;  5HW7 A;  1ZCN A;  4TW8 A;  4JFM A;  5I98 A;  3O5Q A;  1YAT A;  3O5F A;  2MLX A;  2ZQT A;  2PBC A;  4W9Q A;  3O5I A;  3IKD A;  1EYM A;  2XP6 A;  2MF9 A;  4ITZ A;  4TYO A;  2ZQV A;  2F4E A;  3KAF A;  5HT1 A;  1J6Y A;  3O5O A;  4FAP A;  2N87 A;  1FKB A;  2RSE A;  3UI5 A;  2L2S A;  4QT3 A;  3JYM A;  4ODQ A;  2ZR5 A;  3UQA A;  4U86 A;  1ZK6 A;  2RUR A;  4TW7 A;  2DG9 A;  4W9O A;  1NMW A;  3UI6 A;  3VAW A;  3RFW A;  2LPV A;  2DG4 A;  1C9H A;  2PV1 A;  3LUO A;  4IQ2 A;  4DRK A;  3KCE A;  5D75 A;  1FKF A;  4DRN A;  2XP4 A;  1T11 A;  5DIU A;  1PBK A;  4IPX A;  4MGV A;  4JFJ A;  1D7H A;  1FKD A;  3TDB A;  2MNT A;  1U79 A;  2KE0 A;  1R9H A;  3GPK A;  2M1I A;  2D9F A;  4JFK A;  4DRP A;  1Y0O A;  3I6C A;  3IHZ A;  4G2P A;  4TW6 A;  1BL4 A;  3ODK A;  4G50 A;  3UQI A;  1Q6I A;  2F21 A;  2RQS A;  5HW8 A;  3TCZ A;  2KR7 A;  5HUA A;  4LAV A;  4DT4 A;  1FKL A;  2ZR6 A;  3B7X A;  2MLZ A;  1Q6H A;  3KAB A;  4O2T A;  1M5Y A;  1W26 A;  4DRI A;  4DRM A;  4ODK A;  3IK8 A;  1F8A B;  3PRB A;  3O5P A;  4DRO A;  1D7J A;  4DRQ A;  4J4N A;  2F2D A;  1Q6U A;  3NRK A;  3O5D A;  1P5Q A;  2KO7 A;  3KAH A;  3O5K A;  4ODP A;  1EQ3 A;  1FAP A;  4ODL A;  1A7X A;  3UI4 A;  2PPP A;  2RUQ A;  3JYJ A;  1BKF A;  1D6O A;  3IKG A;  4W9P A;  1ROU A;  3O5M A;  3O5L A;  4N19 A;  2OFN A;  3KAI A;  2M2A A;  1FKJ A;  4TX0 A;  1FKT A;  4JYS A;  1J4H A;  2Y78 A;  1D7I A;  1FKG A; 
#chains in the Genus database with same CATH topology
 1KFW A;  3RM8 A;  2DT0 A;  1E6P A;  4DIP A;  3TC5 A;  1E6N A;  2KI3 A;  3QOK A;  4LAW A;  2Q5A A;  2WLY A;  1UR9 A;  3PRD A;  2PPO A;  2XPA A;  1TCO C;  1QPF A;  3ARZ A;  3UQB A;  1LL6 A;  3RGC A;  5GPG A;  1PIN A;  1GRJ A;  1FKK A;  3O5J A;  2QF8 A;  1QPL A;  1HKM A;  1B6C A;  2LGO A;  3FXY A;  1LG1 A;  4Z2L A;  1XRV A;  1GOI A;  2JZV A;  2B5U B;  4IT6 A;  2XP3 A;  4IQC A;  1YW5 A;  3ALG A;  5HKG A;  4P8U A;  3KZ7 A;  1X6N A;  3WH0 A;  1ZCN A;  4JFM A;  2DSZ A;  3O5Q A;  2G41 A;  3BXW A;  2PBC A;  2XP6 A;  3O5O A;  4FAP A;  2RSE A;  3UI5 A;  1GUV A;  3WD1 A;  3WL0 A;  4DWS D;  1ZK6 A;  2PI6 A;  2DG9 A;  3B9A A;  2DG4 A;  3WD0 A;  3KCE A;  4DRN A;  3ARW A;  2XP4 A;  1WNO A;  4MGV A;  4JFJ A;  3TDB A;  1U79 A;  3CH9 A;  1LG2 A;  3I6C A;  4G2P A;  1BL4 A;  4G50 A;  3AS3 A;  1LJY A;  1ZBW A;  1Q6I A;  5JH8 A;  1JNE A;  3B8S A;  1NWT A;  3KAB A;  4O2T A;  1Q6H A;  2WLZ A;  3CZ8 A;  1W26 A;  3G6L A;  1LQ0 A;  3PRB A;  2ETN A;  3O5P A;  5GPR A;  3GTY X;  3NRK A;  2KO7 A;  4ODP A;  4P8V A;  2DT3 A;  1E44 A;  1BKF A;  1ROU A;  4L3N A;  4N19 A;  4AY1 A;  2OFN A;  1H0G A;  2DT2 A;  1NH6 A;  4L72 B;  2OLH A;  3FY1 A;  1FKG A;  3FAP A;  1KT1 A;  4ODO A;  4HBE A;  4DZ3 A;  1SYT A;  4GIV A;  3CGN A;  2ZQU A;  4Z2J A;  1FKI A;  1NWR A;  2KGJ A;  2MLY A;  4JFI A;  1W1T A;  1NSG A;  1W1V A;  2RUD A;  4ZPW R;  2UZ5 A;  4WKA A;  3G6M A;  4Z2H A;  5BXJ A;  4U84 A;  1Q1C A;  3ARX A;  2FKE A;  2ZR4 A;  3WQW A;  1JND A;  4XAK A;  4DWS A;  1NMV A;  3RM9 A;  2FDM A;  2IF4 A;  4MTV A;  3O5G A;  1EIB A;  3EY6 A;  4FN2 A;  1K9T A;  1JNS A;  2XP9 A;  2LKN A;  1N1A A;  1E6R A;  2FAP A;  5DIT A;  3W4R A;  5B8I C;  3WIJ A;  2XP7 A;  3PA7 A;  1W9P A;  2MPH A;  3AS0 A;  1HJW A;  4J4O A;  5DIV A;  4W5U A;  3OOB A;  1HKJ A;  4TW8 A;  5I98 A;  3CHF A;  1YAT A;  2ZQT A;  4NSB A;  1HKK A;  4QT3 A;  3B9D A;  4Z2I A;  2RUR A;  4Z2G A;  3WD4 A;  4W9O A;  1NMW A;  3VAW A;  2A3A A;  2LPV A;  2A3B A;  4R5E A;  4IQ2 A;  1JCH B;  1FKF A;  3WKZ A;  1D7H A;  1SR0 A;  2MNT A;  2G8Z A;  1E15 A;  2KR7 A;  1ZL1 A;  2ZR6 A;  2A3E A;  2MLZ A;  1ZBK A;  1M5Y A;  4DRI A;  1EHN A;  1W9U A;  4DRM A;  3IK8 A;  1D7J A;  4P8X A;  1P5Q A;  4DWS B;  1HJV A;  1ZBV A;  4PTM A;  3UI4 A;  1FFR A;  1D6O A;  4ZPV R;  2YBT A;  3KAI A;  3WQV A;  2M2A A;  2DT1 A;  4TX0 A;  4JYS A;  4IT4 A;  3O5E A;  3KAD A;  3NTP A;  3GU0 A;  4C02 B;  4UDM A;  2M08 A;  2XPB A;  1UR8 A;  2ITK A;  4MNK A;  2AWG A;  4ZS6 A;  5HWB A;  4BF8 A;  1ZB5 A;  2DSW A;  1LL4 A;  2K8I A;  2KFW A;  4WIW A;  1W1P A;  1JVW A;  3CHE A;  4WKH A;  1VF8 A;  3CGM A;  1F40 A;  1HKI A;  5DF0 A;  4MPK A;  2LJ4 A;  3JXV A;  4LAY A;  2XP8 A;  1JNT A;  3KAC A;  1FD9 A;  2VCD A;  1X6L A;  1ZU8 A;  4QZV B;  3WD2 A;  2IUZ A;  1ROT A;  3ARR A;  3O5R A;  2WK2 A;  4NNR A;  2PPN A;  5HTG A;  2P4V A;  4MSP A;  1W1Y A;  4GGQ A;  4LAX A;  4ODN A;  4DZ2 A;  4TNS A;  4WJX A;  1NWU A;  3O5F A;  2MLX A;  2O9O A;  4W9Q A;  3IKD A;  1EYM A;  2MF9 A;  4ITZ A;  4TYO A;  4Q22 A;  2N87 A;  1FKB A;  3JYM A;  4ODQ A;  2ZR5 A;  4MNJ A;  3UQA A;  3UI6 A;  3RFW A;  1C9H A;  2PV1 A;  1E9L A;  5D75 A;  4S3K A;  1OGG A;  3ARO A;  1FKD A;  2D9F A;  2PN0 A;  4MAV A;  3ARS A;  2RQS A;  3ARU A;  1OWQ A;  1FKL A;  3B7X A;  4ZPT R;  4ODK A;  3WL1 A;  1F8A B;  1Q6U A;  3RME A;  3O5D A;  1EQ3 A;  2ESC A;  4ODL A;  1A7X A;  4KR0 B;  2PPP A;  3JYJ A;  1EDQ A;  2RUQ A;  4W9P A;  3CHD A;  1HJX A;  3O5M A;  3RM4 A;  5HBF A;  3AS2 A;  1J4H A;  4DRK A;  2DPE A;  2B31 A;  3ARV A;  2O92 A;  1H0I A;  1FKS A;  4DWS C;  4ODM A;  2ZQS A;  4P8W A;  4MNM A;  2AOS A;  2WM0 A;  2PV2 A;  4S3J A;  3MDY B;  2PV3 A;  2DSU A;  3ALF A;  3KAG A;  3UF8 A;  1J4I A;  1O6I A;  5GQB A;  3CHC A;  2DG3 A;  1L1P A;  1D2K A;  5HW6 A;  4QT2 A;  4R0X A;  3NI6 A;  1J4R A;  2RUC A;  2YBU A;  1QZ2 A;  4DRH A;  4ODR A;  4DRJ A;  1XHG A;  5J6E A;  5HWC A;  4DH0 A;  1FKH A;  2A3C A;  1HXV A;  3AS1 A;  4QIB A;  1FKR A;  1W9V A;  2VN1 A;  3OA5 A;  2XP5 A;  2EUL A;  4MNL A;  1ZBC A;  1FFQ A;  4JFL A;  4U85 A;  1KT0 A;  1FJD A;  3ARP A;  5HW7 A;  1CTN A;  3O5I A;  1J6Y A;  2ZQV A;  2F4E A;  3KAF A;  5HT1 A;  3PR9 A;  4URI A;  1LL7 A;  2L2S A;  1NWS A;  4U86 A;  1D7I A;  3ART A;  4TW7 A;  4LGX A;  3LUO A;  3ARY A;  1WAW A;  4Q7N A;  4WKF A;  1T11 A;  5DIU A;  1PBK A;  4IPX A;  1RD6 A;  3GPK A;  2KE0 A;  1R9H A;  4JFK A;  2M1I A;  4WK9 A;  4DRP A;  1Y0O A;  3IHZ A;  1E6Z A;  4TW6 A;  3ODK A;  1IX5 A;  4Z2K A;  4ML4 A;  3UQI A;  2F21 A;  1GPF A;  3WD3 A;  5HW8 A;  3TCZ A;  3ARQ A;  5HUA A;  2F23 A;  3EIP A;  4LAV A;  4DT4 A;  1WB0 A;  3AQU A;  3B9E A;  5DEZ A;  3PRA A;  4DRO A;  4DRQ A;  4J4N A;  4NZC A;  1TFV A;  2F2D A;  4HAR A;  4HBO A;  3O5K A;  3KAH A;  1FAP A;  1ITX A;  3IKG A;  5DO2 A;  3O5L A;  3BMB A;  1OGB A;  1FKJ A;  2DSV A;  1FKT A;  2Y78 A;  3H9R B;  4KQZ A; 
#chains in the Genus database with same CATH homology
 1KFW A;  3RM8 A;  2DT0 A;  1E6P A;  4DIP A;  3TC5 A;  1E6N A;  2KI3 A;  3QOK A;  4LAW A;  2Q5A A;  2WLY A;  1UR9 A;  3PRD A;  2PPO A;  2XPA A;  1TCO C;  1QPF A;  3ARZ A;  3UQB A;  1LL6 A;  3RGC A;  5GPG A;  1PIN A;  1FKK A;  3O5J A;  2QF8 A;  1QPL A;  1HKM A;  1B6C A;  2LGO A;  3FXY A;  1LG1 A;  4Z2L A;  1XRV A;  1GOI A;  2JZV A;  4IT6 A;  2XP3 A;  4IQC A;  1YW5 A;  3ALG A;  5HKG A;  4P8U A;  3KZ7 A;  1X6N A;  3WH0 A;  1ZCN A;  4JFM A;  2DSZ A;  3O5Q A;  2G41 A;  3BXW A;  2PBC A;  2XP6 A;  3O5O A;  4FAP A;  2RSE A;  3UI5 A;  1GUV A;  3WD1 A;  3WL0 A;  4DWS D;  1ZK6 A;  2PI6 A;  2DG9 A;  3B9A A;  2DG4 A;  3WD0 A;  3KCE A;  4DRN A;  3ARW A;  2XP4 A;  1WNO A;  4MGV A;  4JFJ A;  3TDB A;  1U79 A;  3CH9 A;  1LG2 A;  3I6C A;  4G2P A;  1BL4 A;  4G50 A;  3AS3 A;  1LJY A;  1ZBW A;  1Q6I A;  5JH8 A;  1JNE A;  3B8S A;  1NWT A;  3KAB A;  4O2T A;  1Q6H A;  2WLZ A;  3CZ8 A;  1W26 A;  3G6L A;  1LQ0 A;  3PRB A;  3O5P A;  5GPR A;  3NRK A;  2KO7 A;  4ODP A;  4P8V A;  2DT3 A;  1BKF A;  1ROU A;  4L3N A;  4N19 A;  4AY1 A;  2OFN A;  1H0G A;  2DT2 A;  1NH6 A;  4L72 B;  2OLH A;  3FY1 A;  1FKG A;  3FAP A;  1KT1 A;  4ODO A;  4HBE A;  4DZ3 A;  1SYT A;  4GIV A;  3CGN A;  2ZQU A;  4Z2J A;  1FKI A;  1NWR A;  2KGJ A;  2MLY A;  4JFI A;  1W1T A;  1NSG A;  1W1V A;  2RUD A;  4ZPW R;  2UZ5 A;  4WKA A;  3G6M A;  4Z2H A;  5BXJ A;  4U84 A;  1Q1C A;  3ARX A;  2FKE A;  2ZR4 A;  3WQW A;  1JND A;  4XAK A;  4DWS A;  1NMV A;  3RM9 A;  2FDM A;  2IF4 A;  4MTV A;  3O5G A;  1EIB A;  3EY6 A;  4FN2 A;  1K9T A;  1JNS A;  2XP9 A;  2LKN A;  1N1A A;  1E6R A;  2FAP A;  5DIT A;  3W4R A;  5B8I C;  3WIJ A;  2XP7 A;  3PA7 A;  1W9P A;  2MPH A;  3AS0 A;  1HJW A;  4J4O A;  5DIV A;  4W5U A;  3OOB A;  1HKJ A;  4TW8 A;  5I98 A;  3CHF A;  1YAT A;  2ZQT A;  4NSB A;  1HKK A;  4QT3 A;  3B9D A;  4Z2I A;  2RUR A;  4Z2G A;  3WD4 A;  4W9O A;  1NMW A;  3VAW A;  2A3A A;  2LPV A;  2A3B A;  4R5E A;  4IQ2 A;  1FKF A;  3WKZ A;  1D7H A;  1SR0 A;  2MNT A;  2G8Z A;  1E15 A;  2KR7 A;  1ZL1 A;  2ZR6 A;  2A3E A;  2MLZ A;  1ZBK A;  1M5Y A;  4DRI A;  1EHN A;  1W9U A;  4DRM A;  3IK8 A;  1D7J A;  4P8X A;  1P5Q A;  4DWS B;  1HJV A;  1ZBV A;  4PTM A;  3UI4 A;  1FFR A;  1D6O A;  4ZPV R;  2YBT A;  3KAI A;  3WQV A;  2M2A A;  2DT1 A;  4TX0 A;  4JYS A;  4IT4 A;  3O5E A;  3KAD A;  3NTP A;  4C02 B;  2M08 A;  2XPB A;  1UR8 A;  2ITK A;  4MNK A;  2AWG A;  4ZS6 A;  5HWB A;  4BF8 A;  1ZB5 A;  2DSW A;  1LL4 A;  2K8I A;  2KFW A;  4WIW A;  1W1P A;  1JVW A;  3CHE A;  4WKH A;  1VF8 A;  3CGM A;  1F40 A;  1HKI A;  5DF0 A;  4MPK A;  2LJ4 A;  3JXV A;  4LAY A;  2XP8 A;  1JNT A;  3KAC A;  1FD9 A;  2VCD A;  1X6L A;  1ZU8 A;  4QZV B;  3WD2 A;  2IUZ A;  1ROT A;  3ARR A;  3O5R A;  2WK2 A;  4NNR A;  2PPN A;  5HTG A;  4MSP A;  1W1Y A;  4GGQ A;  4LAX A;  4ODN A;  4DZ2 A;  4TNS A;  4WJX A;  1NWU A;  3O5F A;  2MLX A;  2O9O A;  4W9Q A;  3IKD A;  1EYM A;  2MF9 A;  4ITZ A;  4TYO A;  4Q22 A;  2N87 A;  1FKB A;  3JYM A;  4ODQ A;  2ZR5 A;  4MNJ A;  3UQA A;  3UI6 A;  3RFW A;  1C9H A;  2PV1 A;  1E9L A;  5D75 A;  4S3K A;  1OGG A;  3ARO A;  1FKD A;  2D9F A;  4MAV A;  3ARS A;  2RQS A;  3ARU A;  1OWQ A;  1FKL A;  3B7X A;  4ZPT R;  4ODK A;  3WL1 A;  1F8A B;  1Q6U A;  3RME A;  3O5D A;  1EQ3 A;  2ESC A;  4ODL A;  1A7X A;  4KR0 B;  2PPP A;  3JYJ A;  1EDQ A;  2RUQ A;  4W9P A;  3CHD A;  1HJX A;  3O5M A;  3RM4 A;  5HBF A;  3AS2 A;  1J4H A;  4DRK A;  2DPE A;  2B31 A;  3ARV A;  2O92 A;  1H0I A;  1FKS A;  4DWS C;  4ODM A;  2ZQS A;  4P8W A;  4MNM A;  2AOS A;  2WM0 A;  2PV2 A;  4S3J A;  3MDY B;  2PV3 A;  2DSU A;  3ALF A;  3KAG A;  3UF8 A;  1J4I A;  1O6I A;  5GQB A;  3CHC A;  2DG3 A;  1L1P A;  1D2K A;  5HW6 A;  4QT2 A;  4R0X A;  3NI6 A;  1J4R A;  2RUC A;  2YBU A;  1QZ2 A;  4DRH A;  4ODR A;  4DRJ A;  1XHG A;  5J6E A;  5HWC A;  4DH0 A;  1FKH A;  2A3C A;  1HXV A;  3AS1 A;  4QIB A;  1FKR A;  1W9V A;  2VN1 A;  3OA5 A;  2XP5 A;  4MNL A;  1ZBC A;  1FFQ A;  4JFL A;  4U85 A;  1KT0 A;  1FJD A;  3ARP A;  5HW7 A;  1CTN A;  3O5I A;  1J6Y A;  2ZQV A;  2F4E A;  3KAF A;  5HT1 A;  3PR9 A;  4URI A;  1LL7 A;  2L2S A;  1NWS A;  4U86 A;  1D7I A;  3ART A;  4TW7 A;  4LGX A;  3LUO A;  3ARY A;  1WAW A;  4Q7N A;  4WKF A;  1T11 A;  5DIU A;  1PBK A;  4IPX A;  1RD6 A;  3GPK A;  2KE0 A;  1R9H A;  4JFK A;  2M1I A;  4WK9 A;  4DRP A;  1Y0O A;  3IHZ A;  1E6Z A;  4TW6 A;  3ODK A;  1IX5 A;  4Z2K A;  4ML4 A;  3UQI A;  2F21 A;  1GPF A;  3WD3 A;  5HW8 A;  3TCZ A;  3ARQ A;  5HUA A;  4LAV A;  4DT4 A;  1WB0 A;  3AQU A;  3B9E A;  5DEZ A;  3PRA A;  4DRO A;  4DRQ A;  4J4N A;  4NZC A;  1TFV A;  2F2D A;  4HAR A;  4HBO A;  3O5K A;  3KAH A;  1FAP A;  1ITX A;  3IKG A;  5DO2 A;  3O5L A;  1OGB A;  1FKJ A;  2DSV A;  1FKT A;  2Y78 A;  3H9R B;  4KQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...