4ODPA

Structure of slyd delta-if from thermus thermophilus in complex with s2-w23a peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
101
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
total genus 23
structure length 101
sequence length 110
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odpA00
1J4IA 2KGJA 4GIVA 3GPKA 3B7XA 2MLZA 1Q1CA 2ZR5A 2ZQUA 4U84A 4N19A 2XP9A 4W9PA 2ZQSA 4JFMA 2MPHA 5HW6A 4FN2A 3UQBA 2FAPA 2L2SA 3WH0A 4ODRA 3KCEA 4GGQA 3UI4A 4DH0A 5GPGA 3KACA 3CGMA 4DROA 2LPVA 2ZR6A 3O5LA 4MSPA 4ODQA 4LAVA 3OOBA 4TYOA 2LJ4A 4W9QA 3KAIA 3IKGA 4JFJA 2KR7A 1YW5A 1ZCNA 2PV3A 2RQSA 2XPAA 2ZQTA 1EQ3A 1QPFA 1NMWA 1PBKA 2KE0A 4JYSA 5HUAA 2DG9A 1KT1A 3O5JA 1J6YA 2MLYA 1FKJA 2PPPA 2ZR4A 1FD9A 2RURA 3I6CA 3H9RB 3JXVA 4J4OA 1C9HA 2Q5AA 5HKGA 2M1IA 1T11A 2VCDA 2OFNA 2RUQA 1N1AA 3MDYB 4TW6A 4ODNA 3JYMA 3KAFA 4G50A 4LAWA 5DIVA 2N87A 2XP6A 1Q6HA 1FKRA 3O5KA 2KFWA 5J6EA 1ROTA 3RGCA 4TX0A 5DIUA 2LKNA 1U79A 5B8IC 4DIPA 2PPOA 2RUCA 3NTPA 3O5QA 1FKKA 1KT0A 3KABA 3O5EA 5HWBA 2M08A 4IQCA 3UQIA 3TCZA 3O5IA 2RSEA 4ODOA 1QPLA 2RUDA 4DRJA 2FKEA 3UI5A 3NI6A 1FJDA 1FKGA 3O5DA 1Y0OA 2UZ5A 2M2AA 4TW7A 4O2TA 4DRIA 2XP3A 4R0XA 4W9OA 4DRNA 4DT4A 3RFWA 2Y78A 3EY6A 4FAPA 1J4HA 2F4EA 1FKSA 4BF8A 1NMVA 1JVWA 1D7JA 5HTGA 4IPXA 4LAXA 5D75A 1D6OA 4U85A 3LUOA 4DRQA 2KI3A 2XP4A 1FAPA 3PA7A 4ODPA 1L1PA 1FKFA 1P5QA 1FKLA 3O5OA 3FAPA 3IHZA 4IQ2A 2ZQVA 3UI6A 5HT1A 2F2DA 3O5PA 4MGVA 1ROUA 1ZK6A 4DZ3A 1D7IA 5HW7A 1NSGA 1FKDA 4DRKA 5DITA 2K8IA 3IK8A 2ITKA 3ODKA 5HWCA 2MNTA 5I98A 2PPNA 4QT3A 2PV2A 5BXJA 3UQAA 1F40A 1Q6IA 3VAWA 4DRMA 2PV1A 1R9HA 1FKTA 2XP7A 1FKBA 2XP5A 3O5GA 2D9FA 3O5FA 4J4NA 1FKIA 3UF8A 4DRHA 1JNSA 1BKFA 1JNTA 3O5RA 1BL4A 3TC5A 2DG3A 4ITZA 1EYMA 1D7HA 2XP8A 4ODMA 2F21A 4JFLA 1HXVA 2DG4A 3KAHA 2MLXA 2VN1A 3KADA 1W26A 1QZ2A 4JFKA 1A7XA 4G2PA 4C02B 4JFIA 4LAYA 5HW8A 2KO7A 2LGOA 4QT2A 4ODKA 2AWGA 3KAGA 4QIBA 4TW8A 1TCOC 2JZVA 3KZ7A 1F8AB 2XPBA 3NRKA 4U86A 4ODLA 4DZ2A 1Q6UA 3O5MA 4NNRA 4DRPA 2IF4A 1YATA 1M5YA 3PRDA 1PINA 1FKHA 3PRBA 4TNSA 1B6CA 3TDBA 3CGNA 2MF9A 3IKDA 3JYJA 2PBCA 1J4RA
chains in the Genus database with same CATH superfamily
1HKJA 1HKMA 3GPKA 1WAWA 3AS1A 2ZQUA 4N19A 2XP9A 4W9PA 5HW6A 2FAPA 4DH0A 1H0IA 2ZR6A 4W9QA 3AROA 3IKGA 2RQSA 1ZCNA 1EQ3A 5DF0A 1QPFA 1NMWA 3WL0A 4DWSA 5HUAA 1KT1A 1SR0A 4ZPWR 2PPPA 2ZR4A 1C9HA 1ITXA 2VCDA 1N1AA 3RM9A 4ODNA 4G50A 4LAWA 5DIVA 3WQWA 1E6PA 3WL1A 1W1YA 2ETNA 4MTVA 5J6EA 1NWTA 1ROTA 2A3BA 1NWUA 4TX0A 5DIUA 1U79A 4DIPA 3NTPA 3O5QA 3O5EA 3ARQA 1KFWA 2O9OA 1LG2A 4WK9A 2RSEA 4Q7NA 1D2KA 2FKEA 1FJDA 3O5DA 1LG1A 3B9AA 3AQUA 1XRVA 4L3NA 1ZU8A 4S3JA 4FAPA 3ALFA 4BF8A 3ARTA 3B9EA 1ZL1A 5HTGA 1D6OA 1RD6A 3LUOA 4DRQA 1JNDA 2QF8A 4ODPA 1P5QA 3FAPA 3WKZA 2ZQVA 1CTNA 1ROUA 5I98A 5DITA 2K8IA 2YBTA 4P8WA 2MNTA 5BXJA 1X6LA 3VAWA 1GPFA 1FKTA 1NWRA 2XP7A 2XP5A 1UR8A 3RM4A 4Z2HA 1JNSA 1BKFA 2B31A 4ITZA 2XP8A 4JFLA 4KR0B 1W26A 1W9UA 1QZ2A 5HW8A 1FFQA 1TCOC 3KZ7A 3ARXA 4ODLA 4DZ2A 1Q6UA 4DRPA 1PINA 4ML4A 1FFRA 1ZBWA 3CGNA 4HBOA 3ARSA 2PBCA 1H0GA 4GIVA 2MLZA 2ZR5A 4U84A 2ZQSA 2IUZA 4P8UA 4ODRA 3KCEA 3UI4A 5GPRA 4DROA 3CGMA 1ZB5A 1EIBA 2LPVA 4ODQA 3OOBA 4TYOA 2KR7A 1YW5A 2ZQTA 3AS2A 3ARZA 4JYSA 2DSUA 4NZCA 3O5JA 1O6IA 3I6CA 2RURA 3JXVA 3H9RB 4J4OA 2Q5AA 2OFNA 3MDYB 1HKKA 3CHFA 1LL6A 2WM0A 2XP6A 4ZS6A 2KFWA 1SYTA 2PPOA 1FKKA 2A3AA 4Z2KA 4DWSC 1WNOA 1LL4A 1JCHB 3UQIA 5HWBA 4Z2GA 3WD3A 3TCZA 4DRJA 4IT6A 1FKGA 1LQ0A 1Y0OA 2UZ5A 2DPEA 1E6NA 4DRIA 2XP3A 3B8SA 5D75A 1JNEA 2KI3A 2XP4A 3G6MA 3PA7A 1OWQA 3IHZA 4L72B 4WKAA 1ZK6A 2YBUA 4IT4A 5HW7A 1NSGA 1FKDA 3IK8A 5HWCA 1W1TA 4DWSD 2PV2A 1NWSA 3O5GA 3FY1A 2D9FA 3WD4A 4DRHA 1FKIA 1JNTA 3O5RA 1E6ZA 1E9LA 1EYMA 3B9DA 2F21A 4KQZA 2DG4A 3KAHA 2VN1A 2G8ZA 4WIWA 3KADA 3CHDA 4G2PA 4LAYA 2KO7A 2LGOA 4TW8A 1W9VA 1HJWA 1M5YA 4WJXA 3PRDA 3PRBA 3TDBA 2MF9A 1W1PA 1J4RA 2KGJA 3B7XA 1Q1CA 2ESCA 4MNMA 4JFMA 2MPHA 2L2SA 3CZ8A 3WH0A 4LAVA 2LJ4A 3KAIA 4JFJA 1W1VA 1PBKA 2KE0A 2DG9A 1J6YA 4Q22A 3WIJA 1HJVA 1LJYA 2PI6A 5HKGA 2WLYA 2M1IA 4URIA 1ZBVA 2B5UB 1LL7A 3JYMA 4Z2JA 2O92A 3ARVA 1WB0A 2N87A 3CH9A 4ZPTR 3ARUA 3O5KA 3BMBA 4R5EA 3OA5A 3RGCA 4HARA 3ARYA 5JH8A 2RUCA 4HBEA 2DT0A 1KT0A 4MAVA 2M08A 4IQCA 3O5IA 4ODOA 3UI5A 3NI6A 2M2AA 4TW7A 4UDMA 3G6LA 4O2TA 4DRNA 4DT4A 2Y78A 3EY6A 2F4EA 1NMVA 1JVWA 4QZVB 1D7JA 3ARWA 1W9PA 3ARRA 2A3EA 3WD2A 1FKFA 4Z2LA 4IQ2A 4PTMA 3UI6A 5HT1A 2F2DA 3O5PA 4MGVA 1GOIA 3AS0A 4DZ3A 2WK2A 3ODKA 4QT3A 1Q6IA 2PV1A 1R9HA 1FKBA 3O5FA 1VF8A 4J4NA 3UF8A 1E15A 1BL4A 1D7HA 1E6RA 3AS3A 4ODMA 2MLXA 1NH6A 1XHGA 4ZPVR 3WQVA 4C02B 3KAGA 2EULA 2JZVA 2XPBA 3NRKA 4U86A 3O5MA 3CHEA 2IF4A 2DT3A 1B6CA 1EHNA 4S3KA 2P4VA 4DWSB 1J4IA 4W5UA 4NSBA 1HKIA 1ZBCA 4FN2A 4WKHA 3UQBA 1ZBKA 4GGQA 5GPGA 3KACA 4MPKA 2F23A 4P8XA 3O5LA 2AOSA 4MSPA 4WKFA 2PV3A 2XPAA 2DT2A 1X6NA 2OLHA 2MLYA 1FKJA 1FD9A 1T11A 2RUQA 4TW6A 3BXWA 3KAFA 3ARPA 1TFVA 2FDMA 1Q6HA 1OGBA 1FKRA 3RMEA 5GQBA 1OGGA 3W4RA 2LKNA 5B8IC 1GUVA 2DSZA 3CHCA 3KABA 1K9TA 4AY1A 1IX5A 1QPLA 2RUDA 4LGXA 3EIPA 4R0XA 4W9OA 3RFWA 1J4HA 4MNJA 1FKSA 3GU0A 4IPXA 4XAKA 4LAXA 3WD1A 4U85A 1FAPA 1L1PA 2PN0A 1FKLA 3O5OA 2DT1A 5DEZA 1D7IA 4Z2IA 5HBFA 4DRKA 2ITKA 3UQAA 2PPNA 1F40A 5DO2A 4MNKA 4DRMA 3PRAA 2DSWA 2DG3A 3TC5A 2DSVA 1HXVA 1HJXA 3FXYA 2G41A 2A3CA 2WLZA 4JFKA 1UR9A 1A7XA 4JFIA 4QT2A 4ODKA 2AWGA 1EDQA 4QIBA 1E44A 1F8AB 3PR9A 1GRJA 4NNRA 1YATA 3GTYX 3RM8A 3ALGA 3WD0A 1FKHA 4TNSA 3QOKA 3IKDA 3JYJA 4MNLA 4P8VA
chains in the Genus database with same CATH topology
1HKJA 1HKMA 3GPKA 1WAWA 3AS1A 2ZQUA 4N19A 2XP9A 4W9PA 5HW6A 2FAPA 4DH0A 1H0IA 2ZR6A 4W9QA 3AROA 3IKGA 2RQSA 1ZCNA 1EQ3A 5DF0A 1QPFA 1NMWA 3WL0A 4DWSA 5HUAA 1KT1A 1SR0A 4ZPWR 2PPPA 2ZR4A 1C9HA 1ITXA 2VCDA 1N1AA 3RM9A 4ODNA 4G50A 4LAWA 5DIVA 3WQWA 1E6PA 3WL1A 1W1YA 4MTVA 5J6EA 1NWTA 1ROTA 2A3BA 1NWUA 4TX0A 5DIUA 1U79A 4DIPA 3NTPA 3O5QA 3O5EA 3ARQA 1KFWA 2O9OA 1LG2A 4WK9A 2RSEA 4Q7NA 1D2KA 2FKEA 1FJDA 3O5DA 1LG1A 3B9AA 3AQUA 1XRVA 4L3NA 1ZU8A 4S3JA 4FAPA 3ALFA 4BF8A 3ARTA 3B9EA 1ZL1A 5HTGA 1D6OA 1RD6A 3LUOA 4DRQA 1JNDA 2QF8A 4ODPA 1P5QA 3FAPA 3WKZA 2ZQVA 1CTNA 1ROUA 5I98A 5DITA 2K8IA 2YBTA 4P8WA 2MNTA 5BXJA 1X6LA 3VAWA 1GPFA 1NWRA 1FKTA 2XP7A 2XP5A 1UR8A 3RM4A 4Z2HA 1JNSA 1BKFA 2B31A 4ITZA 2XP8A 4JFLA 4KR0B 1W26A 1W9UA 1QZ2A 5HW8A 1FFQA 1TCOC 3KZ7A 3ARXA 4ODLA 4DZ2A 1Q6UA 4DRPA 1PINA 4ML4A 1FFRA 1ZBWA 3CGNA 4HBOA 3ARSA 2PBCA 1H0GA 4GIVA 2MLZA 2ZR5A 4U84A 2ZQSA 2IUZA 4P8UA 4ODRA 3KCEA 3UI4A 5GPRA 4DROA 3CGMA 1ZB5A 1EIBA 2LPVA 4ODQA 3OOBA 4TYOA 2KR7A 1YW5A 2ZQTA 3AS2A 3ARZA 4JYSA 2DSUA 4NZCA 3O5JA 1O6IA 3I6CA 2RURA 3JXVA 3H9RB 4J4OA 2Q5AA 2OFNA 3MDYB 1HKKA 3CHFA 1LL6A 2WM0A 2XP6A 4ZS6A 2KFWA 1SYTA 2PPOA 1FKKA 2A3AA 4Z2KA 4DWSC 1WNOA 1LL4A 5HWBA 3UQIA 4Z2GA 3WD3A 3TCZA 4DRJA 4IT6A 1FKGA 1LQ0A 1Y0OA 2UZ5A 2DPEA 1E6NA 4DRIA 2XP3A 3B8SA 5D75A 1JNEA 2KI3A 2XP4A 3G6MA 3PA7A 1OWQA 3IHZA 4L72B 4WKAA 1ZK6A 2YBUA 4IT4A 5HW7A 1NSGA 1FKDA 3IK8A 5HWCA 1W1TA 4DWSD 2PV2A 1NWSA 3O5GA 3FY1A 2D9FA 3WD4A 4DRHA 1FKIA 1JNTA 3O5RA 1E6ZA 1E9LA 1EYMA 3B9DA 2F21A 4KQZA 2DG4A 3KAHA 2VN1A 2G8ZA 4WIWA 3KADA 3CHDA 4G2PA 4LAYA 2KO7A 2LGOA 4TW8A 1W9VA 1HJWA 1M5YA 4WJXA 3PRDA 3PRBA 3TDBA 2MF9A 1W1PA 1J4RA 2KGJA 3B7XA 1Q1CA 2ESCA 4MNMA 4JFMA 2MPHA 2L2SA 3CZ8A 3WH0A 4LAVA 2LJ4A 3KAIA 4JFJA 1W1VA 1PBKA 2KE0A 2DG9A 1J6YA 4Q22A 3WIJA 1HJVA 1LJYA 2PI6A 5HKGA 2WLYA 2M1IA 4URIA 1ZBVA 1LL7A 3JYMA 4Z2JA 2O92A 3ARVA 1WB0A 2N87A 3CH9A 4ZPTR 3ARUA 3O5KA 4R5EA 3OA5A 3RGCA 4HARA 3ARYA 5JH8A 2RUCA 4HBEA 2DT0A 1KT0A 4MAVA 2M08A 4IQCA 3O5IA 4ODOA 3UI5A 3NI6A 2M2AA 4TW7A 3G6LA 4O2TA 4DRNA 4DT4A 2Y78A 3EY6A 2F4EA 1NMVA 1JVWA 4QZVB 1D7JA 3ARWA 1W9PA 3ARRA 2A3EA 3WD2A 1FKFA 4Z2LA 4IQ2A 4PTMA 3UI6A 5HT1A 2F2DA 3O5PA 4MGVA 1GOIA 3AS0A 4DZ3A 2WK2A 3ODKA 4QT3A 1Q6IA 2PV1A 1R9HA 1FKBA 3O5FA 1VF8A 4J4NA 3UF8A 1E15A 1BL4A 1D7HA 1E6RA 3AS3A 4ODMA 2MLXA 1NH6A 1XHGA 4ZPVR 3WQVA 4C02B 3KAGA 2JZVA 2XPBA 3NRKA 4U86A 3O5MA 3CHEA 2IF4A 2DT3A 1B6CA 1EHNA 4S3KA 4DWSB 1J4IA 4W5UA 4NSBA 1HKIA 1ZBCA 4FN2A 4WKHA 3UQBA 1ZBKA 4GGQA 5GPGA 3KACA 4MPKA 4P8XA 3O5LA 2AOSA 4MSPA 4WKFA 2PV3A 2XPAA 2DT2A 1X6NA 2OLHA 2MLYA 1FKJA 1FD9A 1T11A 2RUQA 4TW6A 3BXWA 3KAFA 3ARPA 1TFVA 2FDMA 1Q6HA 1OGBA 1FKRA 3RMEA 5GQBA 1OGGA 3W4RA 2LKNA 5B8IC 1GUVA 2DSZA 3CHCA 3KABA 1K9TA 4AY1A 1IX5A 1QPLA 2RUDA 4LGXA 4R0XA 4W9OA 3RFWA 1J4HA 4MNJA 1FKSA 4IPXA 4XAKA 4LAXA 3WD1A 4U85A 1FAPA 1L1PA 1FKLA 3O5OA 2DT1A 5DEZA 1D7IA 4Z2IA 5HBFA 4DRKA 2ITKA 3UQAA 2PPNA 1F40A 5DO2A 4MNKA 4DRMA 3PRAA 2DSWA 2DG3A 3TC5A 2DSVA 1HXVA 1HJXA 3FXYA 2G41A 2A3CA 2WLZA 4JFKA 1UR9A 1A7XA 4JFIA 4QT2A 4ODKA 2AWGA 1EDQA 4QIBA 1F8AB 3PR9A 4NNRA 1YATA 3RM8A 3ALGA 3WD0A 1FKHA 4TNSA 3QOKA 3IKDA 3JYJA 4MNLA 4P8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J4I A;  2KGJ A;  4GIV A;  3GPK A;  3B7X A;  2MLZ A;  1Q1C A;  2ZR5 A;  2ZQU A;  4U84 A;  4N19 A;  2XP9 A;  4W9P A;  2ZQS A;  4JFM A;  2MPH A;  5HW6 A;  4FN2 A;  3UQB A;  2FAP A;  2L2S A;  3WH0 A;  4ODR A;  3KCE A;  4GGQ A;  3UI4 A;  4DH0 A;  5GPG A;  3KAC A;  3CGM A;  4DRO A;  2LPV A;  2ZR6 A;  3O5L A;  4MSP A;  4ODQ A;  4LAV A;  3OOB A;  4TYO A;  2LJ4 A;  4W9Q A;  3KAI A;  3IKG A;  4JFJ A;  2KR7 A;  1YW5 A;  1ZCN A;  2PV3 A;  2RQS A;  2XPA A;  2ZQT A;  1EQ3 A;  1QPF A;  1NMW A;  1PBK A;  2KE0 A;  4JYS A;  5HUA A;  2DG9 A;  1KT1 A;  3O5J A;  1J6Y A;  2MLY A;  1FKJ A;  2PPP A;  2ZR4 A;  1FD9 A;  2RUR A;  3I6C A;  3H9R B;  3JXV A;  4J4O A;  1C9H A;  2Q5A A;  5HKG A;  2M1I A;  1T11 A;  2VCD A;  2OFN A;  2RUQ A;  1N1A A;  3MDY B;  4TW6 A;  4ODN A;  3JYM A;  3KAF A;  4G50 A;  4LAW A;  5DIV A;  2N87 A;  2XP6 A;  1Q6H A;  1FKR A;  3O5K A;  2KFW A;  5J6E A;  1ROT A;  3RGC A;  4TX0 A;  5DIU A;  2LKN A;  1U79 A;  5B8I C;  4DIP A;  2PPO A;  2RUC A;  3NTP A;  3O5Q A;  1FKK A;  1KT0 A;  3KAB A;  3O5E A;  5HWB A;  2M08 A;  4IQC A;  3UQI A;  3TCZ A;  3O5I A;  2RSE A;  4ODO A;  1QPL A;  2RUD A;  4DRJ A;  2FKE A;  3UI5 A;  3NI6 A;  1FJD A;  1FKG A;  3O5D A;  1Y0O A;  2UZ5 A;  2M2A A;  4TW7 A;  4O2T A;  4DRI A;  2XP3 A;  4R0X A;  4W9O A;  4DRN A;  4DT4 A;  3RFW A;  2Y78 A;  3EY6 A;  4FAP A;  1J4H A;  2F4E A;  1FKS A;  4BF8 A;  1NMV A;  1JVW A;  1D7J A;  5HTG A;  4IPX A;  4LAX A;  5D75 A;  1D6O A;  4U85 A;  3LUO A;  4DRQ A;  2KI3 A;  2XP4 A;  1FAP A;  3PA7 A;  4ODP A;  1L1P A;  1FKF A;  1P5Q A;  1FKL A;  3O5O A;  3FAP A;  3IHZ A;  4IQ2 A;  2ZQV A;  3UI6 A;  5HT1 A;  2F2D A;  3O5P A;  4MGV A;  1ROU A;  1ZK6 A;  4DZ3 A;  1D7I A;  5HW7 A;  1NSG A;  1FKD A;  4DRK A;  5DIT A;  2K8I A;  3IK8 A;  2ITK A;  3ODK A;  5HWC A;  2MNT A;  5I98 A;  2PPN A;  4QT3 A;  2PV2 A;  5BXJ A;  3UQA A;  1F40 A;  1Q6I A;  3VAW A;  4DRM A;  2PV1 A;  1R9H A;  1FKT A;  2XP7 A;  1FKB A;  2XP5 A;  3O5G A;  2D9F A;  3O5F A;  4J4N A;  1FKI A;  3UF8 A;  4DRH A;  1JNS A;  1BKF A;  1JNT A;  3O5R A;  1BL4 A;  3TC5 A;  2DG3 A;  4ITZ A;  1EYM A;  1D7H A;  2XP8 A;  4ODM A;  2F21 A;  4JFL A;  1HXV A;  2DG4 A;  3KAH A;  2MLX A;  2VN1 A;  3KAD A;  1W26 A;  1QZ2 A;  4JFK A;  1A7X A;  4G2P A;  4C02 B;  4JFI A;  4LAY A;  5HW8 A;  2KO7 A;  2LGO A;  4QT2 A;  4ODK A;  2AWG A;  3KAG A;  4QIB A;  4TW8 A;  1TCO C;  2JZV A;  3KZ7 A;  1F8A B;  2XPB A;  3NRK A;  4U86 A;  4ODL A;  4DZ2 A;  1Q6U A;  3O5M A;  4NNR A;  4DRP A;  2IF4 A;  1YAT A;  1M5Y A;  3PRD A;  1PIN A;  1FKH A;  3PRB A;  4TNS A;  1B6C A;  3TDB A;  3CGN A;  2MF9 A;  3IKD A;  3JYJ A;  2PBC A;  1J4R A; 
#chains in the Genus database with same CATH topology
 1HKJ A;  1HKM A;  3GPK A;  1WAW A;  3AS1 A;  2ZQU A;  4N19 A;  2XP9 A;  4W9P A;  5HW6 A;  2FAP A;  4DH0 A;  1H0I A;  2ZR6 A;  4W9Q A;  3ARO A;  3IKG A;  2RQS A;  1ZCN A;  1EQ3 A;  5DF0 A;  1QPF A;  1NMW A;  3WL0 A;  4DWS A;  5HUA A;  1KT1 A;  1SR0 A;  4ZPW R;  2PPP A;  2ZR4 A;  1C9H A;  1ITX A;  2VCD A;  1N1A A;  3RM9 A;  4ODN A;  4G50 A;  4LAW A;  5DIV A;  3WQW A;  1E6P A;  3WL1 A;  1W1Y A;  2ETN A;  4MTV A;  5J6E A;  1NWT A;  1ROT A;  2A3B A;  1NWU A;  4TX0 A;  5DIU A;  1U79 A;  4DIP A;  3NTP A;  3O5Q A;  3O5E A;  3ARQ A;  1KFW A;  2O9O A;  1LG2 A;  4WK9 A;  2RSE A;  4Q7N A;  1D2K A;  2FKE A;  1FJD A;  3O5D A;  1LG1 A;  3B9A A;  3AQU A;  1XRV A;  4L3N A;  1ZU8 A;  4S3J A;  4FAP A;  3ALF A;  4BF8 A;  3ART A;  3B9E A;  1ZL1 A;  5HTG A;  1D6O A;  1RD6 A;  3LUO A;  4DRQ A;  1JND A;  2QF8 A;  4ODP A;  1P5Q A;  3FAP A;  3WKZ A;  2ZQV A;  1CTN A;  1ROU A;  5I98 A;  5DIT A;  2K8I A;  2YBT A;  4P8W A;  2MNT A;  5BXJ A;  1X6L A;  3VAW A;  1GPF A;  1FKT A;  1NWR A;  2XP7 A;  2XP5 A;  1UR8 A;  3RM4 A;  4Z2H A;  1JNS A;  1BKF A;  2B31 A;  4ITZ A;  2XP8 A;  4JFL A;  4KR0 B;  1W26 A;  1W9U A;  1QZ2 A;  5HW8 A;  1FFQ A;  1TCO C;  3KZ7 A;  3ARX A;  4ODL A;  4DZ2 A;  1Q6U A;  4DRP A;  1PIN A;  4ML4 A;  1FFR A;  1ZBW A;  3CGN A;  4HBO A;  3ARS A;  2PBC A;  1H0G A;  4GIV A;  2MLZ A;  2ZR5 A;  4U84 A;  2ZQS A;  2IUZ A;  4P8U A;  4ODR A;  3KCE A;  3UI4 A;  5GPR A;  4DRO A;  3CGM A;  1ZB5 A;  1EIB A;  2LPV A;  4ODQ A;  3OOB A;  4TYO A;  2KR7 A;  1YW5 A;  2ZQT A;  3AS2 A;  3ARZ A;  4JYS A;  2DSU A;  4NZC A;  3O5J A;  1O6I A;  3I6C A;  2RUR A;  3JXV A;  3H9R B;  4J4O A;  2Q5A A;  2OFN A;  3MDY B;  1HKK A;  3CHF A;  1LL6 A;  2WM0 A;  2XP6 A;  4ZS6 A;  2KFW A;  1SYT A;  2PPO A;  1FKK A;  2A3A A;  4Z2K A;  4DWS C;  1WNO A;  1LL4 A;  1JCH B;  3UQI A;  5HWB A;  4Z2G A;  3WD3 A;  3TCZ A;  4DRJ A;  4IT6 A;  1FKG A;  1LQ0 A;  1Y0O A;  2UZ5 A;  2DPE A;  1E6N A;  4DRI A;  2XP3 A;  3B8S A;  5D75 A;  1JNE A;  2KI3 A;  2XP4 A;  3G6M A;  3PA7 A;  1OWQ A;  3IHZ A;  4L72 B;  4WKA A;  1ZK6 A;  2YBU A;  4IT4 A;  5HW7 A;  1NSG A;  1FKD A;  3IK8 A;  5HWC A;  1W1T A;  4DWS D;  2PV2 A;  1NWS A;  3O5G A;  3FY1 A;  2D9F A;  3WD4 A;  4DRH A;  1FKI A;  1JNT A;  3O5R A;  1E6Z A;  1E9L A;  1EYM A;  3B9D A;  2F21 A;  4KQZ A;  2DG4 A;  3KAH A;  2VN1 A;  2G8Z A;  4WIW A;  3KAD A;  3CHD A;  4G2P A;  4LAY A;  2KO7 A;  2LGO A;  4TW8 A;  1W9V A;  1HJW A;  1M5Y A;  4WJX A;  3PRD A;  3PRB A;  3TDB A;  2MF9 A;  1W1P A;  1J4R A;  2KGJ A;  3B7X A;  1Q1C A;  2ESC A;  4MNM A;  4JFM A;  2MPH A;  2L2S A;  3CZ8 A;  3WH0 A;  4LAV A;  2LJ4 A;  3KAI A;  4JFJ A;  1W1V A;  1PBK A;  2KE0 A;  2DG9 A;  1J6Y A;  4Q22 A;  3WIJ A;  1HJV A;  1LJY A;  2PI6 A;  5HKG A;  2WLY A;  2M1I A;  4URI A;  1ZBV A;  2B5U B;  1LL7 A;  3JYM A;  4Z2J A;  2O92 A;  3ARV A;  1WB0 A;  2N87 A;  3CH9 A;  4ZPT R;  3ARU A;  3O5K A;  3BMB A;  4R5E A;  3OA5 A;  3RGC A;  4HAR A;  3ARY A;  5JH8 A;  2RUC A;  4HBE A;  2DT0 A;  1KT0 A;  4MAV A;  2M08 A;  4IQC A;  3O5I A;  4ODO A;  3UI5 A;  3NI6 A;  2M2A A;  4TW7 A;  4UDM A;  3G6L A;  4O2T A;  4DRN A;  4DT4 A;  2Y78 A;  3EY6 A;  2F4E A;  1NMV A;  1JVW A;  4QZV B;  1D7J A;  3ARW A;  1W9P A;  3ARR A;  2A3E A;  3WD2 A;  1FKF A;  4Z2L A;  4IQ2 A;  4PTM A;  3UI6 A;  5HT1 A;  2F2D A;  3O5P A;  4MGV A;  1GOI A;  3AS0 A;  4DZ3 A;  2WK2 A;  3ODK A;  4QT3 A;  1Q6I A;  2PV1 A;  1R9H A;  1FKB A;  3O5F A;  1VF8 A;  4J4N A;  3UF8 A;  1E15 A;  1BL4 A;  1D7H A;  1E6R A;  3AS3 A;  4ODM A;  2MLX A;  1NH6 A;  1XHG A;  4ZPV R;  3WQV A;  4C02 B;  3KAG A;  2EUL A;  2JZV A;  2XPB A;  3NRK A;  4U86 A;  3O5M A;  3CHE A;  2IF4 A;  2DT3 A;  1B6C A;  1EHN A;  4S3K A;  2P4V A;  4DWS B;  1J4I A;  4W5U A;  4NSB A;  1HKI A;  1ZBC A;  4FN2 A;  4WKH A;  3UQB A;  1ZBK A;  4GGQ A;  5GPG A;  3KAC A;  4MPK A;  2F23 A;  4P8X A;  3O5L A;  2AOS A;  4MSP A;  4WKF A;  2PV3 A;  2XPA A;  2DT2 A;  1X6N A;  2OLH A;  2MLY A;  1FKJ A;  1FD9 A;  1T11 A;  2RUQ A;  4TW6 A;  3BXW A;  3KAF A;  3ARP A;  1TFV A;  2FDM A;  1Q6H A;  1OGB A;  1FKR A;  3RME A;  5GQB A;  1OGG A;  3W4R A;  2LKN A;  5B8I C;  1GUV A;  2DSZ A;  3CHC A;  3KAB A;  1K9T A;  4AY1 A;  1IX5 A;  1QPL A;  2RUD A;  4LGX A;  3EIP A;  4R0X A;  4W9O A;  3RFW A;  1J4H A;  4MNJ A;  1FKS A;  3GU0 A;  4IPX A;  4XAK A;  4LAX A;  3WD1 A;  4U85 A;  1FAP A;  1L1P A;  2PN0 A;  1FKL A;  3O5O A;  2DT1 A;  5DEZ A;  1D7I A;  4Z2I A;  5HBF A;  4DRK A;  2ITK A;  3UQA A;  2PPN A;  1F40 A;  5DO2 A;  4MNK A;  4DRM A;  3PRA A;  2DSW A;  2DG3 A;  3TC5 A;  2DSV A;  1HXV A;  1HJX A;  3FXY A;  2G41 A;  2A3C A;  2WLZ A;  4JFK A;  1UR9 A;  1A7X A;  4JFI A;  4QT2 A;  4ODK A;  2AWG A;  1EDQ A;  4QIB A;  1E44 A;  1F8A B;  3PR9 A;  1GRJ A;  4NNR A;  1YAT A;  3GTY X;  3RM8 A;  3ALG A;  3WD0 A;  1FKH A;  4TNS A;  3QOK A;  3IKD A;  3JYJ A;  4MNL A;  4P8V A; 
#chains in the Genus database with same CATH homology
 1HKJ A;  1HKM A;  3GPK A;  1WAW A;  3AS1 A;  2ZQU A;  4N19 A;  2XP9 A;  4W9P A;  5HW6 A;  2FAP A;  4DH0 A;  1H0I A;  2ZR6 A;  4W9Q A;  3ARO A;  3IKG A;  2RQS A;  1ZCN A;  1EQ3 A;  5DF0 A;  1QPF A;  1NMW A;  3WL0 A;  4DWS A;  5HUA A;  1KT1 A;  1SR0 A;  4ZPW R;  2PPP A;  2ZR4 A;  1C9H A;  1ITX A;  2VCD A;  1N1A A;  3RM9 A;  4ODN A;  4G50 A;  4LAW A;  5DIV A;  3WQW A;  1E6P A;  3WL1 A;  1W1Y A;  4MTV A;  5J6E A;  1NWT A;  1ROT A;  2A3B A;  1NWU A;  4TX0 A;  5DIU A;  1U79 A;  4DIP A;  3NTP A;  3O5Q A;  3O5E A;  3ARQ A;  1KFW A;  2O9O A;  1LG2 A;  4WK9 A;  2RSE A;  4Q7N A;  1D2K A;  2FKE A;  1FJD A;  3O5D A;  1LG1 A;  3B9A A;  3AQU A;  1XRV A;  4L3N A;  1ZU8 A;  4S3J A;  4FAP A;  3ALF A;  4BF8 A;  3ART A;  3B9E A;  1ZL1 A;  5HTG A;  1D6O A;  1RD6 A;  3LUO A;  4DRQ A;  1JND A;  2QF8 A;  4ODP A;  1P5Q A;  3FAP A;  3WKZ A;  2ZQV A;  1CTN A;  1ROU A;  5I98 A;  5DIT A;  2K8I A;  2YBT A;  4P8W A;  2MNT A;  5BXJ A;  1X6L A;  3VAW A;  1GPF A;  1NWR A;  1FKT A;  2XP7 A;  2XP5 A;  1UR8 A;  3RM4 A;  4Z2H A;  1JNS A;  1BKF A;  2B31 A;  4ITZ A;  2XP8 A;  4JFL A;  4KR0 B;  1W26 A;  1W9U A;  1QZ2 A;  5HW8 A;  1FFQ A;  1TCO C;  3KZ7 A;  3ARX A;  4ODL A;  4DZ2 A;  1Q6U A;  4DRP A;  1PIN A;  4ML4 A;  1FFR A;  1ZBW A;  3CGN A;  4HBO A;  3ARS A;  2PBC A;  1H0G A;  4GIV A;  2MLZ A;  2ZR5 A;  4U84 A;  2ZQS A;  2IUZ A;  4P8U A;  4ODR A;  3KCE A;  3UI4 A;  5GPR A;  4DRO A;  3CGM A;  1ZB5 A;  1EIB A;  2LPV A;  4ODQ A;  3OOB A;  4TYO A;  2KR7 A;  1YW5 A;  2ZQT A;  3AS2 A;  3ARZ A;  4JYS A;  2DSU A;  4NZC A;  3O5J A;  1O6I A;  3I6C A;  2RUR A;  3JXV A;  3H9R B;  4J4O A;  2Q5A A;  2OFN A;  3MDY B;  1HKK A;  3CHF A;  1LL6 A;  2WM0 A;  2XP6 A;  4ZS6 A;  2KFW A;  1SYT A;  2PPO A;  1FKK A;  2A3A A;  4Z2K A;  4DWS C;  1WNO A;  1LL4 A;  5HWB A;  3UQI A;  4Z2G A;  3WD3 A;  3TCZ A;  4DRJ A;  4IT6 A;  1FKG A;  1LQ0 A;  1Y0O A;  2UZ5 A;  2DPE A;  1E6N A;  4DRI A;  2XP3 A;  3B8S A;  5D75 A;  1JNE A;  2KI3 A;  2XP4 A;  3G6M A;  3PA7 A;  1OWQ A;  3IHZ A;  4L72 B;  4WKA A;  1ZK6 A;  2YBU A;  4IT4 A;  5HW7 A;  1NSG A;  1FKD A;  3IK8 A;  5HWC A;  1W1T A;  4DWS D;  2PV2 A;  1NWS A;  3O5G A;  3FY1 A;  2D9F A;  3WD4 A;  4DRH A;  1FKI A;  1JNT A;  3O5R A;  1E6Z A;  1E9L A;  1EYM A;  3B9D A;  2F21 A;  4KQZ A;  2DG4 A;  3KAH A;  2VN1 A;  2G8Z A;  4WIW A;  3KAD A;  3CHD A;  4G2P A;  4LAY A;  2KO7 A;  2LGO A;  4TW8 A;  1W9V A;  1HJW A;  1M5Y A;  4WJX A;  3PRD A;  3PRB A;  3TDB A;  2MF9 A;  1W1P A;  1J4R A;  2KGJ A;  3B7X A;  1Q1C A;  2ESC A;  4MNM A;  4JFM A;  2MPH A;  2L2S A;  3CZ8 A;  3WH0 A;  4LAV A;  2LJ4 A;  3KAI A;  4JFJ A;  1W1V A;  1PBK A;  2KE0 A;  2DG9 A;  1J6Y A;  4Q22 A;  3WIJ A;  1HJV A;  1LJY A;  2PI6 A;  5HKG A;  2WLY A;  2M1I A;  4URI A;  1ZBV A;  1LL7 A;  3JYM A;  4Z2J A;  2O92 A;  3ARV A;  1WB0 A;  2N87 A;  3CH9 A;  4ZPT R;  3ARU A;  3O5K A;  4R5E A;  3OA5 A;  3RGC A;  4HAR A;  3ARY A;  5JH8 A;  2RUC A;  4HBE A;  2DT0 A;  1KT0 A;  4MAV A;  2M08 A;  4IQC A;  3O5I A;  4ODO A;  3UI5 A;  3NI6 A;  2M2A A;  4TW7 A;  3G6L A;  4O2T A;  4DRN A;  4DT4 A;  2Y78 A;  3EY6 A;  2F4E A;  1NMV A;  1JVW A;  4QZV B;  1D7J A;  3ARW A;  1W9P A;  3ARR A;  2A3E A;  3WD2 A;  1FKF A;  4Z2L A;  4IQ2 A;  4PTM A;  3UI6 A;  5HT1 A;  2F2D A;  3O5P A;  4MGV A;  1GOI A;  3AS0 A;  4DZ3 A;  2WK2 A;  3ODK A;  4QT3 A;  1Q6I A;  2PV1 A;  1R9H A;  1FKB A;  3O5F A;  1VF8 A;  4J4N A;  3UF8 A;  1E15 A;  1BL4 A;  1D7H A;  1E6R A;  3AS3 A;  4ODM A;  2MLX A;  1NH6 A;  1XHG A;  4ZPV R;  3WQV A;  4C02 B;  3KAG A;  2JZV A;  2XPB A;  3NRK A;  4U86 A;  3O5M A;  3CHE A;  2IF4 A;  2DT3 A;  1B6C A;  1EHN A;  4S3K A;  4DWS B;  1J4I A;  4W5U A;  4NSB A;  1HKI A;  1ZBC A;  4FN2 A;  4WKH A;  3UQB A;  1ZBK A;  4GGQ A;  5GPG A;  3KAC A;  4MPK A;  4P8X A;  3O5L A;  2AOS A;  4MSP A;  4WKF A;  2PV3 A;  2XPA A;  2DT2 A;  1X6N A;  2OLH A;  2MLY A;  1FKJ A;  1FD9 A;  1T11 A;  2RUQ A;  4TW6 A;  3BXW A;  3KAF A;  3ARP A;  1TFV A;  2FDM A;  1Q6H A;  1OGB A;  1FKR A;  3RME A;  5GQB A;  1OGG A;  3W4R A;  2LKN A;  5B8I C;  1GUV A;  2DSZ A;  3CHC A;  3KAB A;  1K9T A;  4AY1 A;  1IX5 A;  1QPL A;  2RUD A;  4LGX A;  4R0X A;  4W9O A;  3RFW A;  1J4H A;  4MNJ A;  1FKS A;  4IPX A;  4XAK A;  4LAX A;  3WD1 A;  4U85 A;  1FAP A;  1L1P A;  1FKL A;  3O5O A;  2DT1 A;  5DEZ A;  1D7I A;  4Z2I A;  5HBF A;  4DRK A;  2ITK A;  3UQA A;  2PPN A;  1F40 A;  5DO2 A;  4MNK A;  4DRM A;  3PRA A;  2DSW A;  2DG3 A;  3TC5 A;  2DSV A;  1HXV A;  1HJX A;  3FXY A;  2G41 A;  2A3C A;  2WLZ A;  4JFK A;  1UR9 A;  1A7X A;  4JFI A;  4QT2 A;  4ODK A;  2AWG A;  1EDQ A;  4QIB A;  1F8A B;  3PR9 A;  4NNR A;  1YAT A;  3RM8 A;  3ALG A;  3WD0 A;  1FKH A;  4TNS A;  3QOK A;  3IKD A;  3JYJ A;  4MNL A;  4P8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...