4ODPA

Structure of slyd delta-if from thermus thermophilus in complex with s2-w23a peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
101
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
total genus 23
structure length 101
sequence length 110
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odpA00
1U79A 4DRQA 3TDBA 3O5KA 2XP3A 2LGOA 2KFWA 3KCEA 4IQ2A 5DITA 1FKJA 4JYSA 1HXVA 3VAWA 1FKLA 2RUQA 4LAWA 2ZQVA 1J6YA 3CGNA 1D7JA 4QT3A 1QPFA 3CGMA 4MGVA 4R0XA 2MNTA 2F21A 3NTPA 3UQIA 3UQAA 3O5LA 2ZR5A 3PRDA 4TW7A 2PPPA 2VCDA 3KACA 3KAGA 2K8IA 3O5JA 4J4OA 1FKDA 1PBKA 2DG3A 3IKGA 4TNSA 1FKGA 2M1IA 5HWBA 3O5IA 2PBCA 4ODNA 2MLZA 1D7HA 1J4HA 3OOBA 4ODLA 5HW7A 5J6EA 2F4EA 2KE0A 4ITZA 1ROUA 4DRMA 2KI3A 1FKBA 2XP5A 3UQBA 4DZ2A 4U84A 1FKTA 2PV2A 3UI6A 3KABA 3KADA 1JNSA 1D7IA 1QZ2A 4U85A 4BF8A 4JFLA 1J4IA 3O5GA 2RUDA 5HT1A 3PRBA 4JFKA 2Q5AA 1FKSA 1R9HA 2ZQUA 3IK8A 2KR7A 2MLXA 3WH0A 1ZCNA 2MF9A 2UZ5A 3O5DA 3IKDA 4DRJA 1FD9A 1Q6HA 3O5QA 1NMWA 1T11A 1FKKA 3MDYB 2OFNA 4ODMA 3RGCA 4W9QA 1NMVA 1PINA 4G2PA 4DIPA 3PA7A 4IQCA 1KT0A 4ODKA 4TX0A 4TW8A 2XPBA 2XPAA 4NNRA 3ODKA 2PPNA 2F2DA 2XP7A 2XP8A 2PV1A 1P5QA 5HUAA 1FKIA 4ODRA 1FJDA 2XP4A 5HWCA 3TCZA 2D9FA 4GGQA 2LKNA 3I6CA 3JYJA 2M08A 1QPLA 3UI5A 4GIVA 4QIBA 3O5EA 3O5FA 2DG4A 3TC5A 3LUOA 1FKFA 1Q1CA 1M5YA 5GPGA 1W26A 4JFJA 2FKEA 1C9HA 4QT2A 4TW6A 2IF4A 2KO7A 2N87A 4LAYA 4W9PA 4DRPA 5HTGA 4JFMA 4C02B 5B8IC 4J4NA 3UI4A 2RURA 2PPOA 4DRHA 5I98A 2FAPA 1FKHA 1YATA 1N1AA 2LPVA 1F8AB 3B7XA 4LAVA 1JNTA 3JYMA 2ZQTA 4U86A 3O5OA 2MLYA 2KGJA 1Y0OA 4FN2A 1L1PA 1JVWA 1KT1A 2ZR6A 3H9RB 3O5MA 4W9OA 4DRIA 1Q6IA 2M2AA 4TYOA 1A7XA 1FKRA 3KAIA 2VN1A 4LAXA 1F40A 4DT4A 2ITKA 4MSPA 2LJ4A 2MPHA 1Q6UA 2L2SA 1J4RA 1D6OA 3FAPA 4ODPA 4DROA 2ZQSA 2RUCA 2RQSA 3O5RA 5BXJA 1ROTA 2ZR4A 4DRKA 3NRKA 4JFIA 2JZVA 3JXVA 3UF8A 4DRNA 4FAPA 1BL4A 2AWGA 4DH0A 5HW6A 3IHZA 5HW8A 2PV3A 1BKFA 4G50A 1FAPA 4ODOA 3RFWA 1EQ3A 3KZ7A 5D75A 1NSGA 3KAFA 1YW5A 2DG9A 3EY6A 4O2TA 2XP9A 3O5PA 5HKGA 4N19A 5DIVA 3KAHA 2XP6A 1ZK6A 2RSEA 1EYMA 5DIUA 4IPXA 4DZ3A 3GPKA 1B6CA 3NI6A 2Y78A 4ODQA 1TCOC
chains in the Genus database with same CATH superfamily
1HKMA 4DWSD 4LGXA 1E6NA 3O5KA 2XP3A 1KFWA 2KFWA 5DITA 1HXVA 2RUQA 3ALFA 2ZQVA 3CGNA 4QT3A 4KR0B 4P8UA 3G6MA 2YBTA 3UQIA 3UQAA 3O5LA 4IT6A 2K8IA 3O5JA 1FKDA 1FKGA 4URIA 3O5IA 2PBCA 4WIWA 2MLZA 1D7HA 5HW7A 4NZCA 5J6EA 4HBOA 4XAKA 1E6ZA 2KE0A 2XP5A 1HKKA 4DZ2A 3UI6A 3WQWA 4ZPWR 3WD3A 4BF8A 2DT2A 5DEZA 1J4IA 1K9TA 5HT1A 1FKSA 3IK8A 4ZPTR 1ZCNA 1LQ0A 2UZ5A 1Q6HA 3PRAA 1NMWA 1T11A 1JNDA 1D2KA 4DIPA 4QZVB 4IQCA 5GPRA 2DSWA 3ARUA 3WD1A 2XP8A 2PV1A 5HUAA 1HJWA 1FJDA 3TCZA 3I6CA 2QF8A 4DWSB 1ZU8A 3O5EA 1W1PA 5GPGA 1HKJA 4W9PA 5HTGA 4C02B 1UR8A 4J4NA 1ITXA 1GOIA 3WQVA 1YATA 1N1AA 2LPVA 3ARZA 3ARYA 3B7XA 3JYMA 2KGJA 3CHCA 4FN2A 1X6NA 1E6RA 3ARSA 3O5MA 4P8XA 3ARQA 1E6PA 2LJ4A 2MPHA 1SR0A 4MNLA 3EIPA 1FFQA 3AS3A 5HBFA 3O5RA 4JFIA 5HW6A 2IUZA 5HW8A 3RFWA 4G50A 3KZ7A 1NSGA 5HKGA 2XP9A 2B5UB 4WKHA 3WL0A 2WK2A 5DIUA 4DZ3A 1B6CA 4UDMA 1NWSA 1U79A 1TFVA 1NWRA 4Q7NA 3ALGA 1GUVA 3TDBA 2LGOA 3ARRA 3KCEA 4IQ2A 1FKJA 2G8ZA 1ZBVA 4R0XA 2F21A 3NTPA 1HJXA 3BXWA 1VF8A 3KACA 5HWBA 1ZBWA 3AQUA 4ODLA 1WAWA 1H0IA 4WKAA 3UQBA 4U84A 1NH6A 3KADA 1W9UA 4HBEA 4P8WA 2RUDA 4JFKA 1R9HA 1JNEA 4W5UA 3BMBA 3O5DA 1FD9A 3O5QA 4DWSC 2OFNA 1NMVA 1E15A 1KT0A 2XPBA 3RMEA 2A3EA 2PPNA 4ODRA 1IX5A 1EDQA 2XP4A 3UI5A 4GGQA 1ZBKA 2O92A 1QPLA 4GIVA 4WJXA 3B9EA 1HKIA 3RM8A 2DT1A 4PTMA 3TC5A 1FKFA 4S3JA 4JFJA 4TW6A 2IF4A 4LAYA 4DRPA 1LG1A 1FFRA 3UI4A 2DSZA 1FKHA 1CTNA 1E9LA 2A3BA 3O5OA 2MLYA 4NSBA 1Y0OA 1W1VA 1L1PA 1JVWA 1ZB5A 1W9PA 1ZL1A 2M2AA 3CH9A 1FKRA 4S3KA 2VN1A 4LAXA 4WK9A 4DT4A 4MSPA 1Q6UA 2L2SA 5GQBA 4MPKA 2F23A 4DRKA 1EQ3A 1BKFA 5JH8A 1YW5A 3O5PA 1GPFA 1LG2A 1OWQA 4ZPVR 1ZK6A 2RSEA 1EYMA 1TCOC 2DSVA 3CHFA 4JYSA 3WKZA 3VAWA 1FKLA 1LL4A 2A3AA 3FXYA 3CGMA 2G41A 1WB0A 2ZR5A 3PRDA 4TW7A 4J4OA 1PBKA 3IKGA 2WLYA 2M1IA 3WIJA 3AS2A 4DRMA 2KI3A 4P8VA 1W1YA 2YBUA 1FKTA 2PV2A 1JCHB 1H0GA 3KABA 1D7IA 2ETNA 2WM0A 3WD2A 2ZQUA 2KR7A 3PR9A 3RM9A 3AS1A 3RGCA 3MDYB 3ARXA 4W9QA 1GRJA 1PINA 4G2PA 4Q22A 1W1TA 5DF0A 3RM4A 1SYTA 2XPAA 3ODKA 2XP7A 1FKIA 2ESCA 3AS0A 2LKNA 3JYJA 4QIBA 3WD0A 2DG4A 1Q1CA 1M5YA 4HARA 4QT2A 2KO7A 3CHDA 2N87A 4MNMA 4AY1A 4DRHA 1O6IA 2FAPA 1F8AB 4LAVA 3GTYX 1JNTA 4U86A 1E44A 1EIBA 1XHGA 2AOSA 4ML4A 2ZR6A 5DO2A 4W9OA 4IT4A 4TYOA 1F40A 2ITKA 1J4RA 1D6OA 3FAPA 4ODPA 4DROA 2EULA 2RUCA 5BXJA 3AROA 3NRKA 2JZVA 3JXVA 3UF8A 2AWGA 4L72B 4DH0A 3ARTA 3GU0A 5D75A 2DG9A 3EY6A 4O2TA 3WD4A 4N19A 5DIVA 1OGGA 3KAHA 2XP6A 1X6LA 4IPXA 3GPKA 4ODQA 4DRQA 3B8SA 4KQZA 4Z2HA 4LAWA 1J6YA 1D7JA 1EHNA 1QPFA 3FY1A 3WL1A 4MGVA 2MNTA 1NWTA 1NWUA 2PPPA 2VCDA 3ARPA 3KAGA 4TNSA 2DG3A 4Z2LA 1RD6A 4DWSA 2DT0A 4ODNA 3OOBA 4MAVA 1J4HA 4MNKA 2F4EA 4ITZA 1ROUA 2PN0A 1FKBA 2P4VA 3B9AA 4Z2GA 1JNSA 1QZ2A 4WKFA 2PI6A 3W4RA 4U85A 4JFLA 3O5GA 3PRBA 2Q5AA 1W9VA 2MLXA 3WH0A 2MF9A 4DRJA 3IKDA 4ODMA 1FKKA 3B9DA 3PA7A 2B31A 3ARVA 4MNJA 1LJYA 4ODKA 1WNOA 3G6LA 4TX0A 4TW8A 2O9OA 4NNRA 4R5EA 2F2DA 1P5QA 4Z2IA 5HWCA 2D9FA 3OA5A 2M08A 1HJVA 3O5FA 3LUOA 1UR9A 1W26A 2FKEA 1C9HA 3QOKA 2DSUA 4JFMA 4Z2JA 5B8IC 2RURA 2PPOA 5I98A 4MTVA 2A3CA 2FDMA 2ZQTA 1LL6A 3CHEA 1ZBCA 1KT1A 2DT3A 2WLZA 3H9RB 4DRIA 1Q6IA 1A7XA 3CZ8A 3KAIA 1LL7A 2ZQSA 2RQSA 2OLHA 1ROTA 2ZR4A 4L3NA 4FAPA 4DRNA 1BL4A 2DPEA 4ZS6A 3IHZA 4Z2KA 2PV3A 4ODOA 1FAPA 3ARWA 3KAFA 1OGBA 1XRVA 3NI6A 2Y78A
chains in the Genus database with same CATH topology
1HKMA 4DWSD 4LGXA 1E6NA 3O5KA 2XP3A 1KFWA 2KFWA 5DITA 1HXVA 2RUQA 3ALFA 2ZQVA 3CGNA 4QT3A 4KR0B 4P8UA 3G6MA 2YBTA 3UQIA 3UQAA 3O5LA 4IT6A 2K8IA 3O5JA 1FKDA 1FKGA 4URIA 3O5IA 2PBCA 4WIWA 2MLZA 1D7HA 5HW7A 4NZCA 5J6EA 4HBOA 4XAKA 1E6ZA 2KE0A 2XP5A 1HKKA 4DZ2A 3UI6A 3WQWA 4ZPWR 3WD3A 4BF8A 2DT2A 5DEZA 1J4IA 1K9TA 5HT1A 1FKSA 3IK8A 4ZPTR 1ZCNA 1LQ0A 2UZ5A 1Q6HA 3PRAA 1NMWA 1T11A 1JNDA 1D2KA 4DIPA 4QZVB 4IQCA 5GPRA 2DSWA 3ARUA 3WD1A 2XP8A 2PV1A 5HUAA 1HJWA 1FJDA 3TCZA 3I6CA 2QF8A 4DWSB 1ZU8A 3O5EA 1W1PA 5GPGA 1HKJA 4W9PA 5HTGA 4C02B 1UR8A 4J4NA 1ITXA 1GOIA 3WQVA 1YATA 1N1AA 2LPVA 3ARZA 3ARYA 3B7XA 3JYMA 2KGJA 3CHCA 1X6NA 4FN2A 1E6RA 3ARSA 3O5MA 4P8XA 3ARQA 1E6PA 2LJ4A 2MPHA 1SR0A 4MNLA 1FFQA 3AS3A 5HBFA 3O5RA 4JFIA 5HW6A 2IUZA 5HW8A 3RFWA 4G50A 3KZ7A 1NSGA 5HKGA 2XP9A 4WKHA 3WL0A 2WK2A 5DIUA 4DZ3A 1B6CA 1NWSA 1U79A 1TFVA 1NWRA 4Q7NA 3ALGA 1GUVA 3TDBA 2LGOA 3ARRA 3KCEA 4IQ2A 1FKJA 2G8ZA 1ZBVA 4R0XA 2F21A 3NTPA 1HJXA 3BXWA 1VF8A 3KACA 5HWBA 1ZBWA 3AQUA 4ODLA 1WAWA 1H0IA 4WKAA 3UQBA 4U84A 1NH6A 3KADA 1W9UA 4HBEA 4P8WA 2RUDA 4JFKA 1R9HA 1JNEA 4W5UA 3O5DA 1FD9A 3O5QA 4DWSC 2OFNA 1NMVA 1E15A 1KT0A 2XPBA 3RMEA 2A3EA 2PPNA 4ODRA 1IX5A 1EDQA 2XP4A 3UI5A 4GGQA 1ZBKA 2O92A 1QPLA 4GIVA 4WJXA 3B9EA 1HKIA 3RM8A 2DT1A 4PTMA 3TC5A 1FKFA 4S3JA 4JFJA 4TW6A 2IF4A 4LAYA 4DRPA 1LG1A 1FFRA 3UI4A 2DSZA 1FKHA 1CTNA 1E9LA 2A3BA 3O5OA 2MLYA 4NSBA 1Y0OA 1W1VA 1L1PA 1JVWA 1ZB5A 1W9PA 1ZL1A 2M2AA 3CH9A 1FKRA 4S3KA 2VN1A 4LAXA 4WK9A 4DT4A 4MSPA 1Q6UA 2L2SA 5GQBA 4MPKA 4DRKA 1EQ3A 1BKFA 5JH8A 1YW5A 3O5PA 1GPFA 1LG2A 1OWQA 4ZPVR 1ZK6A 2RSEA 1EYMA 1TCOC 2DSVA 3CHFA 4JYSA 3WKZA 3VAWA 1FKLA 1LL4A 2A3AA 3FXYA 3CGMA 2G41A 1WB0A 2ZR5A 3PRDA 4TW7A 4J4OA 1PBKA 3IKGA 2WLYA 2M1IA 3WIJA 3AS2A 4DRMA 2KI3A 4P8VA 1W1YA 2YBUA 1FKTA 2PV2A 1H0GA 3KABA 1D7IA 2WM0A 3WD2A 2ZQUA 2KR7A 3PR9A 3RM9A 3AS1A 3RGCA 3MDYB 3ARXA 4W9QA 1PINA 4G2PA 4Q22A 1W1TA 5DF0A 3RM4A 1SYTA 2XPAA 3ODKA 2XP7A 1FKIA 2ESCA 3AS0A 2LKNA 3JYJA 4QIBA 3WD0A 2DG4A 1Q1CA 1M5YA 4HARA 4QT2A 2KO7A 3CHDA 2N87A 4MNMA 4AY1A 4DRHA 1O6IA 2FAPA 1F8AB 4LAVA 1JNTA 4U86A 1EIBA 1XHGA 2AOSA 4ML4A 2ZR6A 5DO2A 4W9OA 4IT4A 4TYOA 1F40A 2ITKA 1J4RA 1D6OA 3FAPA 4ODPA 4DROA 2RUCA 5BXJA 3AROA 3NRKA 2JZVA 3JXVA 3UF8A 2AWGA 4L72B 4DH0A 3ARTA 5D75A 2DG9A 3EY6A 4O2TA 3WD4A 4N19A 5DIVA 1OGGA 3KAHA 2XP6A 1X6LA 4IPXA 3GPKA 4ODQA 4DRQA 3B8SA 4KQZA 4Z2HA 4LAWA 1J6YA 1D7JA 1EHNA 1QPFA 3FY1A 3WL1A 4MGVA 2MNTA 1NWTA 1NWUA 2PPPA 2VCDA 3ARPA 3KAGA 4TNSA 2DG3A 4Z2LA 1RD6A 4DWSA 2DT0A 4ODNA 3OOBA 4MAVA 1J4HA 4MNKA 2F4EA 4ITZA 1ROUA 1FKBA 3B9AA 4Z2GA 1JNSA 1QZ2A 4WKFA 2PI6A 3W4RA 4U85A 4JFLA 3O5GA 3PRBA 2Q5AA 1W9VA 2MLXA 3WH0A 2MF9A 4DRJA 3IKDA 4ODMA 1FKKA 3B9DA 3PA7A 2B31A 3ARVA 4MNJA 1LJYA 4ODKA 1WNOA 3G6LA 4TX0A 4TW8A 2O9OA 4NNRA 4R5EA 2F2DA 1P5QA 4Z2IA 5HWCA 2D9FA 3OA5A 2M08A 1HJVA 3O5FA 3LUOA 1UR9A 1W26A 2FKEA 1C9HA 3QOKA 2DSUA 4JFMA 4Z2JA 5B8IC 2RURA 2PPOA 5I98A 4MTVA 2A3CA 2FDMA 2ZQTA 1LL6A 3CHEA 1ZBCA 1KT1A 2DT3A 2WLZA 3H9RB 4DRIA 1Q6IA 1A7XA 3CZ8A 3KAIA 1LL7A 2ZQSA 2RQSA 2OLHA 1ROTA 2ZR4A 4L3NA 4FAPA 4DRNA 1BL4A 2DPEA 4ZS6A 3IHZA 4Z2KA 2PV3A 4ODOA 1FAPA 3ARWA 3KAFA 1OGBA 1XRVA 3NI6A 2Y78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U79 A;  4DRQ A;  3TDB A;  3O5K A;  2XP3 A;  2LGO A;  2KFW A;  3KCE A;  4IQ2 A;  5DIT A;  1FKJ A;  4JYS A;  1HXV A;  3VAW A;  1FKL A;  2RUQ A;  4LAW A;  2ZQV A;  1J6Y A;  3CGN A;  1D7J A;  4QT3 A;  1QPF A;  3CGM A;  4MGV A;  4R0X A;  2MNT A;  2F21 A;  3NTP A;  3UQI A;  3UQA A;  3O5L A;  2ZR5 A;  3PRD A;  4TW7 A;  2PPP A;  2VCD A;  3KAC A;  3KAG A;  2K8I A;  3O5J A;  4J4O A;  1FKD A;  1PBK A;  2DG3 A;  3IKG A;  4TNS A;  1FKG A;  2M1I A;  5HWB A;  3O5I A;  2PBC A;  4ODN A;  2MLZ A;  1D7H A;  1J4H A;  3OOB A;  4ODL A;  5HW7 A;  5J6E A;  2F4E A;  2KE0 A;  4ITZ A;  1ROU A;  4DRM A;  2KI3 A;  1FKB A;  2XP5 A;  3UQB A;  4DZ2 A;  4U84 A;  1FKT A;  2PV2 A;  3UI6 A;  3KAB A;  3KAD A;  1JNS A;  1D7I A;  1QZ2 A;  4U85 A;  4BF8 A;  4JFL A;  1J4I A;  3O5G A;  2RUD A;  5HT1 A;  3PRB A;  4JFK A;  2Q5A A;  1FKS A;  1R9H A;  2ZQU A;  3IK8 A;  2KR7 A;  2MLX A;  3WH0 A;  1ZCN A;  2MF9 A;  2UZ5 A;  3O5D A;  3IKD A;  4DRJ A;  1FD9 A;  1Q6H A;  3O5Q A;  1NMW A;  1T11 A;  1FKK A;  3MDY B;  2OFN A;  4ODM A;  3RGC A;  4W9Q A;  1NMV A;  1PIN A;  4G2P A;  4DIP A;  3PA7 A;  4IQC A;  1KT0 A;  4ODK A;  4TX0 A;  4TW8 A;  2XPB A;  2XPA A;  4NNR A;  3ODK A;  2PPN A;  2F2D A;  2XP7 A;  2XP8 A;  2PV1 A;  1P5Q A;  5HUA A;  1FKI A;  4ODR A;  1FJD A;  2XP4 A;  5HWC A;  3TCZ A;  2D9F A;  4GGQ A;  2LKN A;  3I6C A;  3JYJ A;  2M08 A;  1QPL A;  3UI5 A;  4GIV A;  4QIB A;  3O5E A;  3O5F A;  2DG4 A;  3TC5 A;  3LUO A;  1FKF A;  1Q1C A;  1M5Y A;  5GPG A;  1W26 A;  4JFJ A;  2FKE A;  1C9H A;  4QT2 A;  4TW6 A;  2IF4 A;  2KO7 A;  2N87 A;  4LAY A;  4W9P A;  4DRP A;  5HTG A;  4JFM A;  4C02 B;  5B8I C;  4J4N A;  3UI4 A;  2RUR A;  2PPO A;  4DRH A;  5I98 A;  2FAP A;  1FKH A;  1YAT A;  1N1A A;  2LPV A;  1F8A B;  3B7X A;  4LAV A;  1JNT A;  3JYM A;  2ZQT A;  4U86 A;  3O5O A;  2MLY A;  2KGJ A;  1Y0O A;  4FN2 A;  1L1P A;  1JVW A;  1KT1 A;  2ZR6 A;  3H9R B;  3O5M A;  4W9O A;  4DRI A;  1Q6I A;  2M2A A;  4TYO A;  1A7X A;  1FKR A;  3KAI A;  2VN1 A;  4LAX A;  1F40 A;  4DT4 A;  2ITK A;  4MSP A;  2LJ4 A;  2MPH A;  1Q6U A;  2L2S A;  1J4R A;  1D6O A;  3FAP A;  4ODP A;  4DRO A;  2ZQS A;  2RUC A;  2RQS A;  3O5R A;  5BXJ A;  1ROT A;  2ZR4 A;  4DRK A;  3NRK A;  4JFI A;  2JZV A;  3JXV A;  3UF8 A;  4DRN A;  4FAP A;  1BL4 A;  2AWG A;  4DH0 A;  5HW6 A;  3IHZ A;  5HW8 A;  2PV3 A;  1BKF A;  4G50 A;  1FAP A;  4ODO A;  3RFW A;  1EQ3 A;  3KZ7 A;  5D75 A;  1NSG A;  3KAF A;  1YW5 A;  2DG9 A;  3EY6 A;  4O2T A;  2XP9 A;  3O5P A;  5HKG A;  4N19 A;  5DIV A;  3KAH A;  2XP6 A;  1ZK6 A;  2RSE A;  1EYM A;  5DIU A;  4IPX A;  4DZ3 A;  3GPK A;  1B6C A;  3NI6 A;  2Y78 A;  4ODQ A;  1TCO C; 
#chains in the Genus database with same CATH topology
 1HKM A;  4DWS D;  4LGX A;  1E6N A;  3O5K A;  2XP3 A;  1KFW A;  2KFW A;  5DIT A;  1HXV A;  2RUQ A;  3ALF A;  2ZQV A;  3CGN A;  4QT3 A;  4KR0 B;  4P8U A;  3G6M A;  2YBT A;  3UQI A;  3UQA A;  3O5L A;  4IT6 A;  2K8I A;  3O5J A;  1FKD A;  1FKG A;  4URI A;  3O5I A;  2PBC A;  4WIW A;  2MLZ A;  1D7H A;  5HW7 A;  4NZC A;  5J6E A;  4HBO A;  4XAK A;  1E6Z A;  2KE0 A;  2XP5 A;  1HKK A;  4DZ2 A;  3UI6 A;  3WQW A;  4ZPW R;  3WD3 A;  4BF8 A;  2DT2 A;  5DEZ A;  1J4I A;  1K9T A;  5HT1 A;  1FKS A;  3IK8 A;  4ZPT R;  1ZCN A;  1LQ0 A;  2UZ5 A;  1Q6H A;  3PRA A;  1NMW A;  1T11 A;  1JND A;  1D2K A;  4DIP A;  4QZV B;  4IQC A;  5GPR A;  2DSW A;  3ARU A;  3WD1 A;  2XP8 A;  2PV1 A;  5HUA A;  1HJW A;  1FJD A;  3TCZ A;  3I6C A;  2QF8 A;  4DWS B;  1ZU8 A;  3O5E A;  1W1P A;  5GPG A;  1HKJ A;  4W9P A;  5HTG A;  4C02 B;  1UR8 A;  4J4N A;  1ITX A;  1GOI A;  3WQV A;  1YAT A;  1N1A A;  2LPV A;  3ARZ A;  3ARY A;  3B7X A;  3JYM A;  2KGJ A;  3CHC A;  4FN2 A;  1X6N A;  1E6R A;  3ARS A;  3O5M A;  4P8X A;  3ARQ A;  1E6P A;  2LJ4 A;  2MPH A;  1SR0 A;  4MNL A;  3EIP A;  1FFQ A;  3AS3 A;  5HBF A;  3O5R A;  4JFI A;  5HW6 A;  2IUZ A;  5HW8 A;  3RFW A;  4G50 A;  3KZ7 A;  1NSG A;  5HKG A;  2XP9 A;  2B5U B;  4WKH A;  3WL0 A;  2WK2 A;  5DIU A;  4DZ3 A;  1B6C A;  4UDM A;  1NWS A;  1U79 A;  1TFV A;  1NWR A;  4Q7N A;  3ALG A;  1GUV A;  3TDB A;  2LGO A;  3ARR A;  3KCE A;  4IQ2 A;  1FKJ A;  2G8Z A;  1ZBV A;  4R0X A;  2F21 A;  3NTP A;  1HJX A;  3BXW A;  1VF8 A;  3KAC A;  5HWB A;  1ZBW A;  3AQU A;  4ODL A;  1WAW A;  1H0I A;  4WKA A;  3UQB A;  4U84 A;  1NH6 A;  3KAD A;  1W9U A;  4HBE A;  4P8W A;  2RUD A;  4JFK A;  1R9H A;  1JNE A;  4W5U A;  3BMB A;  3O5D A;  1FD9 A;  3O5Q A;  4DWS C;  2OFN A;  1NMV A;  1E15 A;  1KT0 A;  2XPB A;  3RME A;  2A3E A;  2PPN A;  4ODR A;  1IX5 A;  1EDQ A;  2XP4 A;  3UI5 A;  4GGQ A;  1ZBK A;  2O92 A;  1QPL A;  4GIV A;  4WJX A;  3B9E A;  1HKI A;  3RM8 A;  2DT1 A;  4PTM A;  3TC5 A;  1FKF A;  4S3J A;  4JFJ A;  4TW6 A;  2IF4 A;  4LAY A;  4DRP A;  1LG1 A;  1FFR A;  3UI4 A;  2DSZ A;  1FKH A;  1CTN A;  1E9L A;  2A3B A;  3O5O A;  2MLY A;  4NSB A;  1Y0O A;  1W1V A;  1L1P A;  1JVW A;  1ZB5 A;  1W9P A;  1ZL1 A;  2M2A A;  3CH9 A;  1FKR A;  4S3K A;  2VN1 A;  4LAX A;  4WK9 A;  4DT4 A;  4MSP A;  1Q6U A;  2L2S A;  5GQB A;  4MPK A;  2F23 A;  4DRK A;  1EQ3 A;  1BKF A;  5JH8 A;  1YW5 A;  3O5P A;  1GPF A;  1LG2 A;  1OWQ A;  4ZPV R;  1ZK6 A;  2RSE A;  1EYM A;  1TCO C;  2DSV A;  3CHF A;  4JYS A;  3WKZ A;  3VAW A;  1FKL A;  1LL4 A;  2A3A A;  3FXY A;  3CGM A;  2G41 A;  1WB0 A;  2ZR5 A;  3PRD A;  4TW7 A;  4J4O A;  1PBK A;  3IKG A;  2WLY A;  2M1I A;  3WIJ A;  3AS2 A;  4DRM A;  2KI3 A;  4P8V A;  1W1Y A;  2YBU A;  1FKT A;  2PV2 A;  1JCH B;  1H0G A;  3KAB A;  1D7I A;  2ETN A;  2WM0 A;  3WD2 A;  2ZQU A;  2KR7 A;  3PR9 A;  3RM9 A;  3AS1 A;  3RGC A;  3MDY B;  3ARX A;  4W9Q A;  1GRJ A;  1PIN A;  4G2P A;  4Q22 A;  1W1T A;  5DF0 A;  3RM4 A;  1SYT A;  2XPA A;  3ODK A;  2XP7 A;  1FKI A;  2ESC A;  3AS0 A;  2LKN A;  3JYJ A;  4QIB A;  3WD0 A;  2DG4 A;  1Q1C A;  1M5Y A;  4HAR A;  4QT2 A;  2KO7 A;  3CHD A;  2N87 A;  4MNM A;  4AY1 A;  4DRH A;  1O6I A;  2FAP A;  1F8A B;  4LAV A;  3GTY X;  1JNT A;  4U86 A;  1E44 A;  1EIB A;  1XHG A;  2AOS A;  4ML4 A;  2ZR6 A;  5DO2 A;  4W9O A;  4IT4 A;  4TYO A;  1F40 A;  2ITK A;  1J4R A;  1D6O A;  3FAP A;  4ODP A;  4DRO A;  2EUL A;  2RUC A;  5BXJ A;  3ARO A;  3NRK A;  2JZV A;  3JXV A;  3UF8 A;  2AWG A;  4L72 B;  4DH0 A;  3ART A;  3GU0 A;  5D75 A;  2DG9 A;  3EY6 A;  4O2T A;  3WD4 A;  4N19 A;  5DIV A;  1OGG A;  3KAH A;  2XP6 A;  1X6L A;  4IPX A;  3GPK A;  4ODQ A;  4DRQ A;  3B8S A;  4KQZ A;  4Z2H A;  4LAW A;  1J6Y A;  1D7J A;  1EHN A;  1QPF A;  3FY1 A;  3WL1 A;  4MGV A;  2MNT A;  1NWT A;  1NWU A;  2PPP A;  2VCD A;  3ARP A;  3KAG A;  4TNS A;  2DG3 A;  4Z2L A;  1RD6 A;  4DWS A;  2DT0 A;  4ODN A;  3OOB A;  4MAV A;  1J4H A;  4MNK A;  2F4E A;  4ITZ A;  1ROU A;  2PN0 A;  1FKB A;  2P4V A;  3B9A A;  4Z2G A;  1JNS A;  1QZ2 A;  4WKF A;  2PI6 A;  3W4R A;  4U85 A;  4JFL A;  3O5G A;  3PRB A;  2Q5A A;  1W9V A;  2MLX A;  3WH0 A;  2MF9 A;  4DRJ A;  3IKD A;  4ODM A;  1FKK A;  3B9D A;  3PA7 A;  2B31 A;  3ARV A;  4MNJ A;  1LJY A;  4ODK A;  1WNO A;  3G6L A;  4TX0 A;  4TW8 A;  2O9O A;  4NNR A;  4R5E A;  2F2D A;  1P5Q A;  4Z2I A;  5HWC A;  2D9F A;  3OA5 A;  2M08 A;  1HJV A;  3O5F A;  3LUO A;  1UR9 A;  1W26 A;  2FKE A;  1C9H A;  3QOK A;  2DSU A;  4JFM A;  4Z2J A;  5B8I C;  2RUR A;  2PPO A;  5I98 A;  4MTV A;  2A3C A;  2FDM A;  2ZQT A;  1LL6 A;  3CHE A;  1ZBC A;  1KT1 A;  2DT3 A;  2WLZ A;  3H9R B;  4DRI A;  1Q6I A;  1A7X A;  3CZ8 A;  3KAI A;  1LL7 A;  2ZQS A;  2RQS A;  2OLH A;  1ROT A;  2ZR4 A;  4L3N A;  4FAP A;  4DRN A;  1BL4 A;  2DPE A;  4ZS6 A;  3IHZ A;  4Z2K A;  2PV3 A;  4ODO A;  1FAP A;  3ARW A;  3KAF A;  1OGB A;  1XRV A;  3NI6 A;  2Y78 A; 
#chains in the Genus database with same CATH homology
 1HKM A;  4DWS D;  4LGX A;  1E6N A;  3O5K A;  2XP3 A;  1KFW A;  2KFW A;  5DIT A;  1HXV A;  2RUQ A;  3ALF A;  2ZQV A;  3CGN A;  4QT3 A;  4KR0 B;  4P8U A;  3G6M A;  2YBT A;  3UQI A;  3UQA A;  3O5L A;  4IT6 A;  2K8I A;  3O5J A;  1FKD A;  1FKG A;  4URI A;  3O5I A;  2PBC A;  4WIW A;  2MLZ A;  1D7H A;  5HW7 A;  4NZC A;  5J6E A;  4HBO A;  4XAK A;  1E6Z A;  2KE0 A;  2XP5 A;  1HKK A;  4DZ2 A;  3UI6 A;  3WQW A;  4ZPW R;  3WD3 A;  4BF8 A;  2DT2 A;  5DEZ A;  1J4I A;  1K9T A;  5HT1 A;  1FKS A;  3IK8 A;  4ZPT R;  1ZCN A;  1LQ0 A;  2UZ5 A;  1Q6H A;  3PRA A;  1NMW A;  1T11 A;  1JND A;  1D2K A;  4DIP A;  4QZV B;  4IQC A;  5GPR A;  2DSW A;  3ARU A;  3WD1 A;  2XP8 A;  2PV1 A;  5HUA A;  1HJW A;  1FJD A;  3TCZ A;  3I6C A;  2QF8 A;  4DWS B;  1ZU8 A;  3O5E A;  1W1P A;  5GPG A;  1HKJ A;  4W9P A;  5HTG A;  4C02 B;  1UR8 A;  4J4N A;  1ITX A;  1GOI A;  3WQV A;  1YAT A;  1N1A A;  2LPV A;  3ARZ A;  3ARY A;  3B7X A;  3JYM A;  2KGJ A;  3CHC A;  1X6N A;  4FN2 A;  1E6R A;  3ARS A;  3O5M A;  4P8X A;  3ARQ A;  1E6P A;  2LJ4 A;  2MPH A;  1SR0 A;  4MNL A;  1FFQ A;  3AS3 A;  5HBF A;  3O5R A;  4JFI A;  5HW6 A;  2IUZ A;  5HW8 A;  3RFW A;  4G50 A;  3KZ7 A;  1NSG A;  5HKG A;  2XP9 A;  4WKH A;  3WL0 A;  2WK2 A;  5DIU A;  4DZ3 A;  1B6C A;  1NWS A;  1U79 A;  1TFV A;  1NWR A;  4Q7N A;  3ALG A;  1GUV A;  3TDB A;  2LGO A;  3ARR A;  3KCE A;  4IQ2 A;  1FKJ A;  2G8Z A;  1ZBV A;  4R0X A;  2F21 A;  3NTP A;  1HJX A;  3BXW A;  1VF8 A;  3KAC A;  5HWB A;  1ZBW A;  3AQU A;  4ODL A;  1WAW A;  1H0I A;  4WKA A;  3UQB A;  4U84 A;  1NH6 A;  3KAD A;  1W9U A;  4HBE A;  4P8W A;  2RUD A;  4JFK A;  1R9H A;  1JNE A;  4W5U A;  3O5D A;  1FD9 A;  3O5Q A;  4DWS C;  2OFN A;  1NMV A;  1E15 A;  1KT0 A;  2XPB A;  3RME A;  2A3E A;  2PPN A;  4ODR A;  1IX5 A;  1EDQ A;  2XP4 A;  3UI5 A;  4GGQ A;  1ZBK A;  2O92 A;  1QPL A;  4GIV A;  4WJX A;  3B9E A;  1HKI A;  3RM8 A;  2DT1 A;  4PTM A;  3TC5 A;  1FKF A;  4S3J A;  4JFJ A;  4TW6 A;  2IF4 A;  4LAY A;  4DRP A;  1LG1 A;  1FFR A;  3UI4 A;  2DSZ A;  1FKH A;  1CTN A;  1E9L A;  2A3B A;  3O5O A;  2MLY A;  4NSB A;  1Y0O A;  1W1V A;  1L1P A;  1JVW A;  1ZB5 A;  1W9P A;  1ZL1 A;  2M2A A;  3CH9 A;  1FKR A;  4S3K A;  2VN1 A;  4LAX A;  4WK9 A;  4DT4 A;  4MSP A;  1Q6U A;  2L2S A;  5GQB A;  4MPK A;  4DRK A;  1EQ3 A;  1BKF A;  5JH8 A;  1YW5 A;  3O5P A;  1GPF A;  1LG2 A;  1OWQ A;  4ZPV R;  1ZK6 A;  2RSE A;  1EYM A;  1TCO C;  2DSV A;  3CHF A;  4JYS A;  3WKZ A;  3VAW A;  1FKL A;  1LL4 A;  2A3A A;  3FXY A;  3CGM A;  2G41 A;  1WB0 A;  2ZR5 A;  3PRD A;  4TW7 A;  4J4O A;  1PBK A;  3IKG A;  2WLY A;  2M1I A;  3WIJ A;  3AS2 A;  4DRM A;  2KI3 A;  4P8V A;  1W1Y A;  2YBU A;  1FKT A;  2PV2 A;  1H0G A;  3KAB A;  1D7I A;  2WM0 A;  3WD2 A;  2ZQU A;  2KR7 A;  3PR9 A;  3RM9 A;  3AS1 A;  3RGC A;  3MDY B;  3ARX A;  4W9Q A;  1PIN A;  4G2P A;  4Q22 A;  1W1T A;  5DF0 A;  3RM4 A;  1SYT A;  2XPA A;  3ODK A;  2XP7 A;  1FKI A;  2ESC A;  3AS0 A;  2LKN A;  3JYJ A;  4QIB A;  3WD0 A;  2DG4 A;  1Q1C A;  1M5Y A;  4HAR A;  4QT2 A;  2KO7 A;  3CHD A;  2N87 A;  4MNM A;  4AY1 A;  4DRH A;  1O6I A;  2FAP A;  1F8A B;  4LAV A;  1JNT A;  4U86 A;  1EIB A;  1XHG A;  2AOS A;  4ML4 A;  2ZR6 A;  5DO2 A;  4W9O A;  4IT4 A;  4TYO A;  1F40 A;  2ITK A;  1J4R A;  1D6O A;  3FAP A;  4ODP A;  4DRO A;  2RUC A;  5BXJ A;  3ARO A;  3NRK A;  2JZV A;  3JXV A;  3UF8 A;  2AWG A;  4L72 B;  4DH0 A;  3ART A;  5D75 A;  2DG9 A;  3EY6 A;  4O2T A;  3WD4 A;  4N19 A;  5DIV A;  1OGG A;  3KAH A;  2XP6 A;  1X6L A;  4IPX A;  3GPK A;  4ODQ A;  4DRQ A;  3B8S A;  4KQZ A;  4Z2H A;  4LAW A;  1J6Y A;  1D7J A;  1EHN A;  1QPF A;  3FY1 A;  3WL1 A;  4MGV A;  2MNT A;  1NWT A;  1NWU A;  2PPP A;  2VCD A;  3ARP A;  3KAG A;  4TNS A;  2DG3 A;  4Z2L A;  1RD6 A;  4DWS A;  2DT0 A;  4ODN A;  3OOB A;  4MAV A;  1J4H A;  4MNK A;  2F4E A;  4ITZ A;  1ROU A;  1FKB A;  3B9A A;  4Z2G A;  1JNS A;  1QZ2 A;  4WKF A;  2PI6 A;  3W4R A;  4U85 A;  4JFL A;  3O5G A;  3PRB A;  2Q5A A;  1W9V A;  2MLX A;  3WH0 A;  2MF9 A;  4DRJ A;  3IKD A;  4ODM A;  1FKK A;  3B9D A;  3PA7 A;  2B31 A;  3ARV A;  4MNJ A;  1LJY A;  4ODK A;  1WNO A;  3G6L A;  4TX0 A;  4TW8 A;  2O9O A;  4NNR A;  4R5E A;  2F2D A;  1P5Q A;  4Z2I A;  5HWC A;  2D9F A;  3OA5 A;  2M08 A;  1HJV A;  3O5F A;  3LUO A;  1UR9 A;  1W26 A;  2FKE A;  1C9H A;  3QOK A;  2DSU A;  4JFM A;  4Z2J A;  5B8I C;  2RUR A;  2PPO A;  5I98 A;  4MTV A;  2A3C A;  2FDM A;  2ZQT A;  1LL6 A;  3CHE A;  1ZBC A;  1KT1 A;  2DT3 A;  2WLZ A;  3H9R B;  4DRI A;  1Q6I A;  1A7X A;  3CZ8 A;  3KAI A;  1LL7 A;  2ZQS A;  2RQS A;  2OLH A;  1ROT A;  2ZR4 A;  4L3N A;  4FAP A;  4DRN A;  1BL4 A;  2DPE A;  4ZS6 A;  3IHZ A;  4Z2K A;  2PV3 A;  4ODO A;  1FAP A;  3ARW A;  3KAF A;  1OGB A;  1XRV A;  3NI6 A;  2Y78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...