2F2DA

Solution structure of the fk506-binding domain of human fkbp38
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
121
structure length
121
Chain Sequence
MREWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 38 kDa FK-506 binding protein homolog, FKBP38
publication title Solution Structure of the FK506-Binding Domain of Human FKBP38
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f2dA00
2XP3A 3EY6A 1ROTA 3KABA 3O5KA 1FKRA 3IHZA 3KADA 4TW8A 3TC5A 4JFMA 1C9HA 2MNTA 3O5EA 4DRNA 4BF8A 3OOBA 1HXVA 1FKBA 3NTPA 3B7XA 1FJDA 5HW6A 1KT0A 4DRPA 2DG9A 4IQCA 2RUCA 1BL4A 3MDYB 2M2AA 1ROUA 4ODLA 5D75A 3UF8A 2XP7A 3KCEA 5BXJA 1J4HA 1J4RA 3FAPA 4ODRA 2JZVA 5HTGA 2XPBA 5J6EA 5I98A 3CGMA 2PV3A 5DITA 1QPLA 4LAYA 5HWBA 4W9PA 3H9RB 2L2SA 1QPFA 2Q5AA 4G2PA 2F2DA 4QT3A 3UQIA 2F21A 2AWGA 1FKIA 1T11A 3O5DA 5GPGA 3JYJA 3CGNA 3O5JA 3PRBA 3O5GA 2D9FA 1YW5A 3O5PA 2XP5A 3PA7A 4IQ2A 4ODNA 4DRMA 2KI3A 3O5QA 1F40A 1FKSA 3KZ7A 4U85A 1FAPA 2ZQVA 1JNSA 3O5MA 1L1PA 4ODKA 4DROA 2LKNA 1ZK6A 2ZQTA 1FKTA 3VAWA 3TCZA 1ZCNA 2MPHA 1U79A 2KE0A 4R0XA 3WH0A 4ITZA 3UI4A 2ZQSA 2XP9A 2MLYA 3O5IA 4DRHA 3O5OA 2DG3A 1NSGA 1FD9A 3IKDA 4U86A 3IKGA 2ZR5A 5B8IC 4LAWA 1J4IA 3O5FA 3RFWA 2PPOA 3UQAA 4TW6A 2RURA 4ODOA 2FKEA 2PPNA 3IK8A 1PBKA 1JNTA 2OFNA 4TX0A 1FKHA 4DRQA 2M08A 3NI6A 4DZ2A 1FKFA 2MLXA 3JXVA 4DRIA 4DRJA 5HW7A 4DIPA 2IF4A 1J6YA 4U84A 2ZR4A 1N1AA 2PBCA 1NMWA 1FKGA 1A7XA 2MF9A 3JYMA 2VN1A 2PV2A 2ZQUA 3ODKA 4J4NA 4W9QA 3KACA 3PRDA 1EQ3A 1M5YA 2FAPA 2UZ5A 4QT2A 3UI5A 1B6CA 4ODMA 2LGOA 2PPPA 5HKGA 4ODPA 4NNRA 3O5LA 1Q6HA 2M1IA 2RUQA 3UQBA 1KT1A 3KAIA 3KAFA 4LAXA 2MLZA 4MGVA 4FAPA 5DIVA 2F4EA 1TCOC 4JYSA 1Y0OA 4QIBA 4JFLA 4IPXA 1BKFA 5HWCA 2PV1A 4N19A 1YATA 1EYMA 1FKDA 1D7IA 2Y78A 4J4OA 4ODQA 3TDBA 3UI6A 2ZR6A 5HT1A 3O5RA 5HW8A 1JVWA 2K8IA 2RUDA 2N87A 1R9HA 1Q1CA 2VCDA 3RGCA 1D6OA 4DT4A 1W26A 2XPAA 4MSPA 3NRKA 4TNSA 1D7JA 2XP8A 4LAVA 4JFKA 4W9OA 2RSEA 2KGJA 3I6CA 4O2TA 4DRKA 4FN2A 1NMVA 1Q6IA 4C02B 1QZ2A 4JFJA 4JFIA 4GGQA 2RQSA 4GIVA 1Q6UA 5DIUA 1FKKA 2KFWA 1F8AB 2XP4A 3GPKA 4G50A 2KO7A 2XP6A 2DG4A 2KR7A 1D7HA 2LJ4A 2ITKA 3KAHA 5HUAA 1FKJA 4DH0A 4TYOA 4TW7A 2LPVA 1P5QA 1PINA 4DZ3A 3LUOA 1FKLA 3KAGA
chains in the Genus database with same CATH superfamily
3KABA 1ROTA 3O5KA 4HBEA 3KADA 4TW8A 4W5UA 1E15A 3O5EA 4DRNA 4BF8A 1FKBA 3B7XA 4MNLA 1JCHB 4DRPA 3CHFA 2G8ZA 1BL4A 2M2AA 1ROUA 4ODLA 3WQVA 4ODRA 4KR0B 4P8UA 1WNOA 1QPLA 4LAYA 3WD3A 3GTYX 2DSUA 1HKJA 2F2DA 2B5UB 1NH6A 2F23A 3CGNA 4IQ2A 3O5PA 4ODNA 4WKAA 4DWSC 3WD1A 4Z2GA 2LKNA 1ZK6A 2ZQTA 1E6NA 4WK9A 4Z2KA 1ZCNA 4ITZA 3UI4A 2DSVA 3QOKA 3B9DA 4P8XA 3IKDA 1FD9A 2ZR5A 2IUZA 3RFWA 1LQ0A 2PPOA 4TW6A 3ALFA 4P8WA 2PPNA 3IK8A 3WL0A 1UR9A 2M08A 3CHEA 4DZ2A 4DRJA 3ARYA 4S3JA 4L3NA 1ZU8A 3JYMA 2VN1A 2PV2A 3EIPA 4W9QA 3KACA 4ZPVR 1LG2A 1ZB5A 2PPPA 1TFVA 2DT0A 3KAIA 3KAFA 1Y0OA 1XRVA 1BKFA 4N19A 1EYMA 1D7IA 3UI6A 5HW8A 1ZBVA 2RUDA 2B31A 1R9HA 1Q1CA 2P4VA 1D6OA 1W9UA 4PTMA 1D7JA 3PR9A 1NWRA 1NMVA 4JFIA 4GGQA 2RQSA 1W1PA 1HJVA 4G50A 2KO7A 1D7HA 1FKJA 1ZBKA 3BMBA 1D2KA 1NWUA 4JFJA 2OLHA 2FDMA 3TC5A 1GPFA 2MNTA 2O92A 3OOBA 3NTPA 2O9OA 3RM8A 2DG9A 1W1VA 5DF0A 4Q7NA 2WM0A 4MAVA 5D75A 2XP7A 3KCEA 5BXJA 1J4RA 3FAPA 2XPBA 3CHDA 3CGMA 4Z2LA 1CTNA 3CZ8A 3H9RB 2PN0A 2Q5AA 4QT3A 3UQIA 3O5DA 5GPGA 3O5GA 4WKFA 1YW5A 3ARXA 1EHNA 1JNSA 3O5MA 4DWSB 1LJYA 1GUVA 3VAWA 2KE0A 4QZVB 4XAKA 4MNMA 2EULA 2ZQSA 2XP9A 2MLYA 4LAWA 1J4IA 1ZBCA 4DWSA 4L72B 3RM4A 1JNTA 4DRQA 1FKFA 2MLXA 3JXVA 2IF4A 1J6YA 1X6LA 3WD2A 2MF9A 1ITXA 4WIWA 1HKKA 5DEZA 3WD4A 3UI5A 2DSZA 3ARRA 3O5LA 2M1IA 4MGVA 4FAPA 1K9TA 1LL7A 3ARUA 1EDQA 4JFLA 2PV1A 4NSBA 4J4OA 1FKDA 2Y78A 3O5RA 2N87A 3AS0A 3RGCA 3CH9A 4TNSA 1LL6A 1ZBWA 3RMEA 1ZL1A 4LAVA 4W9OA 2RSEA 1JNDA 3I6CA 4O2TA 1Q6IA 4C02B 1QZ2A 5DIUA 4GIVA 2XP4A 2XP6A 3WKZA 1PINA 3OA5A 4MNJA 4ZS6A 4DZ3A 3AS2A 3IHZA 4JFMA 1C9HA 1OWQA 1HXVA 5HW6A 4IQCA 4IT6A 3GU0A 2YBTA 3AS1A 5HTGA 5J6EA 5I98A 3ALGA 2PV3A 5DITA 3ARQA 1FFRA 2A3CA 1VF8A 5HWBA 3WIJA 1OGGA 4MPKA 4G2PA 2F21A 3JYJA 3O5JA 2D9FA 3PA7A 2XP5A 2ESCA 2KI3A 3O5QA 1EIBA 3KZ7A 4U85A 4HBOA 2A3EA 4Z2HA 2DT3A 4MTVA 1FKTA 3TCZA 3AQUA 1FFQA 3O5IA 1HJXA 1NSGA 4DWSD 4U86A 3IKGA 4ML4A 1LG1A 3UQAA 1OGBA 2RURA 1IX5A 2AOSA 2DT2A 3BXWA 4KQZA 1PBKA 2OFNA 3B9AA 4ZPWR 5HW7A 4DRIA 4DIPA 1LL4A 2QF8A 3WD0A 4URIA 1N1AA 3ODKA 2ETNA 3G6LA 4WKHA 1HJWA 1M5YA 2FAPA 4QT2A 1B6CA 4ODMA 2LGOA 2PI6A 4WJXA 4NNRA 1Q6HA 2RUQA 3UQBA 5GPRA 4LGXA 1KT1A 4LAXA 2MLZA 5DIVA 2F4EA 1TCOC 4AY1A 5HWCA 1W1YA 1YATA 2ZR6A 5GQBA 1JVWA 2K8IA 3ARZA 1O6IA 3ARVA 3WQWA 4DT4A 4MSPA 1W9PA 3NRKA 1NWTA 2XP8A 4JFKA 3ARPA 2KGJA 4DRKA 1E6RA 1FKKA 1F8AB 3GPKA 1JNEA 2KR7A 2LJ4A 3KAHA 2ITKA 4Z2JA 4DH0A 2YBUA 4TW7A 3WL1A 3LUOA 3RM9A 1FKLA 3KAGA 2XP3A 1E6PA 3EY6A 1FKRA 1NWSA 1SYTA 4IT4A 4UDMA 1FJDA 2DSWA 1X6NA 1WB0A 1KT0A 2RUCA 1W9VA 3MDYB 2DPEA 3UF8A 1J4HA 2JZVA 1WAWA 2A3BA 3B8SA 3G6MA 1GOIA 5JH8A 4W9PA 3ARTA 2L2SA 1QPFA 4NZCA 2AWGA 1FKIA 1GRJA 4HARA 1T11A 3PRBA 1RD6A 4DRMA 1F40A 1FKSA 3PRAA 1FAPA 2ZQVA 1L1PA 4ODKA 2G41A 4DROA 1E6ZA 4P8VA 2MPHA 1U79A 3WH0A 4R0XA 1W1TA 4DRHA 3O5OA 2DG3A 5B8IC 3O5FA 1E44A 4MNKA 3W4RA 4ODOA 2FKEA 1H0IA 5DO2A 3FY1A 4TX0A 1FKHA 2WLZA 3NI6A 1HKMA 3CHCA 4U84A 1SR0A 2ZR4A 2PBCA 1NMWA 1FKGA 1A7XA 4J4NA 2ZQUA 3PRDA 1E9LA 4ZPTR 1EQ3A 2UZ5A 3ARWA 5HKGA 4ODPA 1UR8A 3FXYA 4JYSA 4QIBA 3B9EA 4IPXA 4R5EA 1XHGA 3AS3A 4ODQA 3TDBA 5HT1A 4Q22A 1HKIA 2WLYA 4S3KA 2VCDA 1H0GA 2WK2A 1W26A 2DT1A 2XPAA 4FN2A 4Z2IA 1Q6UA 2KFWA 2A3AA 2DG4A 5HBFA 5HUAA 4TYOA 3ARSA 1KFWA 2LPVA 1P5QA 3AROA
chains in the Genus database with same CATH topology
3KABA 1ROTA 3O5KA 4HBEA 3KADA 4TW8A 4W5UA 1E15A 3O5EA 4DRNA 4BF8A 1FKBA 3B7XA 4MNLA 4DRPA 3CHFA 2G8ZA 1BL4A 2M2AA 1ROUA 4ODLA 3WQVA 4ODRA 4KR0B 4P8UA 1WNOA 1QPLA 4LAYA 3WD3A 2DSUA 1HKJA 2F2DA 1NH6A 3CGNA 4IQ2A 3O5PA 4ODNA 4WKAA 4DWSC 3WD1A 4Z2GA 2LKNA 1ZK6A 2ZQTA 1E6NA 4WK9A 4Z2KA 1ZCNA 4ITZA 3UI4A 2DSVA 3QOKA 3B9DA 4P8XA 3IKDA 1FD9A 2ZR5A 2IUZA 3RFWA 1LQ0A 2PPOA 4TW6A 3ALFA 4P8WA 2PPNA 3IK8A 3WL0A 1UR9A 2M08A 3CHEA 4DZ2A 4DRJA 3ARYA 4S3JA 4L3NA 1ZU8A 3JYMA 2VN1A 2PV2A 4W9QA 3KACA 4ZPVR 1LG2A 1ZB5A 2PPPA 1TFVA 2DT0A 3KAIA 3KAFA 1Y0OA 1XRVA 1BKFA 4N19A 1EYMA 1D7IA 3UI6A 5HW8A 1ZBVA 2RUDA 2B31A 1R9HA 1Q1CA 1D6OA 1W9UA 4PTMA 1D7JA 3PR9A 1NWRA 1NMVA 4JFIA 4GGQA 2RQSA 1W1PA 1HJVA 4G50A 2KO7A 1D7HA 1FKJA 1ZBKA 1D2KA 1NWUA 4JFJA 2OLHA 2FDMA 3TC5A 1GPFA 2MNTA 2O92A 3OOBA 3NTPA 2O9OA 3RM8A 2DG9A 1W1VA 5DF0A 4Q7NA 2WM0A 4MAVA 5D75A 2XP7A 3KCEA 5BXJA 1J4RA 3FAPA 2XPBA 3CHDA 3CGMA 4Z2LA 1CTNA 3CZ8A 3H9RB 2Q5AA 4QT3A 3UQIA 3O5DA 5GPGA 3O5GA 4WKFA 1YW5A 3ARXA 1EHNA 1JNSA 3O5MA 4DWSB 1LJYA 1GUVA 3VAWA 2KE0A 4QZVB 4XAKA 4MNMA 2ZQSA 2XP9A 2MLYA 4LAWA 1J4IA 1ZBCA 4DWSA 4L72B 3RM4A 1JNTA 4DRQA 1FKFA 2MLXA 3JXVA 2IF4A 1J6YA 1X6LA 3WD2A 2MF9A 1ITXA 4WIWA 1HKKA 5DEZA 3WD4A 3UI5A 2DSZA 3ARRA 3O5LA 2M1IA 4MGVA 4FAPA 1K9TA 1LL7A 3ARUA 1EDQA 4JFLA 2PV1A 4NSBA 4J4OA 1FKDA 2Y78A 3O5RA 2N87A 3AS0A 3RGCA 3CH9A 4TNSA 1LL6A 1ZBWA 3RMEA 1ZL1A 4LAVA 4W9OA 2RSEA 1JNDA 3I6CA 4O2TA 1Q6IA 4C02B 1QZ2A 5DIUA 4GIVA 2XP4A 2XP6A 3WKZA 1PINA 3OA5A 4MNJA 4ZS6A 4DZ3A 3AS2A 3IHZA 4JFMA 1C9HA 1OWQA 1HXVA 5HW6A 4IQCA 4IT6A 2YBTA 3AS1A 5HTGA 5J6EA 5I98A 3ALGA 2PV3A 5DITA 3ARQA 1FFRA 2A3CA 1VF8A 5HWBA 3WIJA 1OGGA 4MPKA 4G2PA 2F21A 3JYJA 3O5JA 2D9FA 3PA7A 2XP5A 2ESCA 2KI3A 3O5QA 1EIBA 3KZ7A 4U85A 4HBOA 2A3EA 4Z2HA 2DT3A 4MTVA 1FKTA 3TCZA 3AQUA 1FFQA 3O5IA 1HJXA 1NSGA 4DWSD 4U86A 3IKGA 4ML4A 1LG1A 3UQAA 1OGBA 2RURA 1IX5A 2AOSA 2DT2A 3BXWA 4KQZA 1PBKA 2OFNA 3B9AA 4ZPWR 5HW7A 4DRIA 4DIPA 1LL4A 2QF8A 3WD0A 4URIA 1N1AA 3ODKA 3G6LA 4WKHA 1HJWA 1M5YA 2FAPA 4QT2A 1B6CA 4ODMA 2LGOA 2PI6A 4WJXA 4NNRA 1Q6HA 2RUQA 3UQBA 5GPRA 4LGXA 1KT1A 4LAXA 2MLZA 5DIVA 2F4EA 1TCOC 4AY1A 5HWCA 1W1YA 1YATA 2ZR6A 5GQBA 1JVWA 2K8IA 3ARZA 1O6IA 3ARVA 3WQWA 4DT4A 4MSPA 1W9PA 3NRKA 1NWTA 2XP8A 4JFKA 3ARPA 2KGJA 4DRKA 1E6RA 1FKKA 1F8AB 3GPKA 1JNEA 2KR7A 2LJ4A 3KAHA 2ITKA 4Z2JA 4DH0A 2YBUA 4TW7A 3WL1A 3LUOA 3RM9A 1FKLA 3KAGA 2XP3A 1E6PA 3EY6A 1FKRA 1NWSA 1SYTA 4IT4A 1FJDA 2DSWA 1X6NA 1WB0A 1KT0A 2RUCA 1W9VA 3MDYB 2DPEA 3UF8A 1J4HA 2JZVA 1WAWA 2A3BA 3B8SA 3G6MA 1GOIA 5JH8A 4W9PA 3ARTA 2L2SA 1QPFA 4NZCA 2AWGA 1FKIA 4HARA 1T11A 3PRBA 1RD6A 4DRMA 1F40A 1FKSA 3PRAA 1FAPA 2ZQVA 1L1PA 4ODKA 2G41A 4DROA 1E6ZA 4P8VA 2MPHA 1U79A 3WH0A 4R0XA 1W1TA 4DRHA 3O5OA 2DG3A 5B8IC 3O5FA 4MNKA 3W4RA 4ODOA 2FKEA 1H0IA 5DO2A 3FY1A 4TX0A 1FKHA 2WLZA 3NI6A 1HKMA 3CHCA 4U84A 1SR0A 2ZR4A 2PBCA 1NMWA 1FKGA 1A7XA 4J4NA 2ZQUA 3PRDA 1E9LA 4ZPTR 1EQ3A 2UZ5A 3ARWA 5HKGA 4ODPA 1UR8A 3FXYA 4JYSA 4QIBA 3B9EA 4IPXA 4R5EA 1XHGA 3AS3A 4ODQA 3TDBA 5HT1A 4Q22A 1HKIA 2WLYA 4S3KA 2VCDA 1H0GA 2WK2A 1W26A 2DT1A 2XPAA 4FN2A 4Z2IA 1Q6UA 2KFWA 2A3AA 2DG4A 5HBFA 5HUAA 4TYOA 3ARSA 1KFWA 2LPVA 1P5QA 3AROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP3 A;  3EY6 A;  1ROT A;  3KAB A;  3O5K A;  1FKR A;  3IHZ A;  3KAD A;  4TW8 A;  3TC5 A;  4JFM A;  1C9H A;  2MNT A;  3O5E A;  4DRN A;  4BF8 A;  3OOB A;  1HXV A;  1FKB A;  3NTP A;  3B7X A;  1FJD A;  5HW6 A;  1KT0 A;  4DRP A;  2DG9 A;  4IQC A;  2RUC A;  1BL4 A;  3MDY B;  2M2A A;  1ROU A;  4ODL A;  5D75 A;  3UF8 A;  2XP7 A;  3KCE A;  5BXJ A;  1J4H A;  1J4R A;  3FAP A;  4ODR A;  2JZV A;  5HTG A;  2XPB A;  5J6E A;  5I98 A;  3CGM A;  2PV3 A;  5DIT A;  1QPL A;  4LAY A;  5HWB A;  4W9P A;  3H9R B;  2L2S A;  1QPF A;  2Q5A A;  4G2P A;  2F2D A;  4QT3 A;  3UQI A;  2F21 A;  2AWG A;  1FKI A;  1T11 A;  3O5D A;  5GPG A;  3JYJ A;  3CGN A;  3O5J A;  3PRB A;  3O5G A;  2D9F A;  1YW5 A;  3O5P A;  2XP5 A;  3PA7 A;  4IQ2 A;  4ODN A;  4DRM A;  2KI3 A;  3O5Q A;  1F40 A;  1FKS A;  3KZ7 A;  4U85 A;  1FAP A;  2ZQV A;  1JNS A;  3O5M A;  1L1P A;  4ODK A;  4DRO A;  2LKN A;  1ZK6 A;  2ZQT A;  1FKT A;  3VAW A;  3TCZ A;  1ZCN A;  2MPH A;  1U79 A;  2KE0 A;  4R0X A;  3WH0 A;  4ITZ A;  3UI4 A;  2ZQS A;  2XP9 A;  2MLY A;  3O5I A;  4DRH A;  3O5O A;  2DG3 A;  1NSG A;  1FD9 A;  3IKD A;  4U86 A;  3IKG A;  2ZR5 A;  5B8I C;  4LAW A;  1J4I A;  3O5F A;  3RFW A;  2PPO A;  3UQA A;  4TW6 A;  2RUR A;  4ODO A;  2FKE A;  2PPN A;  3IK8 A;  1PBK A;  1JNT A;  2OFN A;  4TX0 A;  1FKH A;  4DRQ A;  2M08 A;  3NI6 A;  4DZ2 A;  1FKF A;  2MLX A;  3JXV A;  4DRI A;  4DRJ A;  5HW7 A;  4DIP A;  2IF4 A;  1J6Y A;  4U84 A;  2ZR4 A;  1N1A A;  2PBC A;  1NMW A;  1FKG A;  1A7X A;  2MF9 A;  3JYM A;  2VN1 A;  2PV2 A;  2ZQU A;  3ODK A;  4J4N A;  4W9Q A;  3KAC A;  3PRD A;  1EQ3 A;  1M5Y A;  2FAP A;  2UZ5 A;  4QT2 A;  3UI5 A;  1B6C A;  4ODM A;  2LGO A;  2PPP A;  5HKG A;  4ODP A;  4NNR A;  3O5L A;  1Q6H A;  2M1I A;  2RUQ A;  3UQB A;  1KT1 A;  3KAI A;  3KAF A;  4LAX A;  2MLZ A;  4MGV A;  4FAP A;  5DIV A;  2F4E A;  1TCO C;  4JYS A;  1Y0O A;  4QIB A;  4JFL A;  4IPX A;  1BKF A;  5HWC A;  2PV1 A;  4N19 A;  1YAT A;  1EYM A;  1FKD A;  1D7I A;  2Y78 A;  4J4O A;  4ODQ A;  3TDB A;  3UI6 A;  2ZR6 A;  5HT1 A;  3O5R A;  5HW8 A;  1JVW A;  2K8I A;  2RUD A;  2N87 A;  1R9H A;  1Q1C A;  2VCD A;  3RGC A;  1D6O A;  4DT4 A;  1W26 A;  2XPA A;  4MSP A;  3NRK A;  4TNS A;  1D7J A;  2XP8 A;  4LAV A;  4JFK A;  4W9O A;  2RSE A;  2KGJ A;  3I6C A;  4O2T A;  4DRK A;  4FN2 A;  1NMV A;  1Q6I A;  4C02 B;  1QZ2 A;  4JFJ A;  4JFI A;  4GGQ A;  2RQS A;  4GIV A;  1Q6U A;  5DIU A;  1FKK A;  2KFW A;  1F8A B;  2XP4 A;  3GPK A;  4G50 A;  2KO7 A;  2XP6 A;  2DG4 A;  2KR7 A;  1D7H A;  2LJ4 A;  2ITK A;  3KAH A;  5HUA A;  1FKJ A;  4DH0 A;  4TYO A;  4TW7 A;  2LPV A;  1P5Q A;  1PIN A;  4DZ3 A;  3LUO A;  1FKL A;  3KAG A; 
#chains in the Genus database with same CATH topology
 3KAB A;  1ROT A;  3O5K A;  4HBE A;  3KAD A;  4TW8 A;  4W5U A;  1E15 A;  3O5E A;  4DRN A;  4BF8 A;  1FKB A;  3B7X A;  4MNL A;  1JCH B;  4DRP A;  3CHF A;  2G8Z A;  1BL4 A;  2M2A A;  1ROU A;  4ODL A;  3WQV A;  4ODR A;  4KR0 B;  4P8U A;  1WNO A;  1QPL A;  4LAY A;  3WD3 A;  3GTY X;  2DSU A;  1HKJ A;  2F2D A;  2B5U B;  1NH6 A;  2F23 A;  3CGN A;  4IQ2 A;  3O5P A;  4ODN A;  4WKA A;  4DWS C;  3WD1 A;  4Z2G A;  2LKN A;  1ZK6 A;  2ZQT A;  1E6N A;  4WK9 A;  4Z2K A;  1ZCN A;  4ITZ A;  3UI4 A;  2DSV A;  3QOK A;  3B9D A;  4P8X A;  3IKD A;  1FD9 A;  2ZR5 A;  2IUZ A;  3RFW A;  1LQ0 A;  2PPO A;  4TW6 A;  3ALF A;  4P8W A;  2PPN A;  3IK8 A;  3WL0 A;  1UR9 A;  2M08 A;  3CHE A;  4DZ2 A;  4DRJ A;  3ARY A;  4S3J A;  4L3N A;  1ZU8 A;  3JYM A;  2VN1 A;  2PV2 A;  3EIP A;  4W9Q A;  3KAC A;  4ZPV R;  1LG2 A;  1ZB5 A;  2PPP A;  1TFV A;  2DT0 A;  3KAI A;  3KAF A;  1Y0O A;  1XRV A;  1BKF A;  4N19 A;  1EYM A;  1D7I A;  3UI6 A;  5HW8 A;  1ZBV A;  2RUD A;  2B31 A;  1R9H A;  1Q1C A;  2P4V A;  1D6O A;  1W9U A;  4PTM A;  1D7J A;  3PR9 A;  1NWR A;  1NMV A;  4JFI A;  4GGQ A;  2RQS A;  1W1P A;  1HJV A;  4G50 A;  2KO7 A;  1D7H A;  1FKJ A;  1ZBK A;  3BMB A;  1D2K A;  1NWU A;  4JFJ A;  2OLH A;  2FDM A;  3TC5 A;  1GPF A;  2MNT A;  2O92 A;  3OOB A;  3NTP A;  2O9O A;  3RM8 A;  2DG9 A;  1W1V A;  5DF0 A;  4Q7N A;  2WM0 A;  4MAV A;  5D75 A;  2XP7 A;  3KCE A;  5BXJ A;  1J4R A;  3FAP A;  2XPB A;  3CHD A;  3CGM A;  4Z2L A;  1CTN A;  3CZ8 A;  3H9R B;  2PN0 A;  2Q5A A;  4QT3 A;  3UQI A;  3O5D A;  5GPG A;  3O5G A;  4WKF A;  1YW5 A;  3ARX A;  1EHN A;  1JNS A;  3O5M A;  4DWS B;  1LJY A;  1GUV A;  3VAW A;  2KE0 A;  4QZV B;  4XAK A;  4MNM A;  2EUL A;  2ZQS A;  2XP9 A;  2MLY A;  4LAW A;  1J4I A;  1ZBC A;  4DWS A;  4L72 B;  3RM4 A;  1JNT A;  4DRQ A;  1FKF A;  2MLX A;  3JXV A;  2IF4 A;  1J6Y A;  1X6L A;  3WD2 A;  2MF9 A;  1ITX A;  4WIW A;  1HKK A;  5DEZ A;  3WD4 A;  3UI5 A;  2DSZ A;  3ARR A;  3O5L A;  2M1I A;  4MGV A;  4FAP A;  1K9T A;  1LL7 A;  3ARU A;  1EDQ A;  4JFL A;  2PV1 A;  4NSB A;  4J4O A;  1FKD A;  2Y78 A;  3O5R A;  2N87 A;  3AS0 A;  3RGC A;  3CH9 A;  4TNS A;  1LL6 A;  1ZBW A;  3RME A;  1ZL1 A;  4LAV A;  4W9O A;  2RSE A;  1JND A;  3I6C A;  4O2T A;  1Q6I A;  4C02 B;  1QZ2 A;  5DIU A;  4GIV A;  2XP4 A;  2XP6 A;  3WKZ A;  1PIN A;  3OA5 A;  4MNJ A;  4ZS6 A;  4DZ3 A;  3AS2 A;  3IHZ A;  4JFM A;  1C9H A;  1OWQ A;  1HXV A;  5HW6 A;  4IQC A;  4IT6 A;  3GU0 A;  2YBT A;  3AS1 A;  5HTG A;  5J6E A;  5I98 A;  3ALG A;  2PV3 A;  5DIT A;  3ARQ A;  1FFR A;  2A3C A;  1VF8 A;  5HWB A;  3WIJ A;  1OGG A;  4MPK A;  4G2P A;  2F21 A;  3JYJ A;  3O5J A;  2D9F A;  3PA7 A;  2XP5 A;  2ESC A;  2KI3 A;  3O5Q A;  1EIB A;  3KZ7 A;  4U85 A;  4HBO A;  2A3E A;  4Z2H A;  2DT3 A;  4MTV A;  1FKT A;  3TCZ A;  3AQU A;  1FFQ A;  3O5I A;  1HJX A;  1NSG A;  4DWS D;  4U86 A;  3IKG A;  4ML4 A;  1LG1 A;  3UQA A;  1OGB A;  2RUR A;  1IX5 A;  2AOS A;  2DT2 A;  3BXW A;  4KQZ A;  1PBK A;  2OFN A;  3B9A A;  4ZPW R;  5HW7 A;  4DRI A;  4DIP A;  1LL4 A;  2QF8 A;  3WD0 A;  4URI A;  1N1A A;  3ODK A;  2ETN A;  3G6L A;  4WKH A;  1HJW A;  1M5Y A;  2FAP A;  4QT2 A;  1B6C A;  4ODM A;  2LGO A;  2PI6 A;  4WJX A;  4NNR A;  1Q6H A;  2RUQ A;  3UQB A;  5GPR A;  4LGX A;  1KT1 A;  4LAX A;  2MLZ A;  5DIV A;  2F4E A;  1TCO C;  4AY1 A;  5HWC A;  1W1Y A;  1YAT A;  2ZR6 A;  5GQB A;  1JVW A;  2K8I A;  3ARZ A;  1O6I A;  3ARV A;  3WQW A;  4DT4 A;  4MSP A;  1W9P A;  3NRK A;  1NWT A;  2XP8 A;  4JFK A;  3ARP A;  2KGJ A;  4DRK A;  1E6R A;  1FKK A;  1F8A B;  3GPK A;  1JNE A;  2KR7 A;  2LJ4 A;  3KAH A;  2ITK A;  4Z2J A;  4DH0 A;  2YBU A;  4TW7 A;  3WL1 A;  3LUO A;  3RM9 A;  1FKL A;  3KAG A;  2XP3 A;  1E6P A;  3EY6 A;  1FKR A;  1NWS A;  1SYT A;  4IT4 A;  4UDM A;  1FJD A;  2DSW A;  1X6N A;  1WB0 A;  1KT0 A;  2RUC A;  1W9V A;  3MDY B;  2DPE A;  3UF8 A;  1J4H A;  2JZV A;  1WAW A;  2A3B A;  3B8S A;  3G6M A;  1GOI A;  5JH8 A;  4W9P A;  3ART A;  2L2S A;  1QPF A;  4NZC A;  2AWG A;  1FKI A;  1GRJ A;  4HAR A;  1T11 A;  3PRB A;  1RD6 A;  4DRM A;  1F40 A;  1FKS A;  3PRA A;  1FAP A;  2ZQV A;  1L1P A;  4ODK A;  2G41 A;  4DRO A;  1E6Z A;  4P8V A;  2MPH A;  1U79 A;  3WH0 A;  4R0X A;  1W1T A;  4DRH A;  3O5O A;  2DG3 A;  5B8I C;  3O5F A;  1E44 A;  4MNK A;  3W4R A;  4ODO A;  2FKE A;  1H0I A;  5DO2 A;  3FY1 A;  4TX0 A;  1FKH A;  2WLZ A;  3NI6 A;  1HKM A;  3CHC A;  4U84 A;  1SR0 A;  2ZR4 A;  2PBC A;  1NMW A;  1FKG A;  1A7X A;  4J4N A;  2ZQU A;  3PRD A;  1E9L A;  4ZPT R;  1EQ3 A;  2UZ5 A;  3ARW A;  5HKG A;  4ODP A;  1UR8 A;  3FXY A;  4JYS A;  4QIB A;  3B9E A;  4IPX A;  4R5E A;  1XHG A;  3AS3 A;  4ODQ A;  3TDB A;  5HT1 A;  4Q22 A;  1HKI A;  2WLY A;  4S3K A;  2VCD A;  1H0G A;  2WK2 A;  1W26 A;  2DT1 A;  2XPA A;  4FN2 A;  4Z2I A;  1Q6U A;  2KFW A;  2A3A A;  2DG4 A;  5HBF A;  5HUA A;  4TYO A;  3ARS A;  1KFW A;  2LPV A;  1P5Q A;  3ARO A; 
#chains in the Genus database with same CATH homology
 3KAB A;  1ROT A;  3O5K A;  4HBE A;  3KAD A;  4TW8 A;  4W5U A;  1E15 A;  3O5E A;  4DRN A;  4BF8 A;  1FKB A;  3B7X A;  4MNL A;  4DRP A;  3CHF A;  2G8Z A;  1BL4 A;  2M2A A;  1ROU A;  4ODL A;  3WQV A;  4ODR A;  4KR0 B;  4P8U A;  1WNO A;  1QPL A;  4LAY A;  3WD3 A;  2DSU A;  1HKJ A;  2F2D A;  1NH6 A;  3CGN A;  4IQ2 A;  3O5P A;  4ODN A;  4WKA A;  4DWS C;  3WD1 A;  4Z2G A;  2LKN A;  1ZK6 A;  2ZQT A;  1E6N A;  4WK9 A;  4Z2K A;  1ZCN A;  4ITZ A;  3UI4 A;  2DSV A;  3QOK A;  3B9D A;  4P8X A;  3IKD A;  1FD9 A;  2ZR5 A;  2IUZ A;  3RFW A;  1LQ0 A;  2PPO A;  4TW6 A;  3ALF A;  4P8W A;  2PPN A;  3IK8 A;  3WL0 A;  1UR9 A;  2M08 A;  3CHE A;  4DZ2 A;  4DRJ A;  3ARY A;  4S3J A;  4L3N A;  1ZU8 A;  3JYM A;  2VN1 A;  2PV2 A;  4W9Q A;  3KAC A;  4ZPV R;  1LG2 A;  1ZB5 A;  2PPP A;  1TFV A;  2DT0 A;  3KAI A;  3KAF A;  1Y0O A;  1XRV A;  1BKF A;  4N19 A;  1EYM A;  1D7I A;  3UI6 A;  5HW8 A;  1ZBV A;  2RUD A;  2B31 A;  1R9H A;  1Q1C A;  1D6O A;  1W9U A;  4PTM A;  1D7J A;  3PR9 A;  1NWR A;  1NMV A;  4JFI A;  4GGQ A;  2RQS A;  1W1P A;  1HJV A;  4G50 A;  2KO7 A;  1D7H A;  1FKJ A;  1ZBK A;  1D2K A;  1NWU A;  4JFJ A;  2OLH A;  2FDM A;  3TC5 A;  1GPF A;  2MNT A;  2O92 A;  3OOB A;  3NTP A;  2O9O A;  3RM8 A;  2DG9 A;  1W1V A;  5DF0 A;  4Q7N A;  2WM0 A;  4MAV A;  5D75 A;  2XP7 A;  3KCE A;  5BXJ A;  1J4R A;  3FAP A;  2XPB A;  3CHD A;  3CGM A;  4Z2L A;  1CTN A;  3CZ8 A;  3H9R B;  2Q5A A;  4QT3 A;  3UQI A;  3O5D A;  5GPG A;  3O5G A;  4WKF A;  1YW5 A;  3ARX A;  1EHN A;  1JNS A;  3O5M A;  4DWS B;  1LJY A;  1GUV A;  3VAW A;  2KE0 A;  4QZV B;  4XAK A;  4MNM A;  2ZQS A;  2XP9 A;  2MLY A;  4LAW A;  1J4I A;  1ZBC A;  4DWS A;  4L72 B;  3RM4 A;  1JNT A;  4DRQ A;  1FKF A;  2MLX A;  3JXV A;  2IF4 A;  1J6Y A;  1X6L A;  3WD2 A;  2MF9 A;  1ITX A;  4WIW A;  1HKK A;  5DEZ A;  3WD4 A;  3UI5 A;  2DSZ A;  3ARR A;  3O5L A;  2M1I A;  4MGV A;  4FAP A;  1K9T A;  1LL7 A;  3ARU A;  1EDQ A;  4JFL A;  2PV1 A;  4NSB A;  4J4O A;  1FKD A;  2Y78 A;  3O5R A;  2N87 A;  3AS0 A;  3RGC A;  3CH9 A;  4TNS A;  1LL6 A;  1ZBW A;  3RME A;  1ZL1 A;  4LAV A;  4W9O A;  2RSE A;  1JND A;  3I6C A;  4O2T A;  1Q6I A;  4C02 B;  1QZ2 A;  5DIU A;  4GIV A;  2XP4 A;  2XP6 A;  3WKZ A;  1PIN A;  3OA5 A;  4MNJ A;  4ZS6 A;  4DZ3 A;  3AS2 A;  3IHZ A;  4JFM A;  1C9H A;  1OWQ A;  1HXV A;  5HW6 A;  4IQC A;  4IT6 A;  2YBT A;  3AS1 A;  5HTG A;  5J6E A;  5I98 A;  3ALG A;  2PV3 A;  5DIT A;  3ARQ A;  1FFR A;  2A3C A;  1VF8 A;  5HWB A;  3WIJ A;  1OGG A;  4MPK A;  4G2P A;  2F21 A;  3JYJ A;  3O5J A;  2D9F A;  3PA7 A;  2XP5 A;  2ESC A;  2KI3 A;  3O5Q A;  1EIB A;  3KZ7 A;  4U85 A;  4HBO A;  2A3E A;  4Z2H A;  2DT3 A;  4MTV A;  1FKT A;  3TCZ A;  3AQU A;  1FFQ A;  3O5I A;  1HJX A;  1NSG A;  4DWS D;  4U86 A;  3IKG A;  4ML4 A;  1LG1 A;  3UQA A;  1OGB A;  2RUR A;  1IX5 A;  2AOS A;  2DT2 A;  3BXW A;  4KQZ A;  1PBK A;  2OFN A;  3B9A A;  4ZPW R;  5HW7 A;  4DRI A;  4DIP A;  1LL4 A;  2QF8 A;  3WD0 A;  4URI A;  1N1A A;  3ODK A;  3G6L A;  4WKH A;  1HJW A;  1M5Y A;  2FAP A;  4QT2 A;  1B6C A;  4ODM A;  2LGO A;  2PI6 A;  4WJX A;  4NNR A;  1Q6H A;  2RUQ A;  3UQB A;  5GPR A;  4LGX A;  1KT1 A;  4LAX A;  2MLZ A;  5DIV A;  2F4E A;  1TCO C;  4AY1 A;  5HWC A;  1W1Y A;  1YAT A;  2ZR6 A;  5GQB A;  1JVW A;  2K8I A;  3ARZ A;  1O6I A;  3ARV A;  3WQW A;  4DT4 A;  4MSP A;  1W9P A;  3NRK A;  1NWT A;  2XP8 A;  4JFK A;  3ARP A;  2KGJ A;  4DRK A;  1E6R A;  1FKK A;  1F8A B;  3GPK A;  1JNE A;  2KR7 A;  2LJ4 A;  3KAH A;  2ITK A;  4Z2J A;  4DH0 A;  2YBU A;  4TW7 A;  3WL1 A;  3LUO A;  3RM9 A;  1FKL A;  3KAG A;  2XP3 A;  1E6P A;  3EY6 A;  1FKR A;  1NWS A;  1SYT A;  4IT4 A;  1FJD A;  2DSW A;  1X6N A;  1WB0 A;  1KT0 A;  2RUC A;  1W9V A;  3MDY B;  2DPE A;  3UF8 A;  1J4H A;  2JZV A;  1WAW A;  2A3B A;  3B8S A;  3G6M A;  1GOI A;  5JH8 A;  4W9P A;  3ART A;  2L2S A;  1QPF A;  4NZC A;  2AWG A;  1FKI A;  4HAR A;  1T11 A;  3PRB A;  1RD6 A;  4DRM A;  1F40 A;  1FKS A;  3PRA A;  1FAP A;  2ZQV A;  1L1P A;  4ODK A;  2G41 A;  4DRO A;  1E6Z A;  4P8V A;  2MPH A;  1U79 A;  3WH0 A;  4R0X A;  1W1T A;  4DRH A;  3O5O A;  2DG3 A;  5B8I C;  3O5F A;  4MNK A;  3W4R A;  4ODO A;  2FKE A;  1H0I A;  5DO2 A;  3FY1 A;  4TX0 A;  1FKH A;  2WLZ A;  3NI6 A;  1HKM A;  3CHC A;  4U84 A;  1SR0 A;  2ZR4 A;  2PBC A;  1NMW A;  1FKG A;  1A7X A;  4J4N A;  2ZQU A;  3PRD A;  1E9L A;  4ZPT R;  1EQ3 A;  2UZ5 A;  3ARW A;  5HKG A;  4ODP A;  1UR8 A;  3FXY A;  4JYS A;  4QIB A;  3B9E A;  4IPX A;  4R5E A;  1XHG A;  3AS3 A;  4ODQ A;  3TDB A;  5HT1 A;  4Q22 A;  1HKI A;  2WLY A;  4S3K A;  2VCD A;  1H0G A;  2WK2 A;  1W26 A;  2DT1 A;  2XPA A;  4FN2 A;  4Z2I A;  1Q6U A;  2KFW A;  2A3A A;  2DG4 A;  5HBF A;  5HUA A;  4TYO A;  3ARS A;  1KFW A;  2LPV A;  1P5Q A;  3ARO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...