4ODPA

Structure of slyd delta-if from thermus thermophilus in complex with s2-w23a peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
101
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase, chaperone
molecule keywords Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl ci
total genus 23
structure length 101
sequence length 110
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4odpA00
5HUAA 4JFKA 4TW6A 3TCZA 4G2PA 1F40A 3TC5A 2MLZA 1ZK6A 4ODMA 3LUOA 4G50A 4C02B 4DT4A 1FKJA 2RUQA 2LGOA 2LJ4A 3PRDA 3KAIA 2Y78A 1Q6IA 2XP4A 2DG3A 2M08A 4GIVA 4ITZA 3PA7A 2K8IA 1W26A 3KAFA 3KAGA 4LAYA 1M5YA 4ODQA 3UQBA 3MDYB 3FAPA 2XP7A 4IQCA 4IPXA 3RFWA 3O5FA 1FKGA 2JZVA 2XP5A 3O5RA 4W9PA 3VAWA 4N19A 1KT0A 3IK8A 4U84A 4DRHA 1J4IA 3B7XA 4O2TA 2MLXA 2PPNA 4JYSA 4TW8A 3KZ7A 5GPGA 3H9RB 3PRBA 4J4NA 2ZR4A 3TDBA 3UF8A 1NMWA 2KO7A 1FJDA 2XPAA 3CGMA 1FD9A 2XP6A 5HKGA 2XPBA 1PINA 3CGNA 4ODRA 1BKFA 1EYMA 1ZCNA 2RQSA 2FKEA 1F8AB 4DIPA 2UZ5A 1YW5A 2RURA 3O5QA 2MLYA 1EQ3A 2OFNA 3KCEA 3UQIA 2ITKA 1NSGA 2PV1A 2RSEA 4TX0A 2L2SA 4QIBA 1T11A 4JFMA 3O5IA 1FKBA 5DITA 2D9FA 2MNTA 4DRJA 1U79A 2KI3A 2PPPA 4DZ2A 4MSPA 1P5QA 4DRPA 1J4HA 5HT1A 5HWCA 4ODPA 2LKNA 5HTGA 3NRKA 2XP3A 1YATA 1Q6UA 3KABA 4DRMA 1ROTA 2M2AA 2ZQUA 1BL4A 2F2DA 1FKKA 2ZR6A 3ODKA 3EY6A 4LAVA 2F4EA 4ODNA 3UI4A 5HW8A 5DIVA 1D7JA 1TCOC 2RUDA 4DRQA 1ROUA 3O5PA 5J6EA 5HWBA 1L1PA 2IF4A 1JNSA 1FAPA 3O5JA 4TNSA 1HXVA 1KT1A 1FKTA 4U86A 1JNTA 4IQ2A 1N1AA 3O5GA 2PV2A 5DIUA 2N87A 1NMVA 1J6YA 4JFIA 1FKIA 3NTPA 1PBKA 2XP8A 2VCDA 1FKHA 4DRKA 2FAPA 1QZ2A 2PPOA 2ZQVA 3KAHA 4MGVA 2KR7A 1D7IA 1B6CA 2MF9A 2ZR5A 3I6CA 4FN2A 4ODOA 3RGCA 4DH0A 1D7HA 1D6OA 2DG4A 3O5DA 4J4OA 3OOBA 1QPLA 4DRNA 3JYMA 2XP9A 2ZQSA 1R9HA 3GPKA 3IKDA 1QPFA 2MPHA 4TYOA 4JFJA 5D75A 4BF8A 4DROA 3UQAA 1C9HA 5B8IC 4JFLA 2F21A 4QT3A 4ODKA 3UI5A 3O5KA 3NI6A 4NNRA 4QT2A 2RUCA 4W9OA 4DRIA 5HW7A 2KFWA 3WH0A 3O5LA 3UI6A 3IHZA 2LPVA 2KE0A 5BXJA 1J4RA 1FKDA 2VN1A 1Q1CA 1FKSA 3KADA 5HW6A 2Q5AA 4W9QA 1Y0OA 2M1IA 1JVWA 3JXVA 3O5EA 3O5MA 3O5OA 4LAXA 2PV3A 3KACA 2DG9A 4U85A 1Q6HA 2PBCA 4GGQA 5I98A 2ZQTA 1FKFA 4R0XA 1FKRA 3JYJA 3IKGA 2AWGA 2KGJA 4TW7A 4FAPA 4LAWA 1FKLA 4ODLA 4DZ3A 1A7XA
chains in the Genus database with same CATH superfamily
1EDQA 1WNOA 4JFKA 4P8WA 1ZBCA 1GOIA 3TCZA 3TC5A 3ARWA 1ZK6A 4DT4A 5HBFA 3KAIA 2XP4A 2DG3A 1E15A 2XP7A 4IPXA 1FKGA 2JZVA 4W9PA 4N19A 1W1VA 1HKIA 4DRHA 4O2TA 2DSUA 1JNEA 2A3AA 5GPGA 3H9RB 4J4NA 3UF8A 1EHNA 3WQWA 1VF8A 4Z2GA 3CGNA 1ZCNA 1EYMA 2UZ5A 4WKAA 4MNJA 3B9DA 3AS2A 1FKBA 4Z2JA 4DZ2A 2PPPA 3AS3A 4MSPA 3WD4A 4DRPA 5DF0A 1J4HA 4ODPA 5HTGA 1LL6A 3NRKA 2XP3A 3ODKA 1FKKA 4ODNA 1TCOC 4HARA 1HXVA 4WJXA 1SYTA 1J6YA 1H0GA 2XP8A 2G41A 4DRKA 2FAPA 2PPOA 2DT0A 3KAHA 4MTVA 3O5DA 1E6RA 1QPLA 1W9UA 2XP9A 1R9HA 3GU0A 4DROA 1E6NA 5B8IC 3FXYA 4JFLA 1FFRA 2DPEA 2B5UB 2IUZA 4DRIA 4NNRA 4W9OA 1XRVA 2RUCA 3AS0A 3WH0A 4ZS6A 2LPVA 2VN1A 3ARUA 5HW6A 3ARVA 4W9QA 1Y0OA 1JVWA 3JXVA 4Q7NA 4U85A 1W9VA 1Q6HA 2PBCA 3EIPA 2KGJA 4TW7A 2QF8A 3ARRA 1F40A 1RD6A 2EULA 3BMBA 1GPFA 3LUOA 4G50A 2RUQA 2LGOA 2LJ4A 1ZB5A 4IT4A 4ML4A 2M08A 3KAFA 3KAGA 4ODQA 3MDYB 3VAWA 3B7XA 4IT6A 3RMEA 2MLXA 3B9AA 4KQZA 3WL1A 3ALFA 1SR0A 4MNLA 1HJXA 3QOKA 3UQIA 4DIPA 3WD3A 2RQSA 5DEZA 1F8AB 1YW5A 2RURA 2MLYA 1EQ3A 1ZBVA 1LL7A 1NSGA 4TX0A 5DO2A 3B8SA 2MNTA 4MPKA 1P5QA 4UDMA 1Q6UA 3KABA 4DRMA 1BL4A 1E44A 1UR8A 2F4EA 3ARXA 4P8UA 1ROUA 1L1PA 5JH8A 2IF4A 1JNSA 3CH9A 2WLZA 3O5JA 3G6LA 1LG2A 2G8ZA 5GQBA 4U86A 4QZVB 2N87A 3G6MA 4JFIA 1FKIA 1PBKA 1QZ2A 2MF9A 4DRNA 1OWQA 4L72B 3GPKA 3IKDA 4TYOA 4DWSA 4S3KA 2O92A 1C9HA 4Z2LA 4Z2HA 3O5KA 4QT2A 1O6IA 2KFWA 3O5LA 3UI6A 3IHZA 2KE0A 1FKSA 1GUVA 3OA5A 1HKMA 2Q5AA 4LAXA 2DG9A 1W1TA 4WK9A 5I98A 4R0XA 1GRJA 1FKRA 4LAWA 1LQ0A 1FKLA 3TDBA 2DSZA 2F23A 5HUAA 1ZU8A 4MNKA 4TW6A 4G2PA 4DWSD 3CHFA 4C02B 1NWTA 1FKJA 1ZBWA 3WIJA 4GIVA 1M5YA 4MAVA 3FAPA 4IQCA 3RFWA 3RM8A 1HKJA 2OLHA 1J4IA 4JYSA 3KZ7A 2ZR4A 1FJDA 2KO7A 4ODRA 1EIBA 3AQUA 1LG1A 1XHGA 2OFNA 3KCEA 2ESCA 1FFQA 1LL4A 2ITKA 4JFMA 2AOSA 3WL0A 2D9FA 4DRJA 2KI3A 1OGBA 3CZ8A 3W4RA 1JCHB 5HT1A 5HWCA 3B9EA 1ROTA 2M2AA 3UI4A 2ZR6A 4LAVA 3EY6A 5DIVA 1D7JA 4AY1A 4DRQA 5HWBA 1WB0A 2A3CA 4S3JA 1HJVA 2A3BA 4WKFA 3WD2A 4ZPWR 3O5GA 2ETNA 2PV2A 1NMVA 3NTPA 3ARZA 1OGGA 4W5UA 2VCDA 2ZQVA 4MGVA 2KR7A 1B6CA 4PTMA 4FN2A 3WD1A 4ODOA 1WAWA 4DH0A 1D6OA 4J4OA 2DT3A 3JYMA 2ZQSA 1QPFA 2MPHA 4BF8A 4JFJA 5D75A 2O9OA 2DT2A 2F21A 3NI6A 1ITXA 5HW7A 1UR9A 5BXJA 1J4RA 3KADA 1FKDA 2PN0A 1Q1CA 3ALGA 4KR0B 2WK2A 1ZBKA 2M1IA 3O5EA 3O5MA 3O5OA 2FDMA 1HJWA 4GGQA 2B31A 2DSWA 3JYJA 3IKGA 3WD0A 4FAPA 4DWSB 2XPAA 2YBTA 4DZ3A 1E6PA 1A7XA 1X6NA 4P8XA 2MLZA 4ODMA 4HBOA 2DT1A 1W1PA 3PRDA 2Y78A 1Q6IA 4ITZA 1HKKA 3PA7A 2K8IA 1W26A 4Z2KA 4LAYA 4WKHA 3O5FA 1NH6A 2XP5A 3O5RA 1IX5A 1KT0A 1KFWA 3IK8A 4U84A 2PPNA 1W9PA 4TW8A 2WM0A 3PRBA 3CHEA 2DSVA 3AROA 1NMWA 5GPRA 3GTYX 3CGMA 1FD9A 2XP6A 1NWRA 5HKGA 3WQVA 2XPBA 1PINA 1BKFA 4NSBA 4P8VA 2FKEA 3O5QA 3CHCA 1NWSA 4L3NA 3WKZA 4XAKA 3CHDA 4HBEA 2PV1A 2P4VA 2RSEA 1E9LA 2L2SA 4DWSC 3AS1A 1T11A 4QIBA 3O5IA 5DITA 1U79A 2PI6A 1ZL1A 1H0IA 4URIA 2LKNA 4Q22A 3ARPA 1YATA 2ZQUA 2F2DA 5HW8A 2RUDA 3O5PA 5J6EA 1TFVA 4WIWA 1FAPA 4TNSA 4Z2IA 1KT1A 1FKTA 4LGXA 4ZPVR 2WLYA 1D2KA 3BXWA 1K9TA 3RM4A 1JNTA 2A3EA 4IQ2A 1N1AA 5DIUA 1LJYA 4MNMA 1FKHA 3ARSA 4R5EA 1D7IA 3RGCA 2ZR5A 3ARQA 3ARTA 3I6CA 3UQBA 1D7HA 1X6LA 2DG4A 3ARYA 3OOBA 3RM9A 1W1YA 3UQAA 4QT3A 1JNDA 4ODKA 3UI5A 1E6ZA 1CTNA 2YBUA 4NZCA 3FY1A 3PR9A 1NWUA 2PV3A 3KACA 3PRAA 2ZQTA 1FKFA 2AWGA 4ZPTR 4ODLA
chains in the Genus database with same CATH topology
1EDQA 1WNOA 4JFKA 4P8WA 1ZBCA 1GOIA 3TCZA 3TC5A 3ARWA 1ZK6A 4DT4A 5HBFA 3KAIA 2XP4A 2DG3A 1E15A 2XP7A 4IPXA 1FKGA 2JZVA 4W9PA 4N19A 1W1VA 1HKIA 4DRHA 4O2TA 2DSUA 1JNEA 2A3AA 5GPGA 3H9RB 4J4NA 3UF8A 1EHNA 3WQWA 1VF8A 4Z2GA 3CGNA 1ZCNA 1EYMA 2UZ5A 4WKAA 4MNJA 3B9DA 3AS2A 1FKBA 4Z2JA 4DZ2A 2PPPA 3AS3A 4MSPA 3WD4A 4DRPA 5DF0A 1J4HA 4ODPA 5HTGA 1LL6A 3NRKA 2XP3A 3ODKA 1FKKA 4ODNA 1TCOC 4HARA 1HXVA 4WJXA 1SYTA 1J6YA 1H0GA 2XP8A 2G41A 4DRKA 2FAPA 2PPOA 2DT0A 3KAHA 4MTVA 3O5DA 1E6RA 1QPLA 1W9UA 2XP9A 1R9HA 4DROA 1E6NA 5B8IC 3FXYA 4JFLA 1FFRA 2DPEA 2IUZA 4DRIA 4NNRA 4W9OA 1XRVA 2RUCA 3AS0A 3WH0A 4ZS6A 2LPVA 2VN1A 3ARUA 5HW6A 3ARVA 4W9QA 1Y0OA 1JVWA 3JXVA 4Q7NA 4U85A 1W9VA 1Q6HA 2PBCA 2KGJA 4TW7A 2QF8A 3ARRA 1F40A 1RD6A 3LUOA 1GPFA 4G50A 2RUQA 2LGOA 2LJ4A 1ZB5A 4IT4A 4ML4A 2M08A 3KAFA 3KAGA 4ODQA 3MDYB 3VAWA 3B7XA 4IT6A 3RMEA 2MLXA 3B9AA 4KQZA 3WL1A 3ALFA 1SR0A 4MNLA 1HJXA 3QOKA 3UQIA 4DIPA 3WD3A 2RQSA 5DEZA 1F8AB 1YW5A 2RURA 2MLYA 1EQ3A 1ZBVA 1LL7A 1NSGA 4TX0A 5DO2A 3B8SA 2MNTA 4MPKA 1P5QA 1Q6UA 3KABA 4DRMA 1BL4A 1UR8A 2F4EA 3ARXA 4P8UA 1ROUA 1L1PA 5JH8A 2IF4A 1JNSA 3CH9A 2WLZA 3O5JA 3G6LA 1LG2A 2G8ZA 5GQBA 4U86A 4QZVB 2N87A 3G6MA 4JFIA 1FKIA 1PBKA 1QZ2A 2MF9A 4DRNA 1OWQA 4L72B 3GPKA 3IKDA 4TYOA 4DWSA 4S3KA 2O92A 1C9HA 4Z2LA 4Z2HA 3O5KA 4QT2A 1O6IA 2KFWA 3O5LA 3UI6A 3IHZA 2KE0A 1FKSA 1GUVA 3OA5A 1HKMA 2Q5AA 4LAXA 2DG9A 1W1TA 4WK9A 5I98A 4R0XA 1FKRA 4LAWA 1LQ0A 1FKLA 3TDBA 2DSZA 5HUAA 1ZU8A 4MNKA 4TW6A 4G2PA 4DWSD 3CHFA 4C02B 1NWTA 1FKJA 1ZBWA 3WIJA 4GIVA 1M5YA 4MAVA 3FAPA 4IQCA 3RFWA 3RM8A 1HKJA 2OLHA 1J4IA 4JYSA 3KZ7A 2ZR4A 1FJDA 2KO7A 4ODRA 1EIBA 3AQUA 1LG1A 1XHGA 2OFNA 3KCEA 2ESCA 1FFQA 1LL4A 2ITKA 4JFMA 2AOSA 3WL0A 2D9FA 4DRJA 2KI3A 1OGBA 3CZ8A 3W4RA 5HT1A 5HWCA 3B9EA 1ROTA 2M2AA 3UI4A 2ZR6A 4LAVA 3EY6A 5DIVA 1D7JA 4AY1A 4DRQA 5HWBA 1WB0A 2A3CA 4S3JA 1HJVA 2A3BA 4WKFA 3WD2A 4ZPWR 3O5GA 2PV2A 1NMVA 3NTPA 3ARZA 1OGGA 4W5UA 2VCDA 2ZQVA 4MGVA 2KR7A 1B6CA 4PTMA 4FN2A 3WD1A 4ODOA 1WAWA 4DH0A 1D6OA 4J4OA 2DT3A 3JYMA 2ZQSA 1QPFA 2MPHA 4BF8A 4JFJA 5D75A 2O9OA 2DT2A 2F21A 3NI6A 1ITXA 5HW7A 1UR9A 5BXJA 1J4RA 3KADA 1FKDA 1Q1CA 3ALGA 4KR0B 2WK2A 1ZBKA 2M1IA 3O5EA 3O5MA 3O5OA 2FDMA 1HJWA 4GGQA 2B31A 2DSWA 3JYJA 3IKGA 3WD0A 4FAPA 4DWSB 2XPAA 2YBTA 4DZ3A 1E6PA 1A7XA 1X6NA 4P8XA 2MLZA 4ODMA 4HBOA 2DT1A 1W1PA 3PRDA 2Y78A 1Q6IA 4ITZA 1HKKA 3PA7A 2K8IA 1W26A 4Z2KA 4LAYA 4WKHA 3O5FA 1NH6A 2XP5A 3O5RA 1IX5A 1KT0A 1KFWA 3IK8A 4U84A 2PPNA 1W9PA 4TW8A 2WM0A 3PRBA 3CHEA 2DSVA 3AROA 1NMWA 5GPRA 3CGMA 1FD9A 2XP6A 1NWRA 5HKGA 3WQVA 2XPBA 1PINA 1BKFA 4NSBA 4P8VA 2FKEA 3O5QA 3CHCA 1NWSA 4L3NA 3WKZA 4XAKA 3CHDA 4HBEA 2PV1A 2RSEA 1E9LA 2L2SA 4DWSC 3AS1A 1T11A 4QIBA 3O5IA 5DITA 1U79A 2PI6A 1ZL1A 1H0IA 4URIA 2LKNA 4Q22A 3ARPA 1YATA 2ZQUA 2F2DA 5HW8A 2RUDA 3O5PA 5J6EA 1TFVA 4WIWA 1FAPA 4TNSA 4Z2IA 1KT1A 1FKTA 4LGXA 4ZPVR 2WLYA 1D2KA 3BXWA 1K9TA 3RM4A 1JNTA 2A3EA 4IQ2A 1N1AA 5DIUA 1LJYA 4MNMA 1FKHA 3ARSA 4R5EA 1D7IA 3RGCA 2ZR5A 3ARQA 3ARTA 3I6CA 3UQBA 1D7HA 1X6LA 2DG4A 3ARYA 3OOBA 3RM9A 1W1YA 3UQAA 4QT3A 1JNDA 4ODKA 3UI5A 1E6ZA 1CTNA 2YBUA 4NZCA 3FY1A 3PR9A 1NWUA 2PV3A 3KACA 3PRAA 2ZQTA 1FKFA 2AWGA 4ZPTR 4ODLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HUA A;  4JFK A;  4TW6 A;  3TCZ A;  4G2P A;  1F40 A;  3TC5 A;  2MLZ A;  1ZK6 A;  4ODM A;  3LUO A;  4G50 A;  4C02 B;  4DT4 A;  1FKJ A;  2RUQ A;  2LGO A;  2LJ4 A;  3PRD A;  3KAI A;  2Y78 A;  1Q6I A;  2XP4 A;  2DG3 A;  2M08 A;  4GIV A;  4ITZ A;  3PA7 A;  2K8I A;  1W26 A;  3KAF A;  3KAG A;  4LAY A;  1M5Y A;  4ODQ A;  3UQB A;  3MDY B;  3FAP A;  2XP7 A;  4IQC A;  4IPX A;  3RFW A;  3O5F A;  1FKG A;  2JZV A;  2XP5 A;  3O5R A;  4W9P A;  3VAW A;  4N19 A;  1KT0 A;  3IK8 A;  4U84 A;  4DRH A;  1J4I A;  3B7X A;  4O2T A;  2MLX A;  2PPN A;  4JYS A;  4TW8 A;  3KZ7 A;  5GPG A;  3H9R B;  3PRB A;  4J4N A;  2ZR4 A;  3TDB A;  3UF8 A;  1NMW A;  2KO7 A;  1FJD A;  2XPA A;  3CGM A;  1FD9 A;  2XP6 A;  5HKG A;  2XPB A;  1PIN A;  3CGN A;  4ODR A;  1BKF A;  1EYM A;  1ZCN A;  2RQS A;  2FKE A;  1F8A B;  4DIP A;  2UZ5 A;  1YW5 A;  2RUR A;  3O5Q A;  2MLY A;  1EQ3 A;  2OFN A;  3KCE A;  3UQI A;  2ITK A;  1NSG A;  2PV1 A;  2RSE A;  4TX0 A;  2L2S A;  4QIB A;  1T11 A;  4JFM A;  3O5I A;  1FKB A;  5DIT A;  2D9F A;  2MNT A;  4DRJ A;  1U79 A;  2KI3 A;  2PPP A;  4DZ2 A;  4MSP A;  1P5Q A;  4DRP A;  1J4H A;  5HT1 A;  5HWC A;  4ODP A;  2LKN A;  5HTG A;  3NRK A;  2XP3 A;  1YAT A;  1Q6U A;  3KAB A;  4DRM A;  1ROT A;  2M2A A;  2ZQU A;  1BL4 A;  2F2D A;  1FKK A;  2ZR6 A;  3ODK A;  3EY6 A;  4LAV A;  2F4E A;  4ODN A;  3UI4 A;  5HW8 A;  5DIV A;  1D7J A;  1TCO C;  2RUD A;  4DRQ A;  1ROU A;  3O5P A;  5J6E A;  5HWB A;  1L1P A;  2IF4 A;  1JNS A;  1FAP A;  3O5J A;  4TNS A;  1HXV A;  1KT1 A;  1FKT A;  4U86 A;  1JNT A;  4IQ2 A;  1N1A A;  3O5G A;  2PV2 A;  5DIU A;  2N87 A;  1NMV A;  1J6Y A;  4JFI A;  1FKI A;  3NTP A;  1PBK A;  2XP8 A;  2VCD A;  1FKH A;  4DRK A;  2FAP A;  1QZ2 A;  2PPO A;  2ZQV A;  3KAH A;  4MGV A;  2KR7 A;  1D7I A;  1B6C A;  2MF9 A;  2ZR5 A;  3I6C A;  4FN2 A;  4ODO A;  3RGC A;  4DH0 A;  1D7H A;  1D6O A;  2DG4 A;  3O5D A;  4J4O A;  3OOB A;  1QPL A;  4DRN A;  3JYM A;  2XP9 A;  2ZQS A;  1R9H A;  3GPK A;  3IKD A;  1QPF A;  2MPH A;  4TYO A;  4JFJ A;  5D75 A;  4BF8 A;  4DRO A;  3UQA A;  1C9H A;  5B8I C;  4JFL A;  2F21 A;  4QT3 A;  4ODK A;  3UI5 A;  3O5K A;  3NI6 A;  4NNR A;  4QT2 A;  2RUC A;  4W9O A;  4DRI A;  5HW7 A;  2KFW A;  3WH0 A;  3O5L A;  3UI6 A;  3IHZ A;  2LPV A;  2KE0 A;  5BXJ A;  1J4R A;  1FKD A;  2VN1 A;  1Q1C A;  1FKS A;  3KAD A;  5HW6 A;  2Q5A A;  4W9Q A;  1Y0O A;  2M1I A;  1JVW A;  3JXV A;  3O5E A;  3O5M A;  3O5O A;  4LAX A;  2PV3 A;  3KAC A;  2DG9 A;  4U85 A;  1Q6H A;  2PBC A;  4GGQ A;  5I98 A;  2ZQT A;  1FKF A;  4R0X A;  1FKR A;  3JYJ A;  3IKG A;  2AWG A;  2KGJ A;  4TW7 A;  4FAP A;  4LAW A;  1FKL A;  4ODL A;  4DZ3 A;  1A7X A; 
#chains in the Genus database with same CATH topology
 1EDQ A;  1WNO A;  4JFK A;  4P8W A;  1ZBC A;  1GOI A;  3TCZ A;  3TC5 A;  3ARW A;  1ZK6 A;  4DT4 A;  5HBF A;  3KAI A;  2XP4 A;  2DG3 A;  1E15 A;  2XP7 A;  4IPX A;  1FKG A;  2JZV A;  4W9P A;  4N19 A;  1W1V A;  1HKI A;  4DRH A;  4O2T A;  2DSU A;  1JNE A;  2A3A A;  5GPG A;  3H9R B;  4J4N A;  3UF8 A;  1EHN A;  3WQW A;  1VF8 A;  4Z2G A;  3CGN A;  1ZCN A;  1EYM A;  2UZ5 A;  4WKA A;  4MNJ A;  3B9D A;  3AS2 A;  1FKB A;  4Z2J A;  4DZ2 A;  2PPP A;  3AS3 A;  4MSP A;  3WD4 A;  4DRP A;  5DF0 A;  1J4H A;  4ODP A;  5HTG A;  1LL6 A;  3NRK A;  2XP3 A;  3ODK A;  1FKK A;  4ODN A;  1TCO C;  4HAR A;  1HXV A;  4WJX A;  1SYT A;  1J6Y A;  1H0G A;  2XP8 A;  2G41 A;  4DRK A;  2FAP A;  2PPO A;  2DT0 A;  3KAH A;  4MTV A;  3O5D A;  1E6R A;  1QPL A;  1W9U A;  2XP9 A;  1R9H A;  3GU0 A;  4DRO A;  1E6N A;  5B8I C;  3FXY A;  4JFL A;  1FFR A;  2DPE A;  2B5U B;  2IUZ A;  4DRI A;  4NNR A;  4W9O A;  1XRV A;  2RUC A;  3AS0 A;  3WH0 A;  4ZS6 A;  2LPV A;  2VN1 A;  3ARU A;  5HW6 A;  3ARV A;  4W9Q A;  1Y0O A;  1JVW A;  3JXV A;  4Q7N A;  4U85 A;  1W9V A;  1Q6H A;  2PBC A;  3EIP A;  2KGJ A;  4TW7 A;  2QF8 A;  3ARR A;  1F40 A;  1RD6 A;  2EUL A;  3BMB A;  1GPF A;  3LUO A;  4G50 A;  2RUQ A;  2LGO A;  2LJ4 A;  1ZB5 A;  4IT4 A;  4ML4 A;  2M08 A;  3KAF A;  3KAG A;  4ODQ A;  3MDY B;  3VAW A;  3B7X A;  4IT6 A;  3RME A;  2MLX A;  3B9A A;  4KQZ A;  3WL1 A;  3ALF A;  1SR0 A;  4MNL A;  1HJX A;  3QOK A;  3UQI A;  4DIP A;  3WD3 A;  2RQS A;  5DEZ A;  1F8A B;  1YW5 A;  2RUR A;  2MLY A;  1EQ3 A;  1ZBV A;  1LL7 A;  1NSG A;  4TX0 A;  5DO2 A;  3B8S A;  2MNT A;  4MPK A;  1P5Q A;  4UDM A;  1Q6U A;  3KAB A;  4DRM A;  1BL4 A;  1E44 A;  1UR8 A;  2F4E A;  3ARX A;  4P8U A;  1ROU A;  1L1P A;  5JH8 A;  2IF4 A;  1JNS A;  3CH9 A;  2WLZ A;  3O5J A;  3G6L A;  1LG2 A;  2G8Z A;  5GQB A;  4U86 A;  4QZV B;  2N87 A;  3G6M A;  4JFI A;  1FKI A;  1PBK A;  1QZ2 A;  2MF9 A;  4DRN A;  1OWQ A;  4L72 B;  3GPK A;  3IKD A;  4TYO A;  4DWS A;  4S3K A;  2O92 A;  1C9H A;  4Z2L A;  4Z2H A;  3O5K A;  4QT2 A;  1O6I A;  2KFW A;  3O5L A;  3UI6 A;  3IHZ A;  2KE0 A;  1FKS A;  1GUV A;  3OA5 A;  1HKM A;  2Q5A A;  4LAX A;  2DG9 A;  1W1T A;  4WK9 A;  5I98 A;  4R0X A;  1GRJ A;  1FKR A;  4LAW A;  1LQ0 A;  1FKL A;  3TDB A;  2DSZ A;  2F23 A;  5HUA A;  1ZU8 A;  4MNK A;  4TW6 A;  4G2P A;  4DWS D;  3CHF A;  4C02 B;  1NWT A;  1FKJ A;  1ZBW A;  3WIJ A;  4GIV A;  1M5Y A;  4MAV A;  3FAP A;  4IQC A;  3RFW A;  3RM8 A;  1HKJ A;  2OLH A;  1J4I A;  4JYS A;  3KZ7 A;  2ZR4 A;  1FJD A;  2KO7 A;  4ODR A;  1EIB A;  3AQU A;  1LG1 A;  1XHG A;  2OFN A;  3KCE A;  2ESC A;  1FFQ A;  1LL4 A;  2ITK A;  4JFM A;  2AOS A;  3WL0 A;  2D9F A;  4DRJ A;  2KI3 A;  1OGB A;  3CZ8 A;  3W4R A;  1JCH B;  5HT1 A;  5HWC A;  3B9E A;  1ROT A;  2M2A A;  3UI4 A;  2ZR6 A;  4LAV A;  3EY6 A;  5DIV A;  1D7J A;  4AY1 A;  4DRQ A;  5HWB A;  1WB0 A;  2A3C A;  4S3J A;  1HJV A;  2A3B A;  4WKF A;  3WD2 A;  4ZPW R;  3O5G A;  2ETN A;  2PV2 A;  1NMV A;  3NTP A;  3ARZ A;  1OGG A;  4W5U A;  2VCD A;  2ZQV A;  4MGV A;  2KR7 A;  1B6C A;  4PTM A;  4FN2 A;  3WD1 A;  4ODO A;  1WAW A;  4DH0 A;  1D6O A;  4J4O A;  2DT3 A;  3JYM A;  2ZQS A;  1QPF A;  2MPH A;  4BF8 A;  4JFJ A;  5D75 A;  2O9O A;  2DT2 A;  2F21 A;  3NI6 A;  1ITX A;  5HW7 A;  1UR9 A;  5BXJ A;  1J4R A;  3KAD A;  1FKD A;  2PN0 A;  1Q1C A;  3ALG A;  4KR0 B;  2WK2 A;  1ZBK A;  2M1I A;  3O5E A;  3O5M A;  3O5O A;  2FDM A;  1HJW A;  4GGQ A;  2B31 A;  2DSW A;  3JYJ A;  3IKG A;  3WD0 A;  4FAP A;  4DWS B;  2XPA A;  2YBT A;  4DZ3 A;  1E6P A;  1A7X A;  1X6N A;  4P8X A;  2MLZ A;  4ODM A;  4HBO A;  2DT1 A;  1W1P A;  3PRD A;  2Y78 A;  1Q6I A;  4ITZ A;  1HKK A;  3PA7 A;  2K8I A;  1W26 A;  4Z2K A;  4LAY A;  4WKH A;  3O5F A;  1NH6 A;  2XP5 A;  3O5R A;  1IX5 A;  1KT0 A;  1KFW A;  3IK8 A;  4U84 A;  2PPN A;  1W9P A;  4TW8 A;  2WM0 A;  3PRB A;  3CHE A;  2DSV A;  3ARO A;  1NMW A;  5GPR A;  3GTY X;  3CGM A;  1FD9 A;  2XP6 A;  1NWR A;  5HKG A;  3WQV A;  2XPB A;  1PIN A;  1BKF A;  4NSB A;  4P8V A;  2FKE A;  3O5Q A;  3CHC A;  1NWS A;  4L3N A;  3WKZ A;  4XAK A;  3CHD A;  4HBE A;  2PV1 A;  2P4V A;  2RSE A;  1E9L A;  2L2S A;  4DWS C;  3AS1 A;  1T11 A;  4QIB A;  3O5I A;  5DIT A;  1U79 A;  2PI6 A;  1ZL1 A;  1H0I A;  4URI A;  2LKN A;  4Q22 A;  3ARP A;  1YAT A;  2ZQU A;  2F2D A;  5HW8 A;  2RUD A;  3O5P A;  5J6E A;  1TFV A;  4WIW A;  1FAP A;  4TNS A;  4Z2I A;  1KT1 A;  1FKT A;  4LGX A;  4ZPV R;  2WLY A;  1D2K A;  3BXW A;  1K9T A;  3RM4 A;  1JNT A;  2A3E A;  4IQ2 A;  1N1A A;  5DIU A;  1LJY A;  4MNM A;  1FKH A;  3ARS A;  4R5E A;  1D7I A;  3RGC A;  2ZR5 A;  3ARQ A;  3ART A;  3I6C A;  3UQB A;  1D7H A;  1X6L A;  2DG4 A;  3ARY A;  3OOB A;  3RM9 A;  1W1Y A;  3UQA A;  4QT3 A;  1JND A;  4ODK A;  3UI5 A;  1E6Z A;  1CTN A;  2YBU A;  4NZC A;  3FY1 A;  3PR9 A;  1NWU A;  2PV3 A;  3KAC A;  3PRA A;  2ZQT A;  1FKF A;  2AWG A;  4ZPT R;  4ODL A; 
#chains in the Genus database with same CATH homology
 1EDQ A;  1WNO A;  4JFK A;  4P8W A;  1ZBC A;  1GOI A;  3TCZ A;  3TC5 A;  3ARW A;  1ZK6 A;  4DT4 A;  5HBF A;  3KAI A;  2XP4 A;  2DG3 A;  1E15 A;  2XP7 A;  4IPX A;  1FKG A;  2JZV A;  4W9P A;  4N19 A;  1W1V A;  1HKI A;  4DRH A;  4O2T A;  2DSU A;  1JNE A;  2A3A A;  5GPG A;  3H9R B;  4J4N A;  3UF8 A;  1EHN A;  3WQW A;  1VF8 A;  4Z2G A;  3CGN A;  1ZCN A;  1EYM A;  2UZ5 A;  4WKA A;  4MNJ A;  3B9D A;  3AS2 A;  1FKB A;  4Z2J A;  4DZ2 A;  2PPP A;  3AS3 A;  4MSP A;  3WD4 A;  4DRP A;  5DF0 A;  1J4H A;  4ODP A;  5HTG A;  1LL6 A;  3NRK A;  2XP3 A;  3ODK A;  1FKK A;  4ODN A;  1TCO C;  4HAR A;  1HXV A;  4WJX A;  1SYT A;  1J6Y A;  1H0G A;  2XP8 A;  2G41 A;  4DRK A;  2FAP A;  2PPO A;  2DT0 A;  3KAH A;  4MTV A;  3O5D A;  1E6R A;  1QPL A;  1W9U A;  2XP9 A;  1R9H A;  4DRO A;  1E6N A;  5B8I C;  3FXY A;  4JFL A;  1FFR A;  2DPE A;  2IUZ A;  4DRI A;  4NNR A;  4W9O A;  1XRV A;  2RUC A;  3AS0 A;  3WH0 A;  4ZS6 A;  2LPV A;  2VN1 A;  3ARU A;  5HW6 A;  3ARV A;  4W9Q A;  1Y0O A;  1JVW A;  3JXV A;  4Q7N A;  4U85 A;  1W9V A;  1Q6H A;  2PBC A;  2KGJ A;  4TW7 A;  2QF8 A;  3ARR A;  1F40 A;  1RD6 A;  3LUO A;  1GPF A;  4G50 A;  2RUQ A;  2LGO A;  2LJ4 A;  1ZB5 A;  4IT4 A;  4ML4 A;  2M08 A;  3KAF A;  3KAG A;  4ODQ A;  3MDY B;  3VAW A;  3B7X A;  4IT6 A;  3RME A;  2MLX A;  3B9A A;  4KQZ A;  3WL1 A;  3ALF A;  1SR0 A;  4MNL A;  1HJX A;  3QOK A;  3UQI A;  4DIP A;  3WD3 A;  2RQS A;  5DEZ A;  1F8A B;  1YW5 A;  2RUR A;  2MLY A;  1EQ3 A;  1ZBV A;  1LL7 A;  1NSG A;  4TX0 A;  5DO2 A;  3B8S A;  2MNT A;  4MPK A;  1P5Q A;  1Q6U A;  3KAB A;  4DRM A;  1BL4 A;  1UR8 A;  2F4E A;  3ARX A;  4P8U A;  1ROU A;  1L1P A;  5JH8 A;  2IF4 A;  1JNS A;  3CH9 A;  2WLZ A;  3O5J A;  3G6L A;  1LG2 A;  2G8Z A;  5GQB A;  4U86 A;  4QZV B;  2N87 A;  3G6M A;  4JFI A;  1FKI A;  1PBK A;  1QZ2 A;  2MF9 A;  4DRN A;  1OWQ A;  4L72 B;  3GPK A;  3IKD A;  4TYO A;  4DWS A;  4S3K A;  2O92 A;  1C9H A;  4Z2L A;  4Z2H A;  3O5K A;  4QT2 A;  1O6I A;  2KFW A;  3O5L A;  3UI6 A;  3IHZ A;  2KE0 A;  1FKS A;  1GUV A;  3OA5 A;  1HKM A;  2Q5A A;  4LAX A;  2DG9 A;  1W1T A;  4WK9 A;  5I98 A;  4R0X A;  1FKR A;  4LAW A;  1LQ0 A;  1FKL A;  3TDB A;  2DSZ A;  5HUA A;  1ZU8 A;  4MNK A;  4TW6 A;  4G2P A;  4DWS D;  3CHF A;  4C02 B;  1NWT A;  1FKJ A;  1ZBW A;  3WIJ A;  4GIV A;  1M5Y A;  4MAV A;  3FAP A;  4IQC A;  3RFW A;  3RM8 A;  1HKJ A;  2OLH A;  1J4I A;  4JYS A;  3KZ7 A;  2ZR4 A;  1FJD A;  2KO7 A;  4ODR A;  1EIB A;  3AQU A;  1LG1 A;  1XHG A;  2OFN A;  3KCE A;  2ESC A;  1FFQ A;  1LL4 A;  2ITK A;  4JFM A;  2AOS A;  3WL0 A;  2D9F A;  4DRJ A;  2KI3 A;  1OGB A;  3CZ8 A;  3W4R A;  5HT1 A;  5HWC A;  3B9E A;  1ROT A;  2M2A A;  3UI4 A;  2ZR6 A;  4LAV A;  3EY6 A;  5DIV A;  1D7J A;  4AY1 A;  4DRQ A;  5HWB A;  1WB0 A;  2A3C A;  4S3J A;  1HJV A;  2A3B A;  4WKF A;  3WD2 A;  4ZPW R;  3O5G A;  2PV2 A;  1NMV A;  3NTP A;  3ARZ A;  1OGG A;  4W5U A;  2VCD A;  2ZQV A;  4MGV A;  2KR7 A;  1B6C A;  4PTM A;  4FN2 A;  3WD1 A;  4ODO A;  1WAW A;  4DH0 A;  1D6O A;  4J4O A;  2DT3 A;  3JYM A;  2ZQS A;  1QPF A;  2MPH A;  4BF8 A;  4JFJ A;  5D75 A;  2O9O A;  2DT2 A;  2F21 A;  3NI6 A;  1ITX A;  5HW7 A;  1UR9 A;  5BXJ A;  1J4R A;  3KAD A;  1FKD A;  1Q1C A;  3ALG A;  4KR0 B;  2WK2 A;  1ZBK A;  2M1I A;  3O5E A;  3O5M A;  3O5O A;  2FDM A;  1HJW A;  4GGQ A;  2B31 A;  2DSW A;  3JYJ A;  3IKG A;  3WD0 A;  4FAP A;  4DWS B;  2XPA A;  2YBT A;  4DZ3 A;  1E6P A;  1A7X A;  1X6N A;  4P8X A;  2MLZ A;  4ODM A;  4HBO A;  2DT1 A;  1W1P A;  3PRD A;  2Y78 A;  1Q6I A;  4ITZ A;  1HKK A;  3PA7 A;  2K8I A;  1W26 A;  4Z2K A;  4LAY A;  4WKH A;  3O5F A;  1NH6 A;  2XP5 A;  3O5R A;  1IX5 A;  1KT0 A;  1KFW A;  3IK8 A;  4U84 A;  2PPN A;  1W9P A;  4TW8 A;  2WM0 A;  3PRB A;  3CHE A;  2DSV A;  3ARO A;  1NMW A;  5GPR A;  3CGM A;  1FD9 A;  2XP6 A;  1NWR A;  5HKG A;  3WQV A;  2XPB A;  1PIN A;  1BKF A;  4NSB A;  4P8V A;  2FKE A;  3O5Q A;  3CHC A;  1NWS A;  4L3N A;  3WKZ A;  4XAK A;  3CHD A;  4HBE A;  2PV1 A;  2RSE A;  1E9L A;  2L2S A;  4DWS C;  3AS1 A;  1T11 A;  4QIB A;  3O5I A;  5DIT A;  1U79 A;  2PI6 A;  1ZL1 A;  1H0I A;  4URI A;  2LKN A;  4Q22 A;  3ARP A;  1YAT A;  2ZQU A;  2F2D A;  5HW8 A;  2RUD A;  3O5P A;  5J6E A;  1TFV A;  4WIW A;  1FAP A;  4TNS A;  4Z2I A;  1KT1 A;  1FKT A;  4LGX A;  4ZPV R;  2WLY A;  1D2K A;  3BXW A;  1K9T A;  3RM4 A;  1JNT A;  2A3E A;  4IQ2 A;  1N1A A;  5DIU A;  1LJY A;  4MNM A;  1FKH A;  3ARS A;  4R5E A;  1D7I A;  3RGC A;  2ZR5 A;  3ARQ A;  3ART A;  3I6C A;  3UQB A;  1D7H A;  1X6L A;  2DG4 A;  3ARY A;  3OOB A;  3RM9 A;  1W1Y A;  3UQA A;  4QT3 A;  1JND A;  4ODK A;  3UI5 A;  1E6Z A;  1CTN A;  2YBU A;  4NZC A;  3FY1 A;  3PR9 A;  1NWU A;  2PV3 A;  3KAC A;  3PRA A;  2ZQT A;  1FKF A;  2AWG A;  4ZPT R;  4ODL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...