4ODPA

Structure of slyd delta-if from thermus thermophilus in complex with s2-w23a peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
101
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 23
structure length 101
sequence length 110
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odpA00
1FKLA 1ROUA 2RUCA 2VCDA 2XP9A 2XP6A 4TNSA 5HWBA 3MDYB 1J6YA 4TW6A 5BXJA 2FKEA 1D7HA 1C9HA 2MLYA 2PPOA 4TW8A 4TYOA 2AWGA 2D9FA 3O5JA 3JYMA 5HW8A 4IPXA 1B6CA 1BKFA 5HUAA 3CGNA 3LUOA 1FKRA 2XP7A 3PRDA 2LGOA 3KABA 4ODMA 3KAFA 4IQCA 4R0XA 5B8IC 4QIBA 3I6CA 4JFIA 3O5LA 3GPKA 1FJDA 1Q6UA 1F8AB 3O5PA 2Y78A 1NSGA 1PINA 2DG9A 1EYMA 2XP3A 2DG3A 2ZR4A 3NI6A 5I98A 2RURA 3O5QA 4U85A 2RSEA 2L2SA 1FAPA 4DRNA 3KACA 1Q1CA 5HW7A 3IHZA 4ODNA 5DIVA 4C02B 4N19A 3O5DA 1W26A 3KCEA 3O5RA 3O5IA 3PRBA 3JXVA 1ZCNA 4W9OA 2K8IA 1FD9A 1JNTA 1QPFA 1NMWA 1FKJA 1KT1A 1R9HA 2M08A 2M1IA 3H9RB 1P5QA 4W9QA 4DZ2A 1J4HA 1FKTA 2KO7A 4ODKA 1L1PA 1FKKA 3IKDA 3KAHA 4W9PA 4IQ2A 4LAWA 4DRJA 3O5GA 2RQSA 3UQBA 4ITZA 2PV2A 3UQIA 1D6OA 1T11A 4QT3A 1A7XA 2KGJA 3RGCA 1JVWA 1J4IA 2F21A 2PV1A 3JYJA 3CGMA 1J4RA 4J4OA 3OOBA 1M5YA 2PV3A 1ROTA 4LAVA 2PPNA 4JFMA 1QPLA 1FKIA 4JYSA 2KFWA 2OFNA 4J4NA 4BF8A 1EQ3A 3IKGA 2F4EA 3O5KA 3VAWA 2XP5A 4TX0A 3KAGA 4GGQA 1JNSA 2JZVA 2LKNA 5DITA 2MPHA 2ZQSA 4ODLA 1FKBA 1YW5A 2ZQTA 3NRKA 1KT0A 4DIPA 1BL4A 2LJ4A 2F2DA 3TCZA 4DRPA 3UF8A 4DRIA 4DRQA 4U84A 1NMVA 2RUQA 2MLZA 2UZ5A 1PBKA 1Q6IA 5GPGA 1FKSA 3O5MA 4ODQA 1HXVA 2VN1A 5D75A 3KAIA 4DRMA 2FAPA 4LAXA 3B7XA 4ODRA 3WH0A 2ZR5A 4DRKA 1FKGA 4LAYA 4ODPA 2Q5AA 3EY6A 4ODOA 1U79A 4TW7A 3UQAA 2KI3A 1N1AA 4DZ3A 3TC5A 4MSPA 3O5FA 2ZQVA 1D7JA 2LPVA 4QT2A 4DH0A 2DG4A 4O2TA 1TCOC 3NTPA 1FKHA 2RUDA 1D7IA 1FKDA 2PBCA 4DT4A 5J6EA 1ZK6A 2MF9A 2ITKA 2KE0A 4NNRA 4U86A 3UI4A 4GIVA 5HKGA 2XP8A 2ZQUA 4JFJA 5HT1A 2XPBA 3IK8A 2ZR6A 3RFWA 2M2AA 3TDBA 1Q6HA 1QZ2A 5HWCA 3FAPA 2XPAA 3ODKA 4FN2A 1FKFA 2MNTA 2MLXA 2XP4A 4DRHA 3UI6A 1F40A 2IF4A 1Y0OA 2N87A 3PA7A 2KR7A 4G50A 1YATA 4FAPA 2PPPA 4JFKA 3KZ7A 4MGVA 5DIUA 3O5EA 4G2PA 4JFLA 3UI5A 4DROA 5HTGA 3KADA 3O5OA 5HW6A
chains in the Genus database with same CATH superfamily
1ROUA 2RUCA 3B9DA 2FKEA 1D7HA 2PPOA 4TW8A 2D9FA 3ARPA 1E6NA 1B6CA 4WKHA 3CGNA 3LUOA 1IX5A 1FKRA 4ODMA 1E6ZA 3I6CA 2DT0A 2DSZA 4ZPWR 3AS0A 4ZS6A 2YBUA 1Q6UA 1F8AB 4DWSD 1FAPA 3AS3A 3KACA 4WKFA 1UR9A 5HW7A 4NZCA 3O5DA 1EHNA 1W26A 3O5RA 1FFRA 4WJXA 4DRQA 2M08A 1P5QA 1FKTA 3IKDA 1ITXA 3RGCA 3B8SA 1H0GA 2DT3A 2PV1A 1J4RA 4P8UA 3WL0A 1E6PA 1FKIA 3QOKA 4BF8A 1EQ3A 3IKGA 3ARVA 3KAGA 3ARUA 2JZVA 1YW5A 2ZQTA 1NWTA 4DIPA 1W9VA 1W1PA 3TCZA 2A3BA 1NMVA 2WK2A 2MLZA 2VN1A 4DRMA 3ARTA 1ZBKA 3ALGA 5GPRA 2ZR5A 4DRKA 4Z2KA 4LAYA 4ODPA 4R5EA 1WB0A 3WD3A 1U79A 1HJWA 3BMBA 4L3NA 4ZPVR 1D7JA 4DH0A 2DG4A 1FKHA 2RUDA 4HBEA 3B9EA 4NSBA 1SYTA 1OWQA 1TFVA 5DEZA 2KE0A 3UI4A 4GIVA 1E15A 2XP8A 3IK8A 2ESCA 2ZR6A 1GRJA 1OGBA 5HWCA 3FAPA 4FN2A 2O9OA 3UI6A 4IT6A 2N87A 1VF8A 2DT1A 2P4VA 2PPPA 5HTGA 4S3KA 1LL7A 1W1TA 2VCDA 4TNSA 2XP9A 4Z2GA 1J6YA 4TW6A 2MLYA 4TYOA 4Z2HA 3WKZA 1CTNA 3JYMA 4IPXA 3G6MA 5HUAA 3CHDA 2XP7A 4AY1A 3WD4A 3KAFA 4HBOA 4IQCA 4R0XA 2DSWA 4KQZA 1H0IA 3GPKA 2DT2A 3O5PA 3GTYX 2Y78A 1PINA 2ZR4A 1EYMA 4PTMA 3EIPA 2YBTA 2RSEA 1XHGA 4HARA 3ARQA 1JNDA 1K9TA 4ODNA 4L72B 4WKAA 1KFWA 1NMWA 4W9QA 1KT1A 3H9RB 1HKJA 4DZ2A 1L1PA 1J4HA 4ODKA 3KAHA 4W9PA 4DRJA 2OLHA 1D6OA 3AS1A 1T11A 4QT3A 4P8XA 5HBFA 1HKIA 4MNJA 1JVWA 1J4IA 1X6NA 3JYJA 1M5YA 1ROTA 1SR0A 2PPNA 4JFMA 1QPLA 1LJYA 4JYSA 2F4EA 1NH6A 4TX0A 4GGQA 2MPHA 4ODLA 1KT0A 4Q7NA 4MNKA 2LJ4A 3RM9A 4U84A 5GPGA 1JCHB 1FKSA 3O5MA 3B9AA 3B7XA 4S3JA 2Q5AA 3UQAA 4P8WA 3TC5A 4MSPA 3O5FA 2ETNA 3CHCA 4QT2A 3ARXA 1TCOC 1D7IA 2PBCA 4DT4A 1LG2A 5JH8A 2ZQUA 2DSUA 4QZVB 3GU0A 1LQ0A 2XPBA 4Q22A 3RFWA 4Z2IA 3TDBA 3ODKA 2MNTA 1YATA 3PR9A 4JFKA 1EDQA 3O5EA 1GUVA 3O5OA 5HW6A 5DO2A 5HWBA 2XP6A 5DF0A 3ARZA 4WIWA 3FXYA 3PRDA 3KABA 4MTVA 4IT4A 4JFIA 3AS2A 3O5LA 1ZBVA 3G6LA 2DPEA 1EIBA 2XP3A 3NI6A 4URIA 2RURA 3O5QA 4MPKA 2L2SA 4LGXA 2EULA 1Q1CA 3WQWA 4MNMA 5DIVA 4Z2LA 1ZBCA 3RMEA 2K8IA 1FD9A 1JNTA 2M1IA 5DITA 2KO7A 3BXWA 3ARYA 4IQ2A 1HJXA 3O5GA 2RQSA 3UQBA 4ITZA 1LG1A 3UQIA 1A7XA 1ZL1A 2F21A 2WLYA 3CGMA 4LAVA 1JNEA 2QF8A 3O5KA 3VAWA 1FFQA 4WK9A 1JNSA 3ALFA 2LKNA 4ML4A 2ZQSA 1HKMA 1HKKA 1O6IA 1FKBA 3NRKA 1BL4A 4DRPA 4DRIA 2RUQA 4ZPTR 3RM8A 2F23A 1Q6IA 4ODQA 5D75A 3KAIA 3EY6A 4TW7A 3PRAA 2WLZA 4MAVA 4DZ3A 4DWSB 1RD6A 2ZQVA 2LPVA 4O2TA 1NWUA 1WNOA 1ZB5A 1ZK6A 4KR0B 4P8VA 2ITKA 4NNRA 4U86A 5HT1A 3CH9A 1NWSA 1E6RA 2M2AA 1Q6HA 2G41A 3WIJA 2XPAA 1FKFA 1OGGA 4DRHA 3CHFA 3FY1A 2PN0A 2KR7A 4FAPA 3UI5A 4G2PA 3WQVA 4DROA 1FKLA 1ZU8A 3MDYB 5BXJA 1C9HA 2AWGA 4XAKA 2O92A 3O5JA 5HW8A 3ARSA 1BKFA 2LGOA 2A3CA 3RM4A 5B8IC 1E9LA 4QIBA 3WD1A 1W9UA 1FJDA 1NSGA 1W9PA 2DG9A 5I98A 1D2KA 2DG3A 4MNLA 4U85A 1NWRA 4DRNA 2A3EA 2AOSA 3IHZA 1W1YA 4C02B 4N19A 3WL1A 3KCEA 3O5IA 1GOIA 3PRBA 3JXVA 1ZCNA 3ARRA 4W9OA 1QPFA 1R9HA 1FKJA 2B31A 1FKKA 4LAWA 4UDMA 2PV2A 2KGJA 2DSVA 4DWSC 1E44A 1W1VA 4J4OA 1LL4A 3OOBA 2PV3A 2KFWA 2OFNA 4J4NA 2XP5A 2G8ZA 3ARWA 2F2DA 3UF8A 2UZ5A 1WAWA 1PBKA 1HXVA 2FAPA 1UR8A 4LAXA 1XRVA 4ODRA 3WH0A 1FKGA 4ODOA 2KI3A 1N1AA 3W4RA 3NTPA 1LL6A 5GQBA 3WD2A 2FDMA 1FKDA 2A3AA 2WM0A 5J6EA 3OA5A 2IUZA 2B5UB 2MF9A 5HKGA 4JFJA 1ZBWA 3AQUA 1QZ2A 2MLXA 3CZ8A 2XP4A 4Z2JA 1GPFA 1X6LA 4W5UA 2IF4A 1Y0OA 1F40A 3PA7A 4G50A 3AROA 1HJVA 3WD0A 4DWSA 2PI6A 3KZ7A 4MGVA 5DIUA 4JFLA 3CHEA 3KADA
chains in the Genus database with same CATH topology
1ROUA 2RUCA 3B9DA 2FKEA 1D7HA 2PPOA 4TW8A 2D9FA 3ARPA 1E6NA 1B6CA 4WKHA 3CGNA 3LUOA 1IX5A 1FKRA 4ODMA 1E6ZA 3I6CA 2DT0A 2DSZA 4ZPWR 3AS0A 4ZS6A 2YBUA 1Q6UA 1F8AB 4DWSD 1FAPA 3AS3A 3KACA 4WKFA 1UR9A 5HW7A 4NZCA 3O5DA 1EHNA 1W26A 3O5RA 1FFRA 4WJXA 4DRQA 2M08A 1P5QA 1FKTA 3IKDA 1ITXA 3RGCA 1H0GA 2DT3A 3B8SA 2PV1A 1J4RA 4P8UA 3WL0A 1E6PA 1FKIA 3QOKA 4BF8A 1EQ3A 3IKGA 3ARVA 3KAGA 3ARUA 2JZVA 1YW5A 2ZQTA 1NWTA 4DIPA 1W9VA 1W1PA 3TCZA 2A3BA 1NMVA 2WK2A 2MLZA 2VN1A 4DRMA 3ARTA 1ZBKA 3ALGA 5GPRA 2ZR5A 4DRKA 4Z2KA 4LAYA 4ODPA 4R5EA 1WB0A 3WD3A 1U79A 1HJWA 4L3NA 4ZPVR 1D7JA 4DH0A 2DG4A 1FKHA 2RUDA 4HBEA 3B9EA 4NSBA 1SYTA 1OWQA 1TFVA 5DEZA 2KE0A 3UI4A 4GIVA 1E15A 2XP8A 3IK8A 2ESCA 2ZR6A 1OGBA 5HWCA 3FAPA 4FN2A 2O9OA 3UI6A 4IT6A 2N87A 1VF8A 2DT1A 2PPPA 5HTGA 4S3KA 1LL7A 1W1TA 2VCDA 4TNSA 2XP9A 4Z2GA 1J6YA 4TW6A 2MLYA 4TYOA 4Z2HA 3WKZA 1CTNA 3JYMA 4IPXA 3G6MA 5HUAA 3CHDA 2XP7A 4AY1A 3WD4A 3KAFA 4HBOA 4IQCA 4R0XA 2DSWA 4KQZA 1H0IA 3GPKA 2DT2A 3O5PA 2Y78A 1PINA 2ZR4A 1EYMA 4PTMA 2YBTA 2RSEA 1XHGA 4HARA 3ARQA 1JNDA 1K9TA 4ODNA 4L72B 4WKAA 1KFWA 1NMWA 4W9QA 1KT1A 3H9RB 1HKJA 4DZ2A 1L1PA 1J4HA 4ODKA 3KAHA 4W9PA 4DRJA 2OLHA 1D6OA 3AS1A 1T11A 4QT3A 4P8XA 5HBFA 1HKIA 4MNJA 1JVWA 1J4IA 1X6NA 3JYJA 1M5YA 1ROTA 1SR0A 2PPNA 4JFMA 1QPLA 1LJYA 4JYSA 2F4EA 1NH6A 4TX0A 4GGQA 2MPHA 4ODLA 1KT0A 4Q7NA 4MNKA 2LJ4A 3RM9A 4U84A 5GPGA 1FKSA 3O5MA 3B9AA 3B7XA 4S3JA 2Q5AA 3UQAA 4P8WA 3TC5A 4MSPA 3O5FA 3CHCA 4QT2A 3ARXA 1TCOC 1D7IA 2PBCA 4DT4A 1LG2A 5JH8A 2ZQUA 2DSUA 4QZVB 4Q22A 1LQ0A 2XPBA 4Z2IA 3RFWA 3TDBA 3ODKA 2MNTA 1YATA 3PR9A 4JFKA 1EDQA 3O5EA 1GUVA 3O5OA 5HW6A 5DO2A 5HWBA 2XP6A 5DF0A 3ARZA 4WIWA 3FXYA 3PRDA 3KABA 4MTVA 4IT4A 4JFIA 3AS2A 3O5LA 1ZBVA 3G6LA 2DPEA 1EIBA 2XP3A 3NI6A 4URIA 2RURA 3O5QA 4MPKA 2L2SA 4LGXA 1Q1CA 3WQWA 4MNMA 5DIVA 4Z2LA 1ZBCA 3RMEA 2K8IA 1FD9A 1JNTA 2M1IA 5DITA 2KO7A 3BXWA 3ARYA 4IQ2A 1HJXA 3O5GA 2RQSA 3UQBA 4ITZA 1LG1A 3UQIA 1A7XA 1ZL1A 2F21A 2WLYA 3CGMA 4LAVA 1JNEA 2QF8A 3O5KA 3VAWA 1FFQA 4WK9A 1JNSA 3ALFA 2LKNA 4ML4A 2ZQSA 1HKMA 1HKKA 1O6IA 1FKBA 3NRKA 1BL4A 4DRPA 4DRIA 2RUQA 4ZPTR 3RM8A 1Q6IA 4ODQA 5D75A 3KAIA 3EY6A 4TW7A 3PRAA 2WLZA 4MAVA 4DZ3A 4DWSB 1RD6A 2ZQVA 2LPVA 4O2TA 1NWUA 1WNOA 1ZB5A 1ZK6A 4KR0B 4P8VA 2ITKA 4NNRA 4U86A 5HT1A 3CH9A 1NWSA 1E6RA 2M2AA 1Q6HA 2G41A 3WIJA 2XPAA 1FKFA 1OGGA 4DRHA 3CHFA 3FY1A 2KR7A 4FAPA 3UI5A 4G2PA 3WQVA 4DROA 1FKLA 1ZU8A 3MDYB 5BXJA 1C9HA 2AWGA 4XAKA 2O92A 3O5JA 5HW8A 3ARSA 1BKFA 2LGOA 2A3CA 3RM4A 5B8IC 1E9LA 4QIBA 3WD1A 1W9UA 1FJDA 1NSGA 1W9PA 2DG9A 5I98A 1D2KA 2DG3A 4MNLA 4U85A 1NWRA 4DRNA 2A3EA 2AOSA 3IHZA 1W1YA 4C02B 4N19A 3WL1A 3KCEA 3O5IA 1GOIA 3PRBA 3JXVA 1ZCNA 3ARRA 4W9OA 1QPFA 1R9HA 1FKJA 2B31A 1FKKA 4LAWA 2PV2A 2KGJA 2DSVA 4DWSC 1W1VA 4J4OA 1LL4A 3OOBA 2PV3A 2KFWA 2OFNA 4J4NA 2XP5A 2G8ZA 3ARWA 2F2DA 3UF8A 2UZ5A 1WAWA 1PBKA 1HXVA 2FAPA 1UR8A 4LAXA 1XRVA 4ODRA 3WH0A 1FKGA 4ODOA 2KI3A 1N1AA 3W4RA 3NTPA 1LL6A 5GQBA 3WD2A 2FDMA 1FKDA 2A3AA 2WM0A 5J6EA 3OA5A 2IUZA 2MF9A 5HKGA 4JFJA 1ZBWA 3AQUA 1QZ2A 2MLXA 3CZ8A 2XP4A 4Z2JA 1GPFA 1X6LA 4W5UA 2IF4A 1Y0OA 1F40A 3PA7A 4G50A 3AROA 1HJVA 3WD0A 4DWSA 2PI6A 3KZ7A 4MGVA 5DIUA 4JFLA 3CHEA 3KADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKL A;  1ROU A;  2RUC A;  2VCD A;  2XP9 A;  2XP6 A;  4TNS A;  5HWB A;  3MDY B;  1J6Y A;  4TW6 A;  5BXJ A;  2FKE A;  1D7H A;  1C9H A;  2MLY A;  2PPO A;  4TW8 A;  4TYO A;  2AWG A;  2D9F A;  3O5J A;  3JYM A;  5HW8 A;  4IPX A;  1B6C A;  1BKF A;  5HUA A;  3CGN A;  3LUO A;  1FKR A;  2XP7 A;  3PRD A;  2LGO A;  3KAB A;  4ODM A;  3KAF A;  4IQC A;  4R0X A;  5B8I C;  4QIB A;  3I6C A;  4JFI A;  3O5L A;  3GPK A;  1FJD A;  1Q6U A;  1F8A B;  3O5P A;  2Y78 A;  1NSG A;  1PIN A;  2DG9 A;  1EYM A;  2XP3 A;  2DG3 A;  2ZR4 A;  3NI6 A;  5I98 A;  2RUR A;  3O5Q A;  4U85 A;  2RSE A;  2L2S A;  1FAP A;  4DRN A;  3KAC A;  1Q1C A;  5HW7 A;  3IHZ A;  4ODN A;  5DIV A;  4C02 B;  4N19 A;  3O5D A;  1W26 A;  3KCE A;  3O5R A;  3O5I A;  3PRB A;  3JXV A;  1ZCN A;  4W9O A;  2K8I A;  1FD9 A;  1JNT A;  1QPF A;  1NMW A;  1FKJ A;  1KT1 A;  1R9H A;  2M08 A;  2M1I A;  3H9R B;  1P5Q A;  4W9Q A;  4DZ2 A;  1J4H A;  1FKT A;  2KO7 A;  4ODK A;  1L1P A;  1FKK A;  3IKD A;  3KAH A;  4W9P A;  4IQ2 A;  4LAW A;  4DRJ A;  3O5G A;  2RQS A;  3UQB A;  4ITZ A;  2PV2 A;  3UQI A;  1D6O A;  1T11 A;  4QT3 A;  1A7X A;  2KGJ A;  3RGC A;  1JVW A;  1J4I A;  2F21 A;  2PV1 A;  3JYJ A;  3CGM A;  1J4R A;  4J4O A;  3OOB A;  1M5Y A;  2PV3 A;  1ROT A;  4LAV A;  2PPN A;  4JFM A;  1QPL A;  1FKI A;  4JYS A;  2KFW A;  2OFN A;  4J4N A;  4BF8 A;  1EQ3 A;  3IKG A;  2F4E A;  3O5K A;  3VAW A;  2XP5 A;  4TX0 A;  3KAG A;  4GGQ A;  1JNS A;  2JZV A;  2LKN A;  5DIT A;  2MPH A;  2ZQS A;  4ODL A;  1FKB A;  1YW5 A;  2ZQT A;  3NRK A;  1KT0 A;  4DIP A;  1BL4 A;  2LJ4 A;  2F2D A;  3TCZ A;  4DRP A;  3UF8 A;  4DRI A;  4DRQ A;  4U84 A;  1NMV A;  2RUQ A;  2MLZ A;  2UZ5 A;  1PBK A;  1Q6I A;  5GPG A;  1FKS A;  3O5M A;  4ODQ A;  1HXV A;  2VN1 A;  5D75 A;  3KAI A;  4DRM A;  2FAP A;  4LAX A;  3B7X A;  4ODR A;  3WH0 A;  2ZR5 A;  4DRK A;  1FKG A;  4LAY A;  4ODP A;  2Q5A A;  3EY6 A;  4ODO A;  1U79 A;  4TW7 A;  3UQA A;  2KI3 A;  1N1A A;  4DZ3 A;  3TC5 A;  4MSP A;  3O5F A;  2ZQV A;  1D7J A;  2LPV A;  4QT2 A;  4DH0 A;  2DG4 A;  4O2T A;  1TCO C;  3NTP A;  1FKH A;  2RUD A;  1D7I A;  1FKD A;  2PBC A;  4DT4 A;  5J6E A;  1ZK6 A;  2MF9 A;  2ITK A;  2KE0 A;  4NNR A;  4U86 A;  3UI4 A;  4GIV A;  5HKG A;  2XP8 A;  2ZQU A;  4JFJ A;  5HT1 A;  2XPB A;  3IK8 A;  2ZR6 A;  3RFW A;  2M2A A;  3TDB A;  1Q6H A;  1QZ2 A;  5HWC A;  3FAP A;  2XPA A;  3ODK A;  4FN2 A;  1FKF A;  2MNT A;  2MLX A;  2XP4 A;  4DRH A;  3UI6 A;  1F40 A;  2IF4 A;  1Y0O A;  2N87 A;  3PA7 A;  2KR7 A;  4G50 A;  1YAT A;  4FAP A;  2PPP A;  4JFK A;  3KZ7 A;  4MGV A;  5DIU A;  3O5E A;  4G2P A;  4JFL A;  3UI5 A;  4DRO A;  5HTG A;  3KAD A;  3O5O A;  5HW6 A; 
#chains in the Genus database with same CATH topology
 1ROU A;  2RUC A;  3B9D A;  2FKE A;  1D7H A;  2PPO A;  4TW8 A;  2D9F A;  3ARP A;  1E6N A;  1B6C A;  4WKH A;  3CGN A;  3LUO A;  1IX5 A;  1FKR A;  4ODM A;  1E6Z A;  3I6C A;  2DT0 A;  2DSZ A;  4ZPW R;  3AS0 A;  4ZS6 A;  2YBU A;  1Q6U A;  1F8A B;  4DWS D;  1FAP A;  3AS3 A;  3KAC A;  4WKF A;  1UR9 A;  5HW7 A;  4NZC A;  3O5D A;  1EHN A;  1W26 A;  3O5R A;  1FFR A;  4WJX A;  4DRQ A;  2M08 A;  1P5Q A;  1FKT A;  3IKD A;  1ITX A;  3RGC A;  3B8S A;  1H0G A;  2DT3 A;  2PV1 A;  1J4R A;  4P8U A;  3WL0 A;  1E6P A;  1FKI A;  3QOK A;  4BF8 A;  1EQ3 A;  3IKG A;  3ARV A;  3KAG A;  3ARU A;  2JZV A;  1YW5 A;  2ZQT A;  1NWT A;  4DIP A;  1W9V A;  1W1P A;  3TCZ A;  2A3B A;  1NMV A;  2WK2 A;  2MLZ A;  2VN1 A;  4DRM A;  3ART A;  1ZBK A;  3ALG A;  5GPR A;  2ZR5 A;  4DRK A;  4Z2K A;  4LAY A;  4ODP A;  4R5E A;  1WB0 A;  3WD3 A;  1U79 A;  1HJW A;  3BMB A;  4L3N A;  4ZPV R;  1D7J A;  4DH0 A;  2DG4 A;  1FKH A;  2RUD A;  4HBE A;  3B9E A;  4NSB A;  1SYT A;  1OWQ A;  1TFV A;  5DEZ A;  2KE0 A;  3UI4 A;  4GIV A;  1E15 A;  2XP8 A;  3IK8 A;  2ESC A;  2ZR6 A;  1GRJ A;  1OGB A;  5HWC A;  3FAP A;  4FN2 A;  2O9O A;  3UI6 A;  4IT6 A;  2N87 A;  1VF8 A;  2DT1 A;  2P4V A;  2PPP A;  5HTG A;  4S3K A;  1LL7 A;  1W1T A;  2VCD A;  4TNS A;  2XP9 A;  4Z2G A;  1J6Y A;  4TW6 A;  2MLY A;  4TYO A;  4Z2H A;  3WKZ A;  1CTN A;  3JYM A;  4IPX A;  3G6M A;  5HUA A;  3CHD A;  2XP7 A;  4AY1 A;  3WD4 A;  3KAF A;  4HBO A;  4IQC A;  4R0X A;  2DSW A;  4KQZ A;  1H0I A;  3GPK A;  2DT2 A;  3O5P A;  3GTY X;  2Y78 A;  1PIN A;  2ZR4 A;  1EYM A;  4PTM A;  3EIP A;  2YBT A;  2RSE A;  1XHG A;  4HAR A;  3ARQ A;  1JND A;  1K9T A;  4ODN A;  4L72 B;  4WKA A;  1KFW A;  1NMW A;  4W9Q A;  1KT1 A;  3H9R B;  1HKJ A;  4DZ2 A;  1L1P A;  1J4H A;  4ODK A;  3KAH A;  4W9P A;  4DRJ A;  2OLH A;  1D6O A;  3AS1 A;  1T11 A;  4QT3 A;  4P8X A;  5HBF A;  1HKI A;  4MNJ A;  1JVW A;  1J4I A;  1X6N A;  3JYJ A;  1M5Y A;  1ROT A;  1SR0 A;  2PPN A;  4JFM A;  1QPL A;  1LJY A;  4JYS A;  2F4E A;  1NH6 A;  4TX0 A;  4GGQ A;  2MPH A;  4ODL A;  1KT0 A;  4Q7N A;  4MNK A;  2LJ4 A;  3RM9 A;  4U84 A;  5GPG A;  1JCH B;  1FKS A;  3O5M A;  3B9A A;  3B7X A;  4S3J A;  2Q5A A;  3UQA A;  4P8W A;  3TC5 A;  4MSP A;  3O5F A;  2ETN A;  3CHC A;  4QT2 A;  3ARX A;  1TCO C;  1D7I A;  2PBC A;  4DT4 A;  1LG2 A;  5JH8 A;  2ZQU A;  2DSU A;  4QZV B;  3GU0 A;  1LQ0 A;  2XPB A;  4Q22 A;  3RFW A;  4Z2I A;  3TDB A;  3ODK A;  2MNT A;  1YAT A;  3PR9 A;  4JFK A;  1EDQ A;  3O5E A;  1GUV A;  3O5O A;  5HW6 A;  5DO2 A;  5HWB A;  2XP6 A;  5DF0 A;  3ARZ A;  4WIW A;  3FXY A;  3PRD A;  3KAB A;  4MTV A;  4IT4 A;  4JFI A;  3AS2 A;  3O5L A;  1ZBV A;  3G6L A;  2DPE A;  1EIB A;  2XP3 A;  3NI6 A;  4URI A;  2RUR A;  3O5Q A;  4MPK A;  2L2S A;  4LGX A;  2EUL A;  1Q1C A;  3WQW A;  4MNM A;  5DIV A;  4Z2L A;  1ZBC A;  3RME A;  2K8I A;  1FD9 A;  1JNT A;  2M1I A;  5DIT A;  2KO7 A;  3BXW A;  3ARY A;  4IQ2 A;  1HJX A;  3O5G A;  2RQS A;  3UQB A;  4ITZ A;  1LG1 A;  3UQI A;  1A7X A;  1ZL1 A;  2F21 A;  2WLY A;  3CGM A;  4LAV A;  1JNE A;  2QF8 A;  3O5K A;  3VAW A;  1FFQ A;  4WK9 A;  1JNS A;  3ALF A;  2LKN A;  4ML4 A;  2ZQS A;  1HKM A;  1HKK A;  1O6I A;  1FKB A;  3NRK A;  1BL4 A;  4DRP A;  4DRI A;  2RUQ A;  4ZPT R;  3RM8 A;  2F23 A;  1Q6I A;  4ODQ A;  5D75 A;  3KAI A;  3EY6 A;  4TW7 A;  3PRA A;  2WLZ A;  4MAV A;  4DZ3 A;  4DWS B;  1RD6 A;  2ZQV A;  2LPV A;  4O2T A;  1NWU A;  1WNO A;  1ZB5 A;  1ZK6 A;  4KR0 B;  4P8V A;  2ITK A;  4NNR A;  4U86 A;  5HT1 A;  3CH9 A;  1NWS A;  1E6R A;  2M2A A;  1Q6H A;  2G41 A;  3WIJ A;  2XPA A;  1FKF A;  1OGG A;  4DRH A;  3CHF A;  3FY1 A;  2PN0 A;  2KR7 A;  4FAP A;  3UI5 A;  4G2P A;  3WQV A;  4DRO A;  1FKL A;  1ZU8 A;  3MDY B;  5BXJ A;  1C9H A;  2AWG A;  4XAK A;  2O92 A;  3O5J A;  5HW8 A;  3ARS A;  1BKF A;  2LGO A;  2A3C A;  3RM4 A;  5B8I C;  1E9L A;  4QIB A;  3WD1 A;  1W9U A;  1FJD A;  1NSG A;  1W9P A;  2DG9 A;  5I98 A;  1D2K A;  2DG3 A;  4MNL A;  4U85 A;  1NWR A;  4DRN A;  2A3E A;  2AOS A;  3IHZ A;  1W1Y A;  4C02 B;  4N19 A;  3WL1 A;  3KCE A;  3O5I A;  1GOI A;  3PRB A;  3JXV A;  1ZCN A;  3ARR A;  4W9O A;  1QPF A;  1R9H A;  1FKJ A;  2B31 A;  1FKK A;  4LAW A;  4UDM A;  2PV2 A;  2KGJ A;  2DSV A;  4DWS C;  1E44 A;  1W1V A;  4J4O A;  1LL4 A;  3OOB A;  2PV3 A;  2KFW A;  2OFN A;  4J4N A;  2XP5 A;  2G8Z A;  3ARW A;  2F2D A;  3UF8 A;  2UZ5 A;  1WAW A;  1PBK A;  1HXV A;  2FAP A;  1UR8 A;  4LAX A;  1XRV A;  4ODR A;  3WH0 A;  1FKG A;  4ODO A;  2KI3 A;  1N1A A;  3W4R A;  3NTP A;  1LL6 A;  5GQB A;  3WD2 A;  2FDM A;  1FKD A;  2A3A A;  2WM0 A;  5J6E A;  3OA5 A;  2IUZ A;  2B5U B;  2MF9 A;  5HKG A;  4JFJ A;  1ZBW A;  3AQU A;  1QZ2 A;  2MLX A;  3CZ8 A;  2XP4 A;  4Z2J A;  1GPF A;  1X6L A;  4W5U A;  2IF4 A;  1Y0O A;  1F40 A;  3PA7 A;  4G50 A;  3ARO A;  1HJV A;  3WD0 A;  4DWS A;  2PI6 A;  3KZ7 A;  4MGV A;  5DIU A;  4JFL A;  3CHE A;  3KAD A; 
#chains in the Genus database with same CATH homology
 1ROU A;  2RUC A;  3B9D A;  2FKE A;  1D7H A;  2PPO A;  4TW8 A;  2D9F A;  3ARP A;  1E6N A;  1B6C A;  4WKH A;  3CGN A;  3LUO A;  1IX5 A;  1FKR A;  4ODM A;  1E6Z A;  3I6C A;  2DT0 A;  2DSZ A;  4ZPW R;  3AS0 A;  4ZS6 A;  2YBU A;  1Q6U A;  1F8A B;  4DWS D;  1FAP A;  3AS3 A;  3KAC A;  4WKF A;  1UR9 A;  5HW7 A;  4NZC A;  3O5D A;  1EHN A;  1W26 A;  3O5R A;  1FFR A;  4WJX A;  4DRQ A;  2M08 A;  1P5Q A;  1FKT A;  3IKD A;  1ITX A;  3RGC A;  1H0G A;  2DT3 A;  3B8S A;  2PV1 A;  1J4R A;  4P8U A;  3WL0 A;  1E6P A;  1FKI A;  3QOK A;  4BF8 A;  1EQ3 A;  3IKG A;  3ARV A;  3KAG A;  3ARU A;  2JZV A;  1YW5 A;  2ZQT A;  1NWT A;  4DIP A;  1W9V A;  1W1P A;  3TCZ A;  2A3B A;  1NMV A;  2WK2 A;  2MLZ A;  2VN1 A;  4DRM A;  3ART A;  1ZBK A;  3ALG A;  5GPR A;  2ZR5 A;  4DRK A;  4Z2K A;  4LAY A;  4ODP A;  4R5E A;  1WB0 A;  3WD3 A;  1U79 A;  1HJW A;  4L3N A;  4ZPV R;  1D7J A;  4DH0 A;  2DG4 A;  1FKH A;  2RUD A;  4HBE A;  3B9E A;  4NSB A;  1SYT A;  1OWQ A;  1TFV A;  5DEZ A;  2KE0 A;  3UI4 A;  4GIV A;  1E15 A;  2XP8 A;  3IK8 A;  2ESC A;  2ZR6 A;  1OGB A;  5HWC A;  3FAP A;  4FN2 A;  2O9O A;  3UI6 A;  4IT6 A;  2N87 A;  1VF8 A;  2DT1 A;  2PPP A;  5HTG A;  4S3K A;  1LL7 A;  1W1T A;  2VCD A;  4TNS A;  2XP9 A;  4Z2G A;  1J6Y A;  4TW6 A;  2MLY A;  4TYO A;  4Z2H A;  3WKZ A;  1CTN A;  3JYM A;  4IPX A;  3G6M A;  5HUA A;  3CHD A;  2XP7 A;  4AY1 A;  3WD4 A;  3KAF A;  4HBO A;  4IQC A;  4R0X A;  2DSW A;  4KQZ A;  1H0I A;  3GPK A;  2DT2 A;  3O5P A;  2Y78 A;  1PIN A;  2ZR4 A;  1EYM A;  4PTM A;  2YBT A;  2RSE A;  1XHG A;  4HAR A;  3ARQ A;  1JND A;  1K9T A;  4ODN A;  4L72 B;  4WKA A;  1KFW A;  1NMW A;  4W9Q A;  1KT1 A;  3H9R B;  1HKJ A;  4DZ2 A;  1L1P A;  1J4H A;  4ODK A;  3KAH A;  4W9P A;  4DRJ A;  2OLH A;  1D6O A;  3AS1 A;  1T11 A;  4QT3 A;  4P8X A;  5HBF A;  1HKI A;  4MNJ A;  1JVW A;  1J4I A;  1X6N A;  3JYJ A;  1M5Y A;  1ROT A;  1SR0 A;  2PPN A;  4JFM A;  1QPL A;  1LJY A;  4JYS A;  2F4E A;  1NH6 A;  4TX0 A;  4GGQ A;  2MPH A;  4ODL A;  1KT0 A;  4Q7N A;  4MNK A;  2LJ4 A;  3RM9 A;  4U84 A;  5GPG A;  1FKS A;  3O5M A;  3B9A A;  3B7X A;  4S3J A;  2Q5A A;  3UQA A;  4P8W A;  3TC5 A;  4MSP A;  3O5F A;  3CHC A;  4QT2 A;  3ARX A;  1TCO C;  1D7I A;  2PBC A;  4DT4 A;  1LG2 A;  5JH8 A;  2ZQU A;  2DSU A;  4QZV B;  4Q22 A;  1LQ0 A;  2XPB A;  4Z2I A;  3RFW A;  3TDB A;  3ODK A;  2MNT A;  1YAT A;  3PR9 A;  4JFK A;  1EDQ A;  3O5E A;  1GUV A;  3O5O A;  5HW6 A;  5DO2 A;  5HWB A;  2XP6 A;  5DF0 A;  3ARZ A;  4WIW A;  3FXY A;  3PRD A;  3KAB A;  4MTV A;  4IT4 A;  4JFI A;  3AS2 A;  3O5L A;  1ZBV A;  3G6L A;  2DPE A;  1EIB A;  2XP3 A;  3NI6 A;  4URI A;  2RUR A;  3O5Q A;  4MPK A;  2L2S A;  4LGX A;  1Q1C A;  3WQW A;  4MNM A;  5DIV A;  4Z2L A;  1ZBC A;  3RME A;  2K8I A;  1FD9 A;  1JNT A;  2M1I A;  5DIT A;  2KO7 A;  3BXW A;  3ARY A;  4IQ2 A;  1HJX A;  3O5G A;  2RQS A;  3UQB A;  4ITZ A;  1LG1 A;  3UQI A;  1A7X A;  1ZL1 A;  2F21 A;  2WLY A;  3CGM A;  4LAV A;  1JNE A;  2QF8 A;  3O5K A;  3VAW A;  1FFQ A;  4WK9 A;  1JNS A;  3ALF A;  2LKN A;  4ML4 A;  2ZQS A;  1HKM A;  1HKK A;  1O6I A;  1FKB A;  3NRK A;  1BL4 A;  4DRP A;  4DRI A;  2RUQ A;  4ZPT R;  3RM8 A;  1Q6I A;  4ODQ A;  5D75 A;  3KAI A;  3EY6 A;  4TW7 A;  3PRA A;  2WLZ A;  4MAV A;  4DZ3 A;  4DWS B;  1RD6 A;  2ZQV A;  2LPV A;  4O2T A;  1NWU A;  1WNO A;  1ZB5 A;  1ZK6 A;  4KR0 B;  4P8V A;  2ITK A;  4NNR A;  4U86 A;  5HT1 A;  3CH9 A;  1NWS A;  1E6R A;  2M2A A;  1Q6H A;  2G41 A;  3WIJ A;  2XPA A;  1FKF A;  1OGG A;  4DRH A;  3CHF A;  3FY1 A;  2KR7 A;  4FAP A;  3UI5 A;  4G2P A;  3WQV A;  4DRO A;  1FKL A;  1ZU8 A;  3MDY B;  5BXJ A;  1C9H A;  2AWG A;  4XAK A;  2O92 A;  3O5J A;  5HW8 A;  3ARS A;  1BKF A;  2LGO A;  2A3C A;  3RM4 A;  5B8I C;  1E9L A;  4QIB A;  3WD1 A;  1W9U A;  1FJD A;  1NSG A;  1W9P A;  2DG9 A;  5I98 A;  1D2K A;  2DG3 A;  4MNL A;  4U85 A;  1NWR A;  4DRN A;  2A3E A;  2AOS A;  3IHZ A;  1W1Y A;  4C02 B;  4N19 A;  3WL1 A;  3KCE A;  3O5I A;  1GOI A;  3PRB A;  3JXV A;  1ZCN A;  3ARR A;  4W9O A;  1QPF A;  1R9H A;  1FKJ A;  2B31 A;  1FKK A;  4LAW A;  2PV2 A;  2KGJ A;  2DSV A;  4DWS C;  1W1V A;  4J4O A;  1LL4 A;  3OOB A;  2PV3 A;  2KFW A;  2OFN A;  4J4N A;  2XP5 A;  2G8Z A;  3ARW A;  2F2D A;  3UF8 A;  2UZ5 A;  1WAW A;  1PBK A;  1HXV A;  2FAP A;  1UR8 A;  4LAX A;  1XRV A;  4ODR A;  3WH0 A;  1FKG A;  4ODO A;  2KI3 A;  1N1A A;  3W4R A;  3NTP A;  1LL6 A;  5GQB A;  3WD2 A;  2FDM A;  1FKD A;  2A3A A;  2WM0 A;  5J6E A;  3OA5 A;  2IUZ A;  2MF9 A;  5HKG A;  4JFJ A;  1ZBW A;  3AQU A;  1QZ2 A;  2MLX A;  3CZ8 A;  2XP4 A;  4Z2J A;  1GPF A;  1X6L A;  4W5U A;  2IF4 A;  1Y0O A;  1F40 A;  3PA7 A;  4G50 A;  3ARO A;  1HJV A;  3WD0 A;  4DWS A;  2PI6 A;  3KZ7 A;  4MGV A;  5DIU A;  4JFL A;  3CHE A;  3KAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...