1A7XA

Fkbp12-fk1012 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKBP12
molecule tags Isomerase
source organism Homo sapiens
publication title Chemical inducers of dimerization: the atomic structure of FKBP12-FK1012A-FKBP12.
pubmed doi rcsb
total genus 26
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1a7xA00
1FKSA 4DZ2A 1TCOC 2KGJA 1L1PA 3OOBA 1T11A 3TCZA 2DG3A 3UQIA 1EYMA 1C9HA 4TNSA 4DRIA 4W9OA 4TYOA 1JNTA 5DIVA 2RQSA 1F8AB 3CGMA 2N87A 3VAWA 3O5FA 2PBCA 4DRKA 2OFNA 3KAIA 2M08A 2XP3A 2XP5A 5D75A 3GPKA 3UI4A 1PINA 4TX0A 2XP4A 4FN2A 5HUAA 2M2AA 1R9HA 2Y78A 4MSPA 1Y0OA 3PA7A 3UQAA 4J4NA 1BL4A 4DRNA 1Q6UA 1FKHA 1FKBA 3WH0A 4JFIA 5DITA 1FD9A 4TW8A 4DT4A 3KABA 2D9FA 3JYMA 4ODMA 1EQ3A 4J4OA 4JYSA 5HT1A 3UI5A 4W9PA 4QT2A 4W9QA 3IHZA 2MLYA 2XPBA 5DIUA 2F21A 2IF4A 2KI3A 1ROTA 2KE0A 2ZQTA 2XP6A 2AWGA 2LKNA 5HW7A 5J6EA 1B6CA 2K8IA 2DG4A 2XP8A 3TDBA 1J4HA 3O5EA 1FKFA 2MNTA 2RUQA 2F2DA 2PV1A 2ZR6A 3IKGA 2ZR5A 1J4RA 3B7XA 3CGNA 1ZCNA 2LJ4A 1FAPA 2PPOA 4QT3A 2KR7A 5GPGA 4ODQA 2LGOA 3I6CA 2FKEA 4LAYA 4ODKA 1D7HA 2JZVA 3NTPA 3RGCA 2FAPA 4IQ2A 2PPPA 2ZQUA 3O5JA 1NSGA 1FKDA 4TW6A 4DIPA 5B8IC 3KAHA 4U85A 1FKGA 4ODPA 4ODOA 3UF8A 4GGQA 4IQCA 5BXJA 4DRQA 1FKJA 1ROUA 2XP7A 4ODNA 2L2SA 2LPVA 2F4EA 4G2PA 1BKFA 2ITKA 1HXVA 3RFWA 2XP9A 3LUOA 3O5MA 1Q6IA 1FKLA 1QPFA 1QZ2A 2MPHA 2Q5AA 4DRHA 2RUDA 1W26A 4DROA 2RURA 2ZQSA 2ZQVA 2DG9A 5I98A 2UZ5A 1M5YA 3O5IA 3O5QA 1U79A 2KO7A 3KAGA 1D7JA 4DZ3A 3KAFA 4JFLA 5HWBA 5HWCA 1QPLA 2MF9A 4U86A 1KT1A 3O5GA 3PRBA 1D6OA 1KT0A 2KFWA 4DRJA 3O5RA 4NNRA 2MLXA 4DRPA 3UQBA 4JFKA 4FAPA 2RSEA 3KCEA 4ODLA 2RUCA 3KADA 3IKDA 4ODRA 3PRDA 1F40A 2ZR4A 3H9RB 1N1AA 3KZ7A 2PPNA 2XPAA 3IK8A 3O5OA 4GIVA 4LAWA 1YATA 1YW5A 3O5KA 2VCDA 5HW8A 1Q1CA 4JFJA 5HTGA 2PV3A 3MDYB 1JVWA 1D7IA 1PBKA 2M1IA 1FKIA 1Q6HA 1NMWA 1ZK6A 4ITZA 4JFMA 4N19A 1FKRA 1JNSA 4MGVA 3EY6A 3JXVA 3JYJA 1FKKA 1A7XA 1J4IA 2MLZA 3FAPA 4BF8A 3KACA 2PV2A 4DH0A 1J6YA 3O5DA 4LAVA 4TW7A 1P5QA 4IPXA 4O2TA 3O5LA 2VN1A 1FJDA 4QIBA 1NMVA 5HW6A 1FKTA 4C02B 3UI6A 3TC5A 3O5PA 4R0XA 4DRMA 3NRKA 4LAXA 4U84A 4G50A 3ODKA 5HKGA 3NI6A
chains in the Genus database with same CATH superfamily
1FKSA 3OOBA 1TFVA 3FXYA 1HKKA 1H0IA 1JNTA 3CGMA 3RMEA 4DWSB 3O5FA 3KAIA 1OGBA 2YBTA 4TX0A 4FN2A 4URIA 2M2AA 4MSPA 3WIJA 3UQAA 3WD2A 4Z2IA 1FD9A 4WKHA 4ZS6A 1EQ3A 3B9DA 1W1TA 2ETNA 2G41A 2F21A 2KI3A 3ARWA 1VF8A 2DG4A 3O5EA 2O92A 1FKFA 2MNTA 3AS1A 3IKGA 1J4RA 1ZCNA 2LJ4A 1FAPA 2KR7A 4ODQA 3I6CA 2FDMA 3O5JA 1FKDA 1EHNA 4S3JA 4ODPA 1K9TA 4DRQA 1ROUA 3RM4A 4IT4A 3RFWA 2RUDA 4Z2JA 2DG9A 5I98A 2UZ5A 3WD4A 1D7JA 1EDQA 3BXWA 4NSBA 1QPLA 2MF9A 4U86A 1KT1A 3PRBA 1KT0A 1E6RA 4ODRA 3PRDA 1F40A 3WL1A 4DWSA 3ARSA 1WNOA 4GIVA 3W4RA 1YATA 4ML4A 5GPRA 3G6LA 2PV3A 3G6MA 1D7IA 1FKIA 2M1IA 3ARPA 1FKRA 1JNSA 4ITZA 2PV2A 1FFQA 1HKMA 2F23A 2VN1A 1NMVA 5HW6A 4R0XA 1NH6A 4LAXA 1E6PA 4G50A 3ODKA 1O6IA 3WL0A 1L1PA 4L3NA 1ZBCA 1OWQA 1GRJA 1T11A 3TCZA 2DG3A 4KQZA 4TYOA 1FFRA 3AROA 1UR8A 2PBCA 4DRKA 2OFNA 2M08A 2XP3A 5D75A 2OLHA 3GPKA 3UI4A 3ARTA 1W9UA 1Y0OA 3ALGA 3AQUA 1CTNA 1Q6UA 4HBEA 4DT4A 4JFIA 2D9FA 5DF0A 4ODMA 4Q22A 4WKFA 1XRVA 4HARA 4W9QA 1UR9A 2LKNA 1HKJA 3CHDA 1B6CA 4PTMA 1J4HA 1W1YA 1LL4A 4ZPTR 2RUQA 1E6ZA 2PI6A 2PV1A 2ZR6A 3ARUA 3B7XA 2PPOA 2EULA 5GPGA 3RGCA 3WKZA 2DT3A 2JZVA 4WK9A 4IQ2A 2A3AA 2ZQUA 4DWSC 2DSUA 1NSGA 4TW6A 4ODOA 3UF8A 4GGQA 4IQCA 3ARXA 1ZL1A 1GOIA 2XP7A 4ODNA 4G2PA 1BKFA 3O5MA 1Q6IA 1FKLA 1QPFA 1QZ2A 2Q5AA 4HBOA 4MTVA 4LGXA 4WJXA 1NWUA 3GTYX 3O5IA 4P8VA 2KO7A 3KAGA 4DZ3A 3KAFA 5DO2A 3RM8A 2DT0A 4QZVB 2MLXA 4JFKA 4FAPA 1GPFA 1ZBVA 3KADA 1RD6A 2ZR4A 3PR9A 1N1AA 4LAWA 3IK8A 4W5UA 4JFMA 1HKIA 4N19A 3AS0A 3JYJA 1FKKA 2MLZA 2DT2A 3KACA 4DH0A 1J6YA 3O5DA 1P5QA 2DSVA 1HJXA 3O5LA 1FJDA 4QIBA 5GQBA 1LL6A 4C02B 1X6LA 3NRKA 4U84A 3NI6A 3BMBA 3PRAA 4DZ2A 3B9AA 2KGJA 1E15A 3UQIA 1EYMA 1C9HA 2AOSA 1WAWA 4W9OA 3ALFA 5DIVA 1ITXA 2RQSA 1F8AB 3VAWA 1E6NA 2O9OA 3B9EA 3PA7A 2B31A 4DRNA 1FKBA 2IUZA 5DITA 4TW8A 1EIBA 4J4OA 4JYSA 1GUVA 4QT2A 4P8UA 3IHZA 2QF8A 2IF4A 2KE0A 2ZQTA 2XP6A 2XP8A 4L72B 4WIWA 3TDBA 2DPEA 2F2DA 4QT3A 1IX5A 1H0GA 2LGOA 5J6EA 4ODKA 4ZPWR 1D7HA 3NTPA 2PPPA 1ZBKA 4DIPA 1ZB5A 5B8IC 1ZU8A 1KFWA 5BXJA 1E44A 3WQVA 2F4EA 3ARZA 2ITKA 3CHFA 1HXVA 2MPHA 4KR0B 4DRHA 4WKAA 1W26A 2ZQVA 1M5YA 3ARRA 3O5QA 4P8XA 5HWBA 2PN0A 4JFLA 5HWCA 4DRJA 2KFWA 3O5RA 3UQBA 4DRPA 2RSEA 2A3BA 2A3EA 2RUCA 3IKDA 4MPKA 1E9LA 4MNKA 2PPNA 3CHEA 1YW5A 1W9PA 3O5KA 5HW8A 3WQWA 5HTGA 2DT1A 1PBKA 1ZK6A 2DSWA 1Q6HA 4MGVA 3JXVA 1A7XA 2YBUA 1HJWA 4XAKA 5HBFA 4LAVA 3AS3A 4TW7A 4O2TA 1X6NA 3B8SA 1W1PA 3UI6A 3O5PA 3CZ8A 1TCOC 2WM0A 4R5EA 3RM9A 4Z2GA 4Z2KA 1JNDA 4DRIA 4TNSA 1LG1A 1LJYA 2N87A 1OGGA 1JNEA 4MAVA 5JH8A 2XP5A 1PINA 4NZCA 2XP4A 5HUAA 1R9HA 2Y78A 4J4NA 1BL4A 2P4VA 1NWSA 3CHCA 2G8ZA 1FKHA 3WH0A 3KABA 3FY1A 3JYMA 3OA5A 5HT1A 3UI5A 1NWRA 2WLYA 4W9PA 4MNLA 1XHGA 2MLYA 2XPBA 5DIUA 3ARQA 1ROTA 3EIPA 3WD3A 2AWGA 5HW7A 2K8IA 5DEZA 2B5UB 2ZR5A 3CGNA 3ARVA 3ARYA 2FKEA 4LAYA 2FAPA 3GU0A 3KAHA 4UDMA 4U85A 1FKGA 4ZPVR 2A3CA 1FKJA 1LG2A 2L2SA 2LPVA 4Q7NA 2XP9A 3LUOA 4P8WA 1D2KA 3CH9A 4DROA 2RURA 1W1VA 2ZQSA 1LQ0A 1U79A 4AY1A 3O5GA 1D6OA 4Z2LA 1SR0A 4NNRA 3KCEA 4ODLA 4Z2HA 3WD1A 3H9RB 3O5OA 3KZ7A 2XPAA 2VCDA 4IT6A 1Q1CA 4JFJA 1SYTA 1WB0A 3MDYB 1JVWA 2DSZA 1NMWA 1NWTA 4MNMA 3QOKA 1HJVA 3EY6A 1W9VA 3FAPA 1J4IA 1JCHB 4BF8A 2WLZA 4DWSD 4IPXA 4MNJA 2ESCA 1ZBWA 1LL7A 1FKTA 4S3KA 3WD0A 5HKGA 3TC5A 4DRMA 2WK2A 3AS2A
chains in the Genus database with same CATH topology
1FKSA 3OOBA 1TFVA 3FXYA 1HKKA 1H0IA 1JNTA 3CGMA 3RMEA 4DWSB 3O5FA 3KAIA 1OGBA 2YBTA 4TX0A 4FN2A 4URIA 2M2AA 4MSPA 3WIJA 3UQAA 3WD2A 4Z2IA 1FD9A 4WKHA 4ZS6A 1EQ3A 3B9DA 1W1TA 2G41A 2F21A 2KI3A 3ARWA 1VF8A 2DG4A 3O5EA 2O92A 1FKFA 2MNTA 3AS1A 3IKGA 1J4RA 1ZCNA 2LJ4A 1FAPA 2KR7A 4ODQA 3I6CA 2FDMA 3O5JA 1FKDA 1EHNA 4S3JA 4ODPA 1K9TA 4DRQA 1ROUA 3RM4A 4IT4A 3RFWA 2RUDA 4Z2JA 2DG9A 5I98A 2UZ5A 3WD4A 1D7JA 1EDQA 3BXWA 4NSBA 1QPLA 2MF9A 4U86A 1KT1A 3PRBA 1KT0A 1E6RA 4ODRA 3PRDA 1F40A 3WL1A 4DWSA 3ARSA 1WNOA 4GIVA 3W4RA 1YATA 4ML4A 5GPRA 3G6LA 2PV3A 3G6MA 1D7IA 1FKIA 2M1IA 3ARPA 1FKRA 1JNSA 4ITZA 2PV2A 1FFQA 1HKMA 2VN1A 1NMVA 5HW6A 4R0XA 1NH6A 4LAXA 1E6PA 4G50A 3ODKA 1O6IA 3WL0A 1L1PA 4L3NA 1ZBCA 1OWQA 1T11A 3TCZA 2DG3A 4KQZA 4TYOA 1FFRA 3AROA 1UR8A 2PBCA 4DRKA 2OFNA 2M08A 2XP3A 5D75A 2OLHA 3GPKA 3UI4A 3ARTA 1W9UA 1Y0OA 3ALGA 3AQUA 1CTNA 1Q6UA 4HBEA 4DT4A 4JFIA 2D9FA 5DF0A 4ODMA 4Q22A 4WKFA 1XRVA 4HARA 4W9QA 1UR9A 2LKNA 1HKJA 3CHDA 1B6CA 4PTMA 1J4HA 1W1YA 1LL4A 4ZPTR 2RUQA 1E6ZA 2PI6A 2PV1A 2ZR6A 3ARUA 3B7XA 2PPOA 5GPGA 3RGCA 3WKZA 2DT3A 2JZVA 4WK9A 4IQ2A 2A3AA 2ZQUA 4DWSC 2DSUA 1NSGA 4TW6A 4ODOA 3UF8A 4GGQA 4IQCA 3ARXA 1ZL1A 1GOIA 2XP7A 4ODNA 4G2PA 1BKFA 3O5MA 1Q6IA 1FKLA 1QPFA 1QZ2A 2Q5AA 4HBOA 4MTVA 4LGXA 4WJXA 1NWUA 3O5IA 4P8VA 2KO7A 3KAGA 4DZ3A 3KAFA 5DO2A 3RM8A 2DT0A 4QZVB 2MLXA 4JFKA 4FAPA 1GPFA 1ZBVA 3KADA 1RD6A 2ZR4A 3PR9A 1N1AA 4LAWA 3IK8A 4W5UA 4JFMA 1HKIA 4N19A 3AS0A 3JYJA 1FKKA 2MLZA 2DT2A 3KACA 4DH0A 1J6YA 3O5DA 1P5QA 2DSVA 1HJXA 3O5LA 1FJDA 4QIBA 5GQBA 1LL6A 4C02B 1X6LA 3NRKA 4U84A 3NI6A 3PRAA 4DZ2A 3B9AA 2KGJA 1E15A 3UQIA 1EYMA 1C9HA 2AOSA 1WAWA 4W9OA 3ALFA 5DIVA 1ITXA 2RQSA 1F8AB 3VAWA 1E6NA 2O9OA 3B9EA 3PA7A 2B31A 4DRNA 1FKBA 2IUZA 5DITA 4TW8A 1EIBA 4J4OA 4JYSA 1GUVA 4QT2A 4P8UA 3IHZA 2QF8A 2IF4A 2KE0A 2ZQTA 2XP6A 2XP8A 4L72B 4WIWA 3TDBA 2DPEA 2F2DA 4QT3A 1IX5A 1H0GA 2LGOA 5J6EA 4ODKA 4ZPWR 1D7HA 3NTPA 2PPPA 1ZBKA 4DIPA 1ZB5A 5B8IC 1ZU8A 1KFWA 5BXJA 3WQVA 2F4EA 3ARZA 2ITKA 3CHFA 1HXVA 2MPHA 4KR0B 4DRHA 4WKAA 1W26A 2ZQVA 1M5YA 3ARRA 3O5QA 4P8XA 5HWBA 4JFLA 5HWCA 4DRJA 2KFWA 3O5RA 3UQBA 4DRPA 2RSEA 2A3BA 2A3EA 2RUCA 3IKDA 4MPKA 1E9LA 4MNKA 2PPNA 3CHEA 1YW5A 1W9PA 3O5KA 5HW8A 3WQWA 5HTGA 2DT1A 1PBKA 1ZK6A 2DSWA 1Q6HA 4MGVA 3JXVA 1A7XA 2YBUA 1HJWA 4XAKA 5HBFA 4LAVA 3AS3A 4TW7A 4O2TA 1X6NA 3B8SA 1W1PA 3UI6A 3O5PA 3CZ8A 1TCOC 2WM0A 4R5EA 3RM9A 4Z2GA 4Z2KA 1JNDA 4DRIA 4TNSA 1LG1A 1LJYA 2N87A 1OGGA 1JNEA 4MAVA 5JH8A 2XP5A 1PINA 4NZCA 2XP4A 5HUAA 1R9HA 2Y78A 4J4NA 1BL4A 1NWSA 3CHCA 2G8ZA 1FKHA 3WH0A 3KABA 3FY1A 3JYMA 3OA5A 5HT1A 3UI5A 1NWRA 2WLYA 4W9PA 4MNLA 1XHGA 2MLYA 2XPBA 5DIUA 3ARQA 1ROTA 3WD3A 2AWGA 5HW7A 2K8IA 5DEZA 2ZR5A 3CGNA 3ARVA 3ARYA 2FKEA 4LAYA 2FAPA 3KAHA 4U85A 1FKGA 4ZPVR 2A3CA 1FKJA 1LG2A 2L2SA 2LPVA 4Q7NA 2XP9A 3LUOA 4P8WA 1D2KA 3CH9A 4DROA 2RURA 1W1VA 2ZQSA 1LQ0A 1U79A 4AY1A 3O5GA 1D6OA 4Z2LA 1SR0A 4NNRA 3KCEA 4ODLA 4Z2HA 3WD1A 3H9RB 3O5OA 3KZ7A 2XPAA 2VCDA 4IT6A 1Q1CA 4JFJA 1SYTA 1WB0A 3MDYB 1JVWA 2DSZA 1NMWA 1NWTA 4MNMA 3QOKA 1HJVA 3EY6A 1W9VA 3FAPA 1J4IA 4BF8A 2WLZA 4DWSD 4IPXA 4MNJA 2ESCA 1ZBWA 1LL7A 1FKTA 4S3KA 3WD0A 5HKGA 3TC5A 4DRMA 2WK2A 3AS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKS A;  4DZ2 A;  1TCO C;  2KGJ A;  1L1P A;  3OOB A;  1T11 A;  3TCZ A;  2DG3 A;  3UQI A;  1EYM A;  1C9H A;  4TNS A;  4DRI A;  4W9O A;  4TYO A;  1JNT A;  5DIV A;  2RQS A;  1F8A B;  3CGM A;  2N87 A;  3VAW A;  3O5F A;  2PBC A;  4DRK A;  2OFN A;  3KAI A;  2M08 A;  2XP3 A;  2XP5 A;  5D75 A;  3GPK A;  3UI4 A;  1PIN A;  4TX0 A;  2XP4 A;  4FN2 A;  5HUA A;  2M2A A;  1R9H A;  2Y78 A;  4MSP A;  1Y0O A;  3PA7 A;  3UQA A;  4J4N A;  1BL4 A;  4DRN A;  1Q6U A;  1FKH A;  1FKB A;  3WH0 A;  4JFI A;  5DIT A;  1FD9 A;  4TW8 A;  4DT4 A;  3KAB A;  2D9F A;  3JYM A;  4ODM A;  1EQ3 A;  4J4O A;  4JYS A;  5HT1 A;  3UI5 A;  4W9P A;  4QT2 A;  4W9Q A;  3IHZ A;  2MLY A;  2XPB A;  5DIU A;  2F21 A;  2IF4 A;  2KI3 A;  1ROT A;  2KE0 A;  2ZQT A;  2XP6 A;  2AWG A;  2LKN A;  5HW7 A;  5J6E A;  1B6C A;  2K8I A;  2DG4 A;  2XP8 A;  3TDB A;  1J4H A;  3O5E A;  1FKF A;  2MNT A;  2RUQ A;  2F2D A;  2PV1 A;  2ZR6 A;  3IKG A;  2ZR5 A;  1J4R A;  3B7X A;  3CGN A;  1ZCN A;  2LJ4 A;  1FAP A;  2PPO A;  4QT3 A;  2KR7 A;  5GPG A;  4ODQ A;  2LGO A;  3I6C A;  2FKE A;  4LAY A;  4ODK A;  1D7H A;  2JZV A;  3NTP A;  3RGC A;  2FAP A;  4IQ2 A;  2PPP A;  2ZQU A;  3O5J A;  1NSG A;  1FKD A;  4TW6 A;  4DIP A;  5B8I C;  3KAH A;  4U85 A;  1FKG A;  4ODP A;  4ODO A;  3UF8 A;  4GGQ A;  4IQC A;  5BXJ A;  4DRQ A;  1FKJ A;  1ROU A;  2XP7 A;  4ODN A;  2L2S A;  2LPV A;  2F4E A;  4G2P A;  1BKF A;  2ITK A;  1HXV A;  3RFW A;  2XP9 A;  3LUO A;  3O5M A;  1Q6I A;  1FKL A;  1QPF A;  1QZ2 A;  2MPH A;  2Q5A A;  4DRH A;  2RUD A;  1W26 A;  4DRO A;  2RUR A;  2ZQS A;  2ZQV A;  2DG9 A;  5I98 A;  2UZ5 A;  1M5Y A;  3O5I A;  3O5Q A;  1U79 A;  2KO7 A;  3KAG A;  1D7J A;  4DZ3 A;  3KAF A;  4JFL A;  5HWB A;  5HWC A;  1QPL A;  2MF9 A;  4U86 A;  1KT1 A;  3O5G A;  3PRB A;  1D6O A;  1KT0 A;  2KFW A;  4DRJ A;  3O5R A;  4NNR A;  2MLX A;  4DRP A;  3UQB A;  4JFK A;  4FAP A;  2RSE A;  3KCE A;  4ODL A;  2RUC A;  3KAD A;  3IKD A;  4ODR A;  3PRD A;  1F40 A;  2ZR4 A;  3H9R B;  1N1A A;  3KZ7 A;  2PPN A;  2XPA A;  3IK8 A;  3O5O A;  4GIV A;  4LAW A;  1YAT A;  1YW5 A;  3O5K A;  2VCD A;  5HW8 A;  1Q1C A;  4JFJ A;  5HTG A;  2PV3 A;  3MDY B;  1JVW A;  1D7I A;  1PBK A;  2M1I A;  1FKI A;  1Q6H A;  1NMW A;  1ZK6 A;  4ITZ A;  4JFM A;  4N19 A;  1FKR A;  1JNS A;  4MGV A;  3EY6 A;  3JXV A;  3JYJ A;  1FKK A;  1A7X A;  1J4I A;  2MLZ A;  3FAP A;  4BF8 A;  3KAC A;  2PV2 A;  4DH0 A;  1J6Y A;  3O5D A;  4LAV A;  4TW7 A;  1P5Q A;  4IPX A;  4O2T A;  3O5L A;  2VN1 A;  1FJD A;  4QIB A;  1NMV A;  5HW6 A;  1FKT A;  4C02 B;  3UI6 A;  3TC5 A;  3O5P A;  4R0X A;  4DRM A;  3NRK A;  4LAX A;  4U84 A;  4G50 A;  3ODK A;  5HKG A;  3NI6 A; 
#chains in the Genus database with same CATH topology
 1FKS A;  3OOB A;  1TFV A;  3FXY A;  1HKK A;  1H0I A;  1JNT A;  3CGM A;  3RME A;  4DWS B;  3O5F A;  3KAI A;  1OGB A;  2YBT A;  4TX0 A;  4FN2 A;  4URI A;  2M2A A;  4MSP A;  3WIJ A;  3UQA A;  3WD2 A;  4Z2I A;  1FD9 A;  4WKH A;  4ZS6 A;  1EQ3 A;  3B9D A;  1W1T A;  2ETN A;  2G41 A;  2F21 A;  2KI3 A;  3ARW A;  1VF8 A;  2DG4 A;  3O5E A;  2O92 A;  1FKF A;  2MNT A;  3AS1 A;  3IKG A;  1J4R A;  1ZCN A;  2LJ4 A;  1FAP A;  2KR7 A;  4ODQ A;  3I6C A;  2FDM A;  3O5J A;  1FKD A;  1EHN A;  4S3J A;  4ODP A;  1K9T A;  4DRQ A;  1ROU A;  3RM4 A;  4IT4 A;  3RFW A;  2RUD A;  4Z2J A;  2DG9 A;  5I98 A;  2UZ5 A;  3WD4 A;  1D7J A;  1EDQ A;  3BXW A;  4NSB A;  1QPL A;  2MF9 A;  4U86 A;  1KT1 A;  3PRB A;  1KT0 A;  1E6R A;  4ODR A;  3PRD A;  1F40 A;  3WL1 A;  4DWS A;  3ARS A;  1WNO A;  4GIV A;  3W4R A;  1YAT A;  4ML4 A;  5GPR A;  3G6L A;  2PV3 A;  3G6M A;  1D7I A;  1FKI A;  2M1I A;  3ARP A;  1FKR A;  1JNS A;  4ITZ A;  2PV2 A;  1FFQ A;  1HKM A;  2F23 A;  2VN1 A;  1NMV A;  5HW6 A;  4R0X A;  1NH6 A;  4LAX A;  1E6P A;  4G50 A;  3ODK A;  1O6I A;  3WL0 A;  1L1P A;  4L3N A;  1ZBC A;  1OWQ A;  1GRJ A;  1T11 A;  3TCZ A;  2DG3 A;  4KQZ A;  4TYO A;  1FFR A;  3ARO A;  1UR8 A;  2PBC A;  4DRK A;  2OFN A;  2M08 A;  2XP3 A;  5D75 A;  2OLH A;  3GPK A;  3UI4 A;  3ART A;  1W9U A;  1Y0O A;  3ALG A;  3AQU A;  1CTN A;  1Q6U A;  4HBE A;  4DT4 A;  4JFI A;  2D9F A;  5DF0 A;  4ODM A;  4Q22 A;  4WKF A;  1XRV A;  4HAR A;  4W9Q A;  1UR9 A;  2LKN A;  1HKJ A;  3CHD A;  1B6C A;  4PTM A;  1J4H A;  1W1Y A;  1LL4 A;  4ZPT R;  2RUQ A;  1E6Z A;  2PI6 A;  2PV1 A;  2ZR6 A;  3ARU A;  3B7X A;  2PPO A;  2EUL A;  5GPG A;  3RGC A;  3WKZ A;  2DT3 A;  2JZV A;  4WK9 A;  4IQ2 A;  2A3A A;  2ZQU A;  4DWS C;  2DSU A;  1NSG A;  4TW6 A;  4ODO A;  3UF8 A;  4GGQ A;  4IQC A;  3ARX A;  1ZL1 A;  1GOI A;  2XP7 A;  4ODN A;  4G2P A;  1BKF A;  3O5M A;  1Q6I A;  1FKL A;  1QPF A;  1QZ2 A;  2Q5A A;  4HBO A;  4MTV A;  4LGX A;  4WJX A;  1NWU A;  3GTY X;  3O5I A;  4P8V A;  2KO7 A;  3KAG A;  4DZ3 A;  3KAF A;  5DO2 A;  3RM8 A;  2DT0 A;  4QZV B;  2MLX A;  4JFK A;  4FAP A;  1GPF A;  1ZBV A;  3KAD A;  1RD6 A;  2ZR4 A;  3PR9 A;  1N1A A;  4LAW A;  3IK8 A;  4W5U A;  4JFM A;  1HKI A;  4N19 A;  3AS0 A;  3JYJ A;  1FKK A;  2MLZ A;  2DT2 A;  3KAC A;  4DH0 A;  1J6Y A;  3O5D A;  1P5Q A;  2DSV A;  1HJX A;  3O5L A;  1FJD A;  4QIB A;  5GQB A;  1LL6 A;  4C02 B;  1X6L A;  3NRK A;  4U84 A;  3NI6 A;  3BMB A;  3PRA A;  4DZ2 A;  3B9A A;  2KGJ A;  1E15 A;  3UQI A;  1EYM A;  1C9H A;  2AOS A;  1WAW A;  4W9O A;  3ALF A;  5DIV A;  1ITX A;  2RQS A;  1F8A B;  3VAW A;  1E6N A;  2O9O A;  3B9E A;  3PA7 A;  2B31 A;  4DRN A;  1FKB A;  2IUZ A;  5DIT A;  4TW8 A;  1EIB A;  4J4O A;  4JYS A;  1GUV A;  4QT2 A;  4P8U A;  3IHZ A;  2QF8 A;  2IF4 A;  2KE0 A;  2ZQT A;  2XP6 A;  2XP8 A;  4L72 B;  4WIW A;  3TDB A;  2DPE A;  2F2D A;  4QT3 A;  1IX5 A;  1H0G A;  2LGO A;  5J6E A;  4ODK A;  4ZPW R;  1D7H A;  3NTP A;  2PPP A;  1ZBK A;  4DIP A;  1ZB5 A;  5B8I C;  1ZU8 A;  1KFW A;  5BXJ A;  1E44 A;  3WQV A;  2F4E A;  3ARZ A;  2ITK A;  3CHF A;  1HXV A;  2MPH A;  4KR0 B;  4DRH A;  4WKA A;  1W26 A;  2ZQV A;  1M5Y A;  3ARR A;  3O5Q A;  4P8X A;  5HWB A;  2PN0 A;  4JFL A;  5HWC A;  4DRJ A;  2KFW A;  3O5R A;  3UQB A;  4DRP A;  2RSE A;  2A3B A;  2A3E A;  2RUC A;  3IKD A;  4MPK A;  1E9L A;  4MNK A;  2PPN A;  3CHE A;  1YW5 A;  1W9P A;  3O5K A;  5HW8 A;  3WQW A;  5HTG A;  2DT1 A;  1PBK A;  1ZK6 A;  2DSW A;  1Q6H A;  4MGV A;  3JXV A;  1A7X A;  2YBU A;  1HJW A;  4XAK A;  5HBF A;  4LAV A;  3AS3 A;  4TW7 A;  4O2T A;  1X6N A;  3B8S A;  1W1P A;  3UI6 A;  3O5P A;  3CZ8 A;  1TCO C;  2WM0 A;  4R5E A;  3RM9 A;  4Z2G A;  4Z2K A;  1JND A;  4DRI A;  4TNS A;  1LG1 A;  1LJY A;  2N87 A;  1OGG A;  1JNE A;  4MAV A;  5JH8 A;  2XP5 A;  1PIN A;  4NZC A;  2XP4 A;  5HUA A;  1R9H A;  2Y78 A;  4J4N A;  1BL4 A;  2P4V A;  1NWS A;  3CHC A;  2G8Z A;  1FKH A;  3WH0 A;  3KAB A;  3FY1 A;  3JYM A;  3OA5 A;  5HT1 A;  3UI5 A;  1NWR A;  2WLY A;  4W9P A;  4MNL A;  1XHG A;  2MLY A;  2XPB A;  5DIU A;  3ARQ A;  1ROT A;  3EIP A;  3WD3 A;  2AWG A;  5HW7 A;  2K8I A;  5DEZ A;  2B5U B;  2ZR5 A;  3CGN A;  3ARV A;  3ARY A;  2FKE A;  4LAY A;  2FAP A;  3GU0 A;  3KAH A;  4UDM A;  4U85 A;  1FKG A;  4ZPV R;  2A3C A;  1FKJ A;  1LG2 A;  2L2S A;  2LPV A;  4Q7N A;  2XP9 A;  3LUO A;  4P8W A;  1D2K A;  3CH9 A;  4DRO A;  2RUR A;  1W1V A;  2ZQS A;  1LQ0 A;  1U79 A;  4AY1 A;  3O5G A;  1D6O A;  4Z2L A;  1SR0 A;  4NNR A;  3KCE A;  4ODL A;  4Z2H A;  3WD1 A;  3H9R B;  3O5O A;  3KZ7 A;  2XPA A;  2VCD A;  4IT6 A;  1Q1C A;  4JFJ A;  1SYT A;  1WB0 A;  3MDY B;  1JVW A;  2DSZ A;  1NMW A;  1NWT A;  4MNM A;  3QOK A;  1HJV A;  3EY6 A;  1W9V A;  3FAP A;  1J4I A;  1JCH B;  4BF8 A;  2WLZ A;  4DWS D;  4IPX A;  4MNJ A;  2ESC A;  1ZBW A;  1LL7 A;  1FKT A;  4S3K A;  3WD0 A;  5HKG A;  3TC5 A;  4DRM A;  2WK2 A;  3AS2 A; 
#chains in the Genus database with same CATH homology
 1FKS A;  3OOB A;  1TFV A;  3FXY A;  1HKK A;  1H0I A;  1JNT A;  3CGM A;  3RME A;  4DWS B;  3O5F A;  3KAI A;  1OGB A;  2YBT A;  4TX0 A;  4FN2 A;  4URI A;  2M2A A;  4MSP A;  3WIJ A;  3UQA A;  3WD2 A;  4Z2I A;  1FD9 A;  4WKH A;  4ZS6 A;  1EQ3 A;  3B9D A;  1W1T A;  2G41 A;  2F21 A;  2KI3 A;  3ARW A;  1VF8 A;  2DG4 A;  3O5E A;  2O92 A;  1FKF A;  2MNT A;  3AS1 A;  3IKG A;  1J4R A;  1ZCN A;  2LJ4 A;  1FAP A;  2KR7 A;  4ODQ A;  3I6C A;  2FDM A;  3O5J A;  1FKD A;  1EHN A;  4S3J A;  4ODP A;  1K9T A;  4DRQ A;  1ROU A;  3RM4 A;  4IT4 A;  3RFW A;  2RUD A;  4Z2J A;  2DG9 A;  5I98 A;  2UZ5 A;  3WD4 A;  1D7J A;  1EDQ A;  3BXW A;  4NSB A;  1QPL A;  2MF9 A;  4U86 A;  1KT1 A;  3PRB A;  1KT0 A;  1E6R A;  4ODR A;  3PRD A;  1F40 A;  3WL1 A;  4DWS A;  3ARS A;  1WNO A;  4GIV A;  3W4R A;  1YAT A;  4ML4 A;  5GPR A;  3G6L A;  2PV3 A;  3G6M A;  1D7I A;  1FKI A;  2M1I A;  3ARP A;  1FKR A;  1JNS A;  4ITZ A;  2PV2 A;  1FFQ A;  1HKM A;  2VN1 A;  1NMV A;  5HW6 A;  4R0X A;  1NH6 A;  4LAX A;  1E6P A;  4G50 A;  3ODK A;  1O6I A;  3WL0 A;  1L1P A;  4L3N A;  1ZBC A;  1OWQ A;  1T11 A;  3TCZ A;  2DG3 A;  4KQZ A;  4TYO A;  1FFR A;  3ARO A;  1UR8 A;  2PBC A;  4DRK A;  2OFN A;  2M08 A;  2XP3 A;  5D75 A;  2OLH A;  3GPK A;  3UI4 A;  3ART A;  1W9U A;  1Y0O A;  3ALG A;  3AQU A;  1CTN A;  1Q6U A;  4HBE A;  4DT4 A;  4JFI A;  2D9F A;  5DF0 A;  4ODM A;  4Q22 A;  4WKF A;  1XRV A;  4HAR A;  4W9Q A;  1UR9 A;  2LKN A;  1HKJ A;  3CHD A;  1B6C A;  4PTM A;  1J4H A;  1W1Y A;  1LL4 A;  4ZPT R;  2RUQ A;  1E6Z A;  2PI6 A;  2PV1 A;  2ZR6 A;  3ARU A;  3B7X A;  2PPO A;  5GPG A;  3RGC A;  3WKZ A;  2DT3 A;  2JZV A;  4WK9 A;  4IQ2 A;  2A3A A;  2ZQU A;  4DWS C;  2DSU A;  1NSG A;  4TW6 A;  4ODO A;  3UF8 A;  4GGQ A;  4IQC A;  3ARX A;  1ZL1 A;  1GOI A;  2XP7 A;  4ODN A;  4G2P A;  1BKF A;  3O5M A;  1Q6I A;  1FKL A;  1QPF A;  1QZ2 A;  2Q5A A;  4HBO A;  4MTV A;  4LGX A;  4WJX A;  1NWU A;  3O5I A;  4P8V A;  2KO7 A;  3KAG A;  4DZ3 A;  3KAF A;  5DO2 A;  3RM8 A;  2DT0 A;  4QZV B;  2MLX A;  4JFK A;  4FAP A;  1GPF A;  1ZBV A;  3KAD A;  1RD6 A;  2ZR4 A;  3PR9 A;  1N1A A;  4LAW A;  3IK8 A;  4W5U A;  4JFM A;  1HKI A;  4N19 A;  3AS0 A;  3JYJ A;  1FKK A;  2MLZ A;  2DT2 A;  3KAC A;  4DH0 A;  1J6Y A;  3O5D A;  1P5Q A;  2DSV A;  1HJX A;  3O5L A;  1FJD A;  4QIB A;  5GQB A;  1LL6 A;  4C02 B;  1X6L A;  3NRK A;  4U84 A;  3NI6 A;  3PRA A;  4DZ2 A;  3B9A A;  2KGJ A;  1E15 A;  3UQI A;  1EYM A;  1C9H A;  2AOS A;  1WAW A;  4W9O A;  3ALF A;  5DIV A;  1ITX A;  2RQS A;  1F8A B;  3VAW A;  1E6N A;  2O9O A;  3B9E A;  3PA7 A;  2B31 A;  4DRN A;  1FKB A;  2IUZ A;  5DIT A;  4TW8 A;  1EIB A;  4J4O A;  4JYS A;  1GUV A;  4QT2 A;  4P8U A;  3IHZ A;  2QF8 A;  2IF4 A;  2KE0 A;  2ZQT A;  2XP6 A;  2XP8 A;  4L72 B;  4WIW A;  3TDB A;  2DPE A;  2F2D A;  4QT3 A;  1IX5 A;  1H0G A;  2LGO A;  5J6E A;  4ODK A;  4ZPW R;  1D7H A;  3NTP A;  2PPP A;  1ZBK A;  4DIP A;  1ZB5 A;  5B8I C;  1ZU8 A;  1KFW A;  5BXJ A;  3WQV A;  2F4E A;  3ARZ A;  2ITK A;  3CHF A;  1HXV A;  2MPH A;  4KR0 B;  4DRH A;  4WKA A;  1W26 A;  2ZQV A;  1M5Y A;  3ARR A;  3O5Q A;  4P8X A;  5HWB A;  4JFL A;  5HWC A;  4DRJ A;  2KFW A;  3O5R A;  3UQB A;  4DRP A;  2RSE A;  2A3B A;  2A3E A;  2RUC A;  3IKD A;  4MPK A;  1E9L A;  4MNK A;  2PPN A;  3CHE A;  1YW5 A;  1W9P A;  3O5K A;  5HW8 A;  3WQW A;  5HTG A;  2DT1 A;  1PBK A;  1ZK6 A;  2DSW A;  1Q6H A;  4MGV A;  3JXV A;  1A7X A;  2YBU A;  1HJW A;  4XAK A;  5HBF A;  4LAV A;  3AS3 A;  4TW7 A;  4O2T A;  1X6N A;  3B8S A;  1W1P A;  3UI6 A;  3O5P A;  3CZ8 A;  1TCO C;  2WM0 A;  4R5E A;  3RM9 A;  4Z2G A;  4Z2K A;  1JND A;  4DRI A;  4TNS A;  1LG1 A;  1LJY A;  2N87 A;  1OGG A;  1JNE A;  4MAV A;  5JH8 A;  2XP5 A;  1PIN A;  4NZC A;  2XP4 A;  5HUA A;  1R9H A;  2Y78 A;  4J4N A;  1BL4 A;  1NWS A;  3CHC A;  2G8Z A;  1FKH A;  3WH0 A;  3KAB A;  3FY1 A;  3JYM A;  3OA5 A;  5HT1 A;  3UI5 A;  1NWR A;  2WLY A;  4W9P A;  4MNL A;  1XHG A;  2MLY A;  2XPB A;  5DIU A;  3ARQ A;  1ROT A;  3WD3 A;  2AWG A;  5HW7 A;  2K8I A;  5DEZ A;  2ZR5 A;  3CGN A;  3ARV A;  3ARY A;  2FKE A;  4LAY A;  2FAP A;  3KAH A;  4U85 A;  1FKG A;  4ZPV R;  2A3C A;  1FKJ A;  1LG2 A;  2L2S A;  2LPV A;  4Q7N A;  2XP9 A;  3LUO A;  4P8W A;  1D2K A;  3CH9 A;  4DRO A;  2RUR A;  1W1V A;  2ZQS A;  1LQ0 A;  1U79 A;  4AY1 A;  3O5G A;  1D6O A;  4Z2L A;  1SR0 A;  4NNR A;  3KCE A;  4ODL A;  4Z2H A;  3WD1 A;  3H9R B;  3O5O A;  3KZ7 A;  2XPA A;  2VCD A;  4IT6 A;  1Q1C A;  4JFJ A;  1SYT A;  1WB0 A;  3MDY B;  1JVW A;  2DSZ A;  1NMW A;  1NWT A;  4MNM A;  3QOK A;  1HJV A;  3EY6 A;  1W9V A;  3FAP A;  1J4I A;  4BF8 A;  2WLZ A;  4DWS D;  4IPX A;  4MNJ A;  2ESC A;  1ZBW A;  1LL7 A;  1FKT A;  4S3K A;  3WD0 A;  5HKG A;  3TC5 A;  4DRM A;  2WK2 A;  3AS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...