2F2DA

Solution structure of the fk506-binding domain of human fkbp38
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
121
structure length
121
Chain Sequence
MREWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the FK506-Binding Domain of Human FKBP38
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords 38 kDa FK-506 binding protein homolog, FKBP38
total genus 11
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f2dA00
3IHZA 1W26A 2ZR5A 3KACA 4N19A 4TX0A 4C02B 4DRNA 1PBKA 3EY6A 2RURA 3NI6A 4LAWA 1FJDA 2KR7A 1JVWA 1NMVA 3O5JA 1ROUA 2FKEA 2K8IA 1FKDA 1D7JA 1FKIA 4DRIA 4GIVA 2LPVA 4TNSA 3PRBA 4ODKA 4QT2A 3WH0A 4JYSA 1F40A 3B7XA 3UI5A 2M1IA 4U84A 5DITA 1FKBA 1NSGA 2XP6A 5D75A 3O5IA 5HUAA 2PV1A 4ODOA 3KAGA 2RUCA 1B6CA 1KT0A 4JFIA 1D7HA 2MLYA 4W9PA 4DH0A 2F21A 4ODRA 4DRHA 4W9OA 4IQCA 4DIPA 2LJ4A 1FKLA 3CGMA 3JYJA 4ITZA 5BXJA 1C9HA 2KI3A 2OFNA 1FKFA 1J4IA 1Q1CA 1P5QA 2RUDA 3JXVA 2MPHA 4TW8A 3LUOA 2XP7A 4G50A 5HW7A 2RQSA 1FAPA 3IK8A 1F8AB 1QPLA 3UI4A 4MSPA 2XP5A 2MLXA 1R9HA 3KADA 2DG4A 3O5PA 4QIBA 2DG3A 4FAPA 1J4RA 3GPKA 4NNRA 2F4EA 2F2DA 2KE0A 1Q6UA 2PBCA 5HWCA 2PV3A 3H9RB 1Q6HA 4ODMA 4QT3A 4DRPA 4DZ2A 1NMWA 4ODNA 4O2TA 4ODQA 2Y78A 1FKJA 3UF8A 2XP4A 1KT1A 2LKNA 5HW6A 4LAVA 2PPPA 2XPBA 3RGCA 3TDBA 3NRKA 5DIUA 1JNSA 3PA7A 3PRDA 2VCDA 1QZ2A 2XP8A 5HWBA 2PPNA 3O5LA 2RSEA 4DRJA 3UQAA 5J6EA 4DRMA 1D7IA 2LGOA 4LAYA 1FKSA 5HKGA 2IF4A 3KAIA 2RUQA 3KAFA 4JFJA 3UI6A 3UQIA 2XP9A 2MF9A 1YATA 2XPAA 2PPOA 3O5QA 4DRQA 4DZ3A 2KFWA 2DG9A 4IPXA 1U79A 5HT1A 2L2SA 4JFKA 1FKTA 3KCEA 4U85A 3RFWA 3KABA 2KGJA 4G2PA 1FD9A 4DT4A 1HXVA 4TYOA 4J4NA 5DIVA 3NTPA 1EQ3A 4U86A 3IKDA 3FAPA 1JNTA 4LAXA 2VN1A 1FKHA 1M5YA 4IQ2A 3VAWA 4BF8A 1BL4A 1N1AA 1PINA 2Q5AA 3I6CA 3TC5A 5HTGA 5B8IC 1TCOC 3ODKA 2ITKA 5GPGA 3O5FA 4GGQA 3TCZA 1T11A 1ZCNA 1FKKA 1A7XA 3KAHA 4DROA 1Q6IA 3O5KA 1FKRA 1EYMA 2PV2A 1J4HA 2XP3A 4TW6A 2ZQSA 2MNTA 1YW5A 2ZR4A 3O5OA 3JYMA 4DRKA 3UQBA 2JZVA 3O5DA 3O5GA 4TW7A 1J6YA 4ODPA 2D9FA 4MGVA 5I98A 4R0XA 1ZK6A 2UZ5A 4W9QA 2MLZA 1Y0OA 2KO7A 2N87A 3O5MA 4JFLA 2ZQVA 1D6OA 2FAPA 1QPFA 3IKGA 4JFMA 5HW8A 1L1PA 2M2AA 2ZQUA 2M08A 3O5RA 4FN2A 1BKFA 3KZ7A 4J4OA 3MDYB 3O5EA 2ZR6A 1ROTA 3OOBA 4ODLA 1FKGA 2ZQTA 3CGNA 2AWGA
chains in the Genus database with same CATH superfamily
2ETNA 4C02B 2RURA 3NI6A 1FJDA 2YBTA 4NSBA 1JVWA 3W4RA 3AS1A 1D7JA 3ARSA 1LG2A 4TNSA 2O92A 1F40A 3BMBA 4MNJA 3PR9A 2XP6A 1OWQA 5D75A 3GU0A 4Z2JA 1B6CA 1KT0A 4JFIA 4WKHA 4HBOA 3ARYA 4IQCA 1FKLA 3JYJA 4DWSD 1C9HA 3AROA 2OFNA 1FKFA 5GPRA 2A3BA 2RUDA 2DSWA 4XAKA 2XP7A 4L3NA 3UI4A 1FAPA 3IK8A 2AOSA 3GTYX 4MSPA 3RM4A 1HJVA 2MLXA 1HJWA 3KADA 1JCHB 1K9TA 3O5PA 4NNRA 2F4EA 2KE0A 1HJXA 1NMWA 4ODNA 4O2TA 3UF8A 2XP4A 2DSVA 2LKNA 1NWRA 1NWSA 3RGCA 3NRKA 5DIUA 1JNSA 3PA7A 2A3CA 2PPNA 4DRJA 2LGOA 1JNEA 4LAYA 3WKZA 3KAFA 1VF8A 4IT4A 2XPAA 4DZ3A 3O5QA 3G6MA 4DRQA 2KFWA 4MTVA 1FKTA 3KCEA 3KABA 1FD9A 1D2KA 1EQ3A 1JNTA 1TFVA 1M5YA 4IQ2A 4BF8A 4MPKA 3TC5A 4ZPWR 1LL6A 1A7XA 1XHGA 1FKRA 1X6LA 2XP3A 3ARWA 4R5EA 2MNTA 4DWSA 4W5UA 1YW5A 2ZR4A 2JZVA 3O5DA 3O5GA 1LL7A 1GRJA 4TW7A 1J6YA 4W9QA 2KO7A 2FAPA 1QPFA 3ARUA 1EIBA 1GPFA 1WB0A 5HW8A 3WQVA 3OOBA 1ROTA 2DT0A 3IHZA 1O6IA 1ZL1A 4LAWA 3O5JA 1ROUA 2FKEA 2K8IA 4DRIA 2F23A 3ALFA 2M1IA 4U84A 1LL4A 3O5IA 5HUAA 5JH8A 4ODOA 3KAGA 4MNKA 4DH0A 1ZBWA 1W1YA 3CZ8A 4S3JA 3WD3A 2KI3A 1J4IA 3RMEA 2MPHA 4G50A 5HW7A 1ZBVA 1R9HA 4QIBA 2DG3A 1NH6A 1OGGA 3BXWA 3RM9A 3WL1A 3AS3A 2PV3A 5HWCA 1Q6HA 4ODMA 4QT3A 3WD2A 4Z2GA 2G41A 1CTNA 1KT1A 1GUVA 2DSUA 2XPBA 1E6ZA 3QOKA 4Z2IA 3CH9A 3O5LA 2RSEA 4DRMA 4WIWA 1FKSA 1W1VA 2RUQA 1YATA 3RM8A 2PPOA 1RD6A 1ZU8A 1U79A 1LJYA 2KGJA 4HBEA 4DT4A 4IT6A 4U86A 2FDMA 2VN1A 1SR0A 1N1AA 4P8VA 4NZCA 3B8SA 5B8IC 1LQ0A 3O5FA 2WK2A 3TCZA 1T11A 1ZCNA 4DROA 1ZBCA 3ARTA 3O5KA 3OA5A 2PV2A 3CHCA 4R0XA 1ZK6A 1Y0OA 2N87A 4JFLA 1D6OA 3ARVA 5DF0A 3ARXA 1BKFA 3WD0A 2QF8A 1HKKA 3CGNA 2AWGA 1W26A 3KACA 4N19A 4DRNA 1PBKA 1E6RA 3ARZA 3EY6A 1H0GA 2A3EA 1FKDA 1W1PA 2WLYA 3WD1A 1FKIA 2P4VA 4ODKA 4QT2A 1ZBKA 3WH0A 4JYSA 3UI5A 4ZPTR 2DPEA 5DITA 3AS0A 1FKBA 3B9EA 5HBFA 1W9VA 2PV1A 2RUCA 4W9PA 2MLYA 2PN0A 3ARPA 4DRHA 4W9OA 4DIPA 2LJ4A 2O9OA 3CGMA 5BXJA 3G6LA 4ZS6A 1HKMA 1P5QA 3JXVA 2WLZA 4S3KA 4TW8A 5GQBA 3LUOA 4UDMA 2RQSA 1J4RA 2F2DA 4HARA 1Q6UA 2PBCA 3AQUA 4DRPA 4ODQA 2Y78A 1KFWA 5HW6A 4MNMA 4LAVA 2PPPA 3ARQA 2VCDA 1E6NA 1QZ2A 2XP8A 5HWBA 2B31A 5J6EA 5HKGA 3B9AA 4JFJA 3CHEA 2XP9A 1NWTA 4WK9A 2DG9A 3WD4A 4WKFA 2DT2A 1HXVA 1OGBA 4J4NA 3NTPA 1H0IA 4MAVA 3IKDA 4QZVB 3FAPA 4LAXA 4LGXA 4WKAA 1X6NA 1BL4A 1PINA 3I6CA 3ODKA 1WAWA 1ZB5A 2ITKA 4GGQA 4Q7NA 1Q6IA 1J4HA 4TW6A 4KR0B 4DRKA 3UQBA 3JYMA 1W1TA 4L72B 4MGVA 4ODPA 5I98A 2MLZA 1LG1A 1IX5A 2WM0A 1EDQA 1GOIA 2M2AA 2M08A 2ZQUA 3EIPA 3O5RA 4FN2A 1W9UA 3MDYB 2ESCA 1SYTA 2ZR6A 2EULA 1FKGA 2IUZA 1ITXA 2ZR5A 1FFRA 4TX0A 1UR9A 3ALGA 2KR7A 4ML4A 1NMVA 4PTMA 4ZPVR 4GIVA 2LPVA 2PI6A 3PRBA 3B7XA 4Z2LA 1EHNA 1NSGA 4WJXA 1E15A 1XRVA 1D7HA 1WNOA 4URIA 2F21A 4ODRA 5DO2A 4ITZA 3FXYA 4DWSB 1Q1CA 3WQWA 1F8AB 1QPLA 2DSZA 2XP5A 4P8XA 2DG4A 4FAPA 2G8ZA 3GPKA 3H9RB 2YBUA 4DZ2A 2DT3A 3B9DA 1FKJA 4DWSC 3TDBA 3PRDA 4KQZA 3UQAA 1D7IA 2OLHA 2IF4A 3KAIA 3FY1A 3UI6A 3UQIA 2MF9A 1FFQA 4IPXA 2DT1A 4Z2KA 1UR8A 3AS2A 4P8WA 5HT1A 2L2SA 4JFKA 4U85A 3RFWA 4G2PA 1W9PA 4TYOA 5DIVA 1E44A 4Q22A 1FKHA 3VAWA 5DEZA 5HTGA 2Q5AA 4Z2HA 1TCOC 5GPGA 3WL0A 1FKKA 3KAHA 1E6PA 1NWUA 4AY1A 1EYMA 1JNDA 2ZQSA 3ARRA 4MNLA 3O5OA 2D9FA 2UZ5A 2A3AA 2B5UB 3O5MA 3CHFA 2ZQVA 3PRAA 3IKGA 1L1PA 4JFMA 1HKJA 1E9LA 3KZ7A 1HKIA 4J4OA 3O5EA 4ODLA 3CHDA 3WIJA 2ZQTA 4P8UA
chains in the Genus database with same CATH topology
4C02B 2RURA 3NI6A 1FJDA 2YBTA 4NSBA 1JVWA 3W4RA 3AS1A 1D7JA 3ARSA 1LG2A 4TNSA 2O92A 1F40A 4MNJA 3PR9A 2XP6A 1OWQA 5D75A 4Z2JA 1B6CA 1KT0A 4JFIA 4WKHA 4HBOA 3ARYA 4IQCA 1FKLA 3JYJA 4DWSD 1C9HA 3AROA 2OFNA 1FKFA 5GPRA 2A3BA 2RUDA 2DSWA 4XAKA 2XP7A 4L3NA 3UI4A 1FAPA 3IK8A 2AOSA 4MSPA 3RM4A 1HJVA 2MLXA 1HJWA 3KADA 1K9TA 3O5PA 4NNRA 2F4EA 2KE0A 1HJXA 1NMWA 4ODNA 4O2TA 3UF8A 2XP4A 2DSVA 2LKNA 1NWRA 1NWSA 3RGCA 3NRKA 5DIUA 1JNSA 3PA7A 2A3CA 2PPNA 4DRJA 2LGOA 1JNEA 4LAYA 3WKZA 3KAFA 1VF8A 4IT4A 2XPAA 4DZ3A 3O5QA 3G6MA 4DRQA 2KFWA 4MTVA 1FKTA 3KCEA 3KABA 1FD9A 1D2KA 1EQ3A 1JNTA 1TFVA 1M5YA 4IQ2A 4BF8A 4MPKA 3TC5A 4ZPWR 1LL6A 1A7XA 1XHGA 1FKRA 1X6LA 2XP3A 3ARWA 4R5EA 2MNTA 4DWSA 4W5UA 1YW5A 2ZR4A 2JZVA 3O5DA 3O5GA 1LL7A 4TW7A 1J6YA 4W9QA 2KO7A 2FAPA 1QPFA 3ARUA 1EIBA 1GPFA 1WB0A 5HW8A 3WQVA 3OOBA 1ROTA 2DT0A 3IHZA 1O6IA 1ZL1A 4LAWA 3O5JA 1ROUA 2FKEA 2K8IA 4DRIA 3ALFA 2M1IA 4U84A 1LL4A 3O5IA 5HUAA 5JH8A 4ODOA 3KAGA 4MNKA 4DH0A 1ZBWA 1W1YA 3CZ8A 4S3JA 3WD3A 2KI3A 1J4IA 3RMEA 2MPHA 4G50A 5HW7A 1ZBVA 1R9HA 4QIBA 2DG3A 1NH6A 1OGGA 3BXWA 3RM9A 3WL1A 3AS3A 2PV3A 5HWCA 1Q6HA 4ODMA 4QT3A 3WD2A 4Z2GA 2G41A 1CTNA 1KT1A 1GUVA 2DSUA 2XPBA 1E6ZA 3QOKA 4Z2IA 3CH9A 3O5LA 2RSEA 4DRMA 4WIWA 1FKSA 1W1VA 2RUQA 1YATA 3RM8A 2PPOA 1RD6A 1ZU8A 1U79A 1LJYA 2KGJA 4HBEA 4DT4A 4IT6A 4U86A 2FDMA 2VN1A 1SR0A 1N1AA 4P8VA 4NZCA 3B8SA 5B8IC 1LQ0A 3O5FA 2WK2A 3TCZA 1T11A 1ZCNA 4DROA 1ZBCA 3ARTA 3O5KA 3OA5A 2PV2A 3CHCA 4R0XA 1ZK6A 1Y0OA 2N87A 4JFLA 1D6OA 3ARVA 5DF0A 3ARXA 1BKFA 3WD0A 2QF8A 1HKKA 3CGNA 2AWGA 1W26A 3KACA 4N19A 4DRNA 1PBKA 1E6RA 3ARZA 3EY6A 1H0GA 2A3EA 1FKDA 1W1PA 2WLYA 3WD1A 1FKIA 4ODKA 4QT2A 1ZBKA 3WH0A 4JYSA 3UI5A 4ZPTR 2DPEA 5DITA 3AS0A 1FKBA 3B9EA 5HBFA 1W9VA 2PV1A 2RUCA 4W9PA 2MLYA 3ARPA 4DRHA 4W9OA 4DIPA 2LJ4A 2O9OA 3CGMA 5BXJA 3G6LA 4ZS6A 1HKMA 1P5QA 3JXVA 2WLZA 4S3KA 4TW8A 5GQBA 3LUOA 2RQSA 1J4RA 2F2DA 4HARA 1Q6UA 2PBCA 3AQUA 4DRPA 4ODQA 2Y78A 1KFWA 5HW6A 4MNMA 4LAVA 2PPPA 3ARQA 2VCDA 1E6NA 1QZ2A 2XP8A 5HWBA 2B31A 5J6EA 5HKGA 3B9AA 4JFJA 3CHEA 2XP9A 1NWTA 4WK9A 2DG9A 3WD4A 4WKFA 2DT2A 1HXVA 1OGBA 4J4NA 3NTPA 1H0IA 4MAVA 3IKDA 4QZVB 3FAPA 4LAXA 4LGXA 4WKAA 1X6NA 1BL4A 1PINA 3I6CA 3ODKA 1WAWA 1ZB5A 2ITKA 4GGQA 4Q7NA 1Q6IA 1J4HA 4TW6A 4KR0B 4DRKA 3UQBA 3JYMA 1W1TA 4L72B 4MGVA 4ODPA 5I98A 2MLZA 1LG1A 1IX5A 2WM0A 1EDQA 1GOIA 2M2AA 2M08A 2ZQUA 3O5RA 4FN2A 1W9UA 3MDYB 2ESCA 1SYTA 2ZR6A 1FKGA 2IUZA 1ITXA 2ZR5A 1FFRA 4TX0A 1UR9A 3ALGA 2KR7A 4ML4A 1NMVA 4PTMA 4ZPVR 4GIVA 2LPVA 2PI6A 3PRBA 3B7XA 4Z2LA 1EHNA 1NSGA 4WJXA 1E15A 1XRVA 1D7HA 1WNOA 4URIA 2F21A 4ODRA 5DO2A 4ITZA 3FXYA 4DWSB 1Q1CA 3WQWA 1F8AB 1QPLA 2DSZA 2XP5A 4P8XA 2DG4A 4FAPA 2G8ZA 3GPKA 3H9RB 2YBUA 4DZ2A 2DT3A 3B9DA 1FKJA 4DWSC 3TDBA 3PRDA 4KQZA 3UQAA 1D7IA 2OLHA 2IF4A 3KAIA 3FY1A 3UI6A 3UQIA 2MF9A 1FFQA 4IPXA 2DT1A 4Z2KA 1UR8A 3AS2A 4P8WA 5HT1A 2L2SA 4JFKA 4U85A 3RFWA 4G2PA 1W9PA 4TYOA 5DIVA 4Q22A 1FKHA 3VAWA 5DEZA 5HTGA 2Q5AA 4Z2HA 1TCOC 5GPGA 3WL0A 1FKKA 3KAHA 1E6PA 1NWUA 4AY1A 1EYMA 1JNDA 2ZQSA 3ARRA 4MNLA 3O5OA 2D9FA 2UZ5A 2A3AA 3O5MA 3CHFA 2ZQVA 3PRAA 3IKGA 1L1PA 4JFMA 1HKJA 1E9LA 3KZ7A 1HKIA 4J4OA 3O5EA 4ODLA 3CHDA 3WIJA 2ZQTA 4P8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHZ A;  1W26 A;  2ZR5 A;  3KAC A;  4N19 A;  4TX0 A;  4C02 B;  4DRN A;  1PBK A;  3EY6 A;  2RUR A;  3NI6 A;  4LAW A;  1FJD A;  2KR7 A;  1JVW A;  1NMV A;  3O5J A;  1ROU A;  2FKE A;  2K8I A;  1FKD A;  1D7J A;  1FKI A;  4DRI A;  4GIV A;  2LPV A;  4TNS A;  3PRB A;  4ODK A;  4QT2 A;  3WH0 A;  4JYS A;  1F40 A;  3B7X A;  3UI5 A;  2M1I A;  4U84 A;  5DIT A;  1FKB A;  1NSG A;  2XP6 A;  5D75 A;  3O5I A;  5HUA A;  2PV1 A;  4ODO A;  3KAG A;  2RUC A;  1B6C A;  1KT0 A;  4JFI A;  1D7H A;  2MLY A;  4W9P A;  4DH0 A;  2F21 A;  4ODR A;  4DRH A;  4W9O A;  4IQC A;  4DIP A;  2LJ4 A;  1FKL A;  3CGM A;  3JYJ A;  4ITZ A;  5BXJ A;  1C9H A;  2KI3 A;  2OFN A;  1FKF A;  1J4I A;  1Q1C A;  1P5Q A;  2RUD A;  3JXV A;  2MPH A;  4TW8 A;  3LUO A;  2XP7 A;  4G50 A;  5HW7 A;  2RQS A;  1FAP A;  3IK8 A;  1F8A B;  1QPL A;  3UI4 A;  4MSP A;  2XP5 A;  2MLX A;  1R9H A;  3KAD A;  2DG4 A;  3O5P A;  4QIB A;  2DG3 A;  4FAP A;  1J4R A;  3GPK A;  4NNR A;  2F4E A;  2F2D A;  2KE0 A;  1Q6U A;  2PBC A;  5HWC A;  2PV3 A;  3H9R B;  1Q6H A;  4ODM A;  4QT3 A;  4DRP A;  4DZ2 A;  1NMW A;  4ODN A;  4O2T A;  4ODQ A;  2Y78 A;  1FKJ A;  3UF8 A;  2XP4 A;  1KT1 A;  2LKN A;  5HW6 A;  4LAV A;  2PPP A;  2XPB A;  3RGC A;  3TDB A;  3NRK A;  5DIU A;  1JNS A;  3PA7 A;  3PRD A;  2VCD A;  1QZ2 A;  2XP8 A;  5HWB A;  2PPN A;  3O5L A;  2RSE A;  4DRJ A;  3UQA A;  5J6E A;  4DRM A;  1D7I A;  2LGO A;  4LAY A;  1FKS A;  5HKG A;  2IF4 A;  3KAI A;  2RUQ A;  3KAF A;  4JFJ A;  3UI6 A;  3UQI A;  2XP9 A;  2MF9 A;  1YAT A;  2XPA A;  2PPO A;  3O5Q A;  4DRQ A;  4DZ3 A;  2KFW A;  2DG9 A;  4IPX A;  1U79 A;  5HT1 A;  2L2S A;  4JFK A;  1FKT A;  3KCE A;  4U85 A;  3RFW A;  3KAB A;  2KGJ A;  4G2P A;  1FD9 A;  4DT4 A;  1HXV A;  4TYO A;  4J4N A;  5DIV A;  3NTP A;  1EQ3 A;  4U86 A;  3IKD A;  3FAP A;  1JNT A;  4LAX A;  2VN1 A;  1FKH A;  1M5Y A;  4IQ2 A;  3VAW A;  4BF8 A;  1BL4 A;  1N1A A;  1PIN A;  2Q5A A;  3I6C A;  3TC5 A;  5HTG A;  5B8I C;  1TCO C;  3ODK A;  2ITK A;  5GPG A;  3O5F A;  4GGQ A;  3TCZ A;  1T11 A;  1ZCN A;  1FKK A;  1A7X A;  3KAH A;  4DRO A;  1Q6I A;  3O5K A;  1FKR A;  1EYM A;  2PV2 A;  1J4H A;  2XP3 A;  4TW6 A;  2ZQS A;  2MNT A;  1YW5 A;  2ZR4 A;  3O5O A;  3JYM A;  4DRK A;  3UQB A;  2JZV A;  3O5D A;  3O5G A;  4TW7 A;  1J6Y A;  4ODP A;  2D9F A;  4MGV A;  5I98 A;  4R0X A;  1ZK6 A;  2UZ5 A;  4W9Q A;  2MLZ A;  1Y0O A;  2KO7 A;  2N87 A;  3O5M A;  4JFL A;  2ZQV A;  1D6O A;  2FAP A;  1QPF A;  3IKG A;  4JFM A;  5HW8 A;  1L1P A;  2M2A A;  2ZQU A;  2M08 A;  3O5R A;  4FN2 A;  1BKF A;  3KZ7 A;  4J4O A;  3MDY B;  3O5E A;  2ZR6 A;  1ROT A;  3OOB A;  4ODL A;  1FKG A;  2ZQT A;  3CGN A;  2AWG A; 
#chains in the Genus database with same CATH topology
 2ETN A;  4C02 B;  2RUR A;  3NI6 A;  1FJD A;  2YBT A;  4NSB A;  1JVW A;  3W4R A;  3AS1 A;  1D7J A;  3ARS A;  1LG2 A;  4TNS A;  2O92 A;  1F40 A;  3BMB A;  4MNJ A;  3PR9 A;  2XP6 A;  1OWQ A;  5D75 A;  3GU0 A;  4Z2J A;  1B6C A;  1KT0 A;  4JFI A;  4WKH A;  4HBO A;  3ARY A;  4IQC A;  1FKL A;  3JYJ A;  4DWS D;  1C9H A;  3ARO A;  2OFN A;  1FKF A;  5GPR A;  2A3B A;  2RUD A;  2DSW A;  4XAK A;  2XP7 A;  4L3N A;  3UI4 A;  1FAP A;  3IK8 A;  2AOS A;  3GTY X;  4MSP A;  3RM4 A;  1HJV A;  2MLX A;  1HJW A;  3KAD A;  1JCH B;  1K9T A;  3O5P A;  4NNR A;  2F4E A;  2KE0 A;  1HJX A;  1NMW A;  4ODN A;  4O2T A;  3UF8 A;  2XP4 A;  2DSV A;  2LKN A;  1NWR A;  1NWS A;  3RGC A;  3NRK A;  5DIU A;  1JNS A;  3PA7 A;  2A3C A;  2PPN A;  4DRJ A;  2LGO A;  1JNE A;  4LAY A;  3WKZ A;  3KAF A;  1VF8 A;  4IT4 A;  2XPA A;  4DZ3 A;  3O5Q A;  3G6M A;  4DRQ A;  2KFW A;  4MTV A;  1FKT A;  3KCE A;  3KAB A;  1FD9 A;  1D2K A;  1EQ3 A;  1JNT A;  1TFV A;  1M5Y A;  4IQ2 A;  4BF8 A;  4MPK A;  3TC5 A;  4ZPW R;  1LL6 A;  1A7X A;  1XHG A;  1FKR A;  1X6L A;  2XP3 A;  3ARW A;  4R5E A;  2MNT A;  4DWS A;  4W5U A;  1YW5 A;  2ZR4 A;  2JZV A;  3O5D A;  3O5G A;  1LL7 A;  1GRJ A;  4TW7 A;  1J6Y A;  4W9Q A;  2KO7 A;  2FAP A;  1QPF A;  3ARU A;  1EIB A;  1GPF A;  1WB0 A;  5HW8 A;  3WQV A;  3OOB A;  1ROT A;  2DT0 A;  3IHZ A;  1O6I A;  1ZL1 A;  4LAW A;  3O5J A;  1ROU A;  2FKE A;  2K8I A;  4DRI A;  2F23 A;  3ALF A;  2M1I A;  4U84 A;  1LL4 A;  3O5I A;  5HUA A;  5JH8 A;  4ODO A;  3KAG A;  4MNK A;  4DH0 A;  1ZBW A;  1W1Y A;  3CZ8 A;  4S3J A;  3WD3 A;  2KI3 A;  1J4I A;  3RME A;  2MPH A;  4G50 A;  5HW7 A;  1ZBV A;  1R9H A;  4QIB A;  2DG3 A;  1NH6 A;  1OGG A;  3BXW A;  3RM9 A;  3WL1 A;  3AS3 A;  2PV3 A;  5HWC A;  1Q6H A;  4ODM A;  4QT3 A;  3WD2 A;  4Z2G A;  2G41 A;  1CTN A;  1KT1 A;  1GUV A;  2DSU A;  2XPB A;  1E6Z A;  3QOK A;  4Z2I A;  3CH9 A;  3O5L A;  2RSE A;  4DRM A;  4WIW A;  1FKS A;  1W1V A;  2RUQ A;  1YAT A;  3RM8 A;  2PPO A;  1RD6 A;  1ZU8 A;  1U79 A;  1LJY A;  2KGJ A;  4HBE A;  4DT4 A;  4IT6 A;  4U86 A;  2FDM A;  2VN1 A;  1SR0 A;  1N1A A;  4P8V A;  4NZC A;  3B8S A;  5B8I C;  1LQ0 A;  3O5F A;  2WK2 A;  3TCZ A;  1T11 A;  1ZCN A;  4DRO A;  1ZBC A;  3ART A;  3O5K A;  3OA5 A;  2PV2 A;  3CHC A;  4R0X A;  1ZK6 A;  1Y0O A;  2N87 A;  4JFL A;  1D6O A;  3ARV A;  5DF0 A;  3ARX A;  1BKF A;  3WD0 A;  2QF8 A;  1HKK A;  3CGN A;  2AWG A;  1W26 A;  3KAC A;  4N19 A;  4DRN A;  1PBK A;  1E6R A;  3ARZ A;  3EY6 A;  1H0G A;  2A3E A;  1FKD A;  1W1P A;  2WLY A;  3WD1 A;  1FKI A;  2P4V A;  4ODK A;  4QT2 A;  1ZBK A;  3WH0 A;  4JYS A;  3UI5 A;  4ZPT R;  2DPE A;  5DIT A;  3AS0 A;  1FKB A;  3B9E A;  5HBF A;  1W9V A;  2PV1 A;  2RUC A;  4W9P A;  2MLY A;  2PN0 A;  3ARP A;  4DRH A;  4W9O A;  4DIP A;  2LJ4 A;  2O9O A;  3CGM A;  5BXJ A;  3G6L A;  4ZS6 A;  1HKM A;  1P5Q A;  3JXV A;  2WLZ A;  4S3K A;  4TW8 A;  5GQB A;  3LUO A;  4UDM A;  2RQS A;  1J4R A;  2F2D A;  4HAR A;  1Q6U A;  2PBC A;  3AQU A;  4DRP A;  4ODQ A;  2Y78 A;  1KFW A;  5HW6 A;  4MNM A;  4LAV A;  2PPP A;  3ARQ A;  2VCD A;  1E6N A;  1QZ2 A;  2XP8 A;  5HWB A;  2B31 A;  5J6E A;  5HKG A;  3B9A A;  4JFJ A;  3CHE A;  2XP9 A;  1NWT A;  4WK9 A;  2DG9 A;  3WD4 A;  4WKF A;  2DT2 A;  1HXV A;  1OGB A;  4J4N A;  3NTP A;  1H0I A;  4MAV A;  3IKD A;  4QZV B;  3FAP A;  4LAX A;  4LGX A;  4WKA A;  1X6N A;  1BL4 A;  1PIN A;  3I6C A;  3ODK A;  1WAW A;  1ZB5 A;  2ITK A;  4GGQ A;  4Q7N A;  1Q6I A;  1J4H A;  4TW6 A;  4KR0 B;  4DRK A;  3UQB A;  3JYM A;  1W1T A;  4L72 B;  4MGV A;  4ODP A;  5I98 A;  2MLZ A;  1LG1 A;  1IX5 A;  2WM0 A;  1EDQ A;  1GOI A;  2M2A A;  2M08 A;  2ZQU A;  3EIP A;  3O5R A;  4FN2 A;  1W9U A;  3MDY B;  2ESC A;  1SYT A;  2ZR6 A;  2EUL A;  1FKG A;  2IUZ A;  1ITX A;  2ZR5 A;  1FFR A;  4TX0 A;  1UR9 A;  3ALG A;  2KR7 A;  4ML4 A;  1NMV A;  4PTM A;  4ZPV R;  4GIV A;  2LPV A;  2PI6 A;  3PRB A;  3B7X A;  4Z2L A;  1EHN A;  1NSG A;  4WJX A;  1E15 A;  1XRV A;  1D7H A;  1WNO A;  4URI A;  2F21 A;  4ODR A;  5DO2 A;  4ITZ A;  3FXY A;  4DWS B;  1Q1C A;  3WQW A;  1F8A B;  1QPL A;  2DSZ A;  2XP5 A;  4P8X A;  2DG4 A;  4FAP A;  2G8Z A;  3GPK A;  3H9R B;  2YBU A;  4DZ2 A;  2DT3 A;  3B9D A;  1FKJ A;  4DWS C;  3TDB A;  3PRD A;  4KQZ A;  3UQA A;  1D7I A;  2OLH A;  2IF4 A;  3KAI A;  3FY1 A;  3UI6 A;  3UQI A;  2MF9 A;  1FFQ A;  4IPX A;  2DT1 A;  4Z2K A;  1UR8 A;  3AS2 A;  4P8W A;  5HT1 A;  2L2S A;  4JFK A;  4U85 A;  3RFW A;  4G2P A;  1W9P A;  4TYO A;  5DIV A;  1E44 A;  4Q22 A;  1FKH A;  3VAW A;  5DEZ A;  5HTG A;  2Q5A A;  4Z2H A;  1TCO C;  5GPG A;  3WL0 A;  1FKK A;  3KAH A;  1E6P A;  1NWU A;  4AY1 A;  1EYM A;  1JND A;  2ZQS A;  3ARR A;  4MNL A;  3O5O A;  2D9F A;  2UZ5 A;  2A3A A;  2B5U B;  3O5M A;  3CHF A;  2ZQV A;  3PRA A;  3IKG A;  1L1P A;  4JFM A;  1HKJ A;  1E9L A;  3KZ7 A;  1HKI A;  4J4O A;  3O5E A;  4ODL A;  3CHD A;  3WIJ A;  2ZQT A;  4P8U A; 
#chains in the Genus database with same CATH homology
 4C02 B;  2RUR A;  3NI6 A;  1FJD A;  2YBT A;  4NSB A;  1JVW A;  3W4R A;  3AS1 A;  1D7J A;  3ARS A;  1LG2 A;  4TNS A;  2O92 A;  1F40 A;  4MNJ A;  3PR9 A;  2XP6 A;  1OWQ A;  5D75 A;  4Z2J A;  1B6C A;  1KT0 A;  4JFI A;  4WKH A;  4HBO A;  3ARY A;  4IQC A;  1FKL A;  3JYJ A;  4DWS D;  1C9H A;  3ARO A;  2OFN A;  1FKF A;  5GPR A;  2A3B A;  2RUD A;  2DSW A;  4XAK A;  2XP7 A;  4L3N A;  3UI4 A;  1FAP A;  3IK8 A;  2AOS A;  4MSP A;  3RM4 A;  1HJV A;  2MLX A;  1HJW A;  3KAD A;  1K9T A;  3O5P A;  4NNR A;  2F4E A;  2KE0 A;  1HJX A;  1NMW A;  4ODN A;  4O2T A;  3UF8 A;  2XP4 A;  2DSV A;  2LKN A;  1NWR A;  1NWS A;  3RGC A;  3NRK A;  5DIU A;  1JNS A;  3PA7 A;  2A3C A;  2PPN A;  4DRJ A;  2LGO A;  1JNE A;  4LAY A;  3WKZ A;  3KAF A;  1VF8 A;  4IT4 A;  2XPA A;  4DZ3 A;  3O5Q A;  3G6M A;  4DRQ A;  2KFW A;  4MTV A;  1FKT A;  3KCE A;  3KAB A;  1FD9 A;  1D2K A;  1EQ3 A;  1JNT A;  1TFV A;  1M5Y A;  4IQ2 A;  4BF8 A;  4MPK A;  3TC5 A;  4ZPW R;  1LL6 A;  1A7X A;  1XHG A;  1FKR A;  1X6L A;  2XP3 A;  3ARW A;  4R5E A;  2MNT A;  4DWS A;  4W5U A;  1YW5 A;  2ZR4 A;  2JZV A;  3O5D A;  3O5G A;  1LL7 A;  4TW7 A;  1J6Y A;  4W9Q A;  2KO7 A;  2FAP A;  1QPF A;  3ARU A;  1EIB A;  1GPF A;  1WB0 A;  5HW8 A;  3WQV A;  3OOB A;  1ROT A;  2DT0 A;  3IHZ A;  1O6I A;  1ZL1 A;  4LAW A;  3O5J A;  1ROU A;  2FKE A;  2K8I A;  4DRI A;  3ALF A;  2M1I A;  4U84 A;  1LL4 A;  3O5I A;  5HUA A;  5JH8 A;  4ODO A;  3KAG A;  4MNK A;  4DH0 A;  1ZBW A;  1W1Y A;  3CZ8 A;  4S3J A;  3WD3 A;  2KI3 A;  1J4I A;  3RME A;  2MPH A;  4G50 A;  5HW7 A;  1ZBV A;  1R9H A;  4QIB A;  2DG3 A;  1NH6 A;  1OGG A;  3BXW A;  3RM9 A;  3WL1 A;  3AS3 A;  2PV3 A;  5HWC A;  1Q6H A;  4ODM A;  4QT3 A;  3WD2 A;  4Z2G A;  2G41 A;  1CTN A;  1KT1 A;  1GUV A;  2DSU A;  2XPB A;  1E6Z A;  3QOK A;  4Z2I A;  3CH9 A;  3O5L A;  2RSE A;  4DRM A;  4WIW A;  1FKS A;  1W1V A;  2RUQ A;  1YAT A;  3RM8 A;  2PPO A;  1RD6 A;  1ZU8 A;  1U79 A;  1LJY A;  2KGJ A;  4HBE A;  4DT4 A;  4IT6 A;  4U86 A;  2FDM A;  2VN1 A;  1SR0 A;  1N1A A;  4P8V A;  4NZC A;  3B8S A;  5B8I C;  1LQ0 A;  3O5F A;  2WK2 A;  3TCZ A;  1T11 A;  1ZCN A;  4DRO A;  1ZBC A;  3ART A;  3O5K A;  3OA5 A;  2PV2 A;  3CHC A;  4R0X A;  1ZK6 A;  1Y0O A;  2N87 A;  4JFL A;  1D6O A;  3ARV A;  5DF0 A;  3ARX A;  1BKF A;  3WD0 A;  2QF8 A;  1HKK A;  3CGN A;  2AWG A;  1W26 A;  3KAC A;  4N19 A;  4DRN A;  1PBK A;  1E6R A;  3ARZ A;  3EY6 A;  1H0G A;  2A3E A;  1FKD A;  1W1P A;  2WLY A;  3WD1 A;  1FKI A;  4ODK A;  4QT2 A;  1ZBK A;  3WH0 A;  4JYS A;  3UI5 A;  4ZPT R;  2DPE A;  5DIT A;  3AS0 A;  1FKB A;  3B9E A;  5HBF A;  1W9V A;  2PV1 A;  2RUC A;  4W9P A;  2MLY A;  3ARP A;  4DRH A;  4W9O A;  4DIP A;  2LJ4 A;  2O9O A;  3CGM A;  5BXJ A;  3G6L A;  4ZS6 A;  1HKM A;  1P5Q A;  3JXV A;  2WLZ A;  4S3K A;  4TW8 A;  5GQB A;  3LUO A;  2RQS A;  1J4R A;  2F2D A;  4HAR A;  1Q6U A;  2PBC A;  3AQU A;  4DRP A;  4ODQ A;  2Y78 A;  1KFW A;  5HW6 A;  4MNM A;  4LAV A;  2PPP A;  3ARQ A;  2VCD A;  1E6N A;  1QZ2 A;  2XP8 A;  5HWB A;  2B31 A;  5J6E A;  5HKG A;  3B9A A;  4JFJ A;  3CHE A;  2XP9 A;  1NWT A;  4WK9 A;  2DG9 A;  3WD4 A;  4WKF A;  2DT2 A;  1HXV A;  1OGB A;  4J4N A;  3NTP A;  1H0I A;  4MAV A;  3IKD A;  4QZV B;  3FAP A;  4LAX A;  4LGX A;  4WKA A;  1X6N A;  1BL4 A;  1PIN A;  3I6C A;  3ODK A;  1WAW A;  1ZB5 A;  2ITK A;  4GGQ A;  4Q7N A;  1Q6I A;  1J4H A;  4TW6 A;  4KR0 B;  4DRK A;  3UQB A;  3JYM A;  1W1T A;  4L72 B;  4MGV A;  4ODP A;  5I98 A;  2MLZ A;  1LG1 A;  1IX5 A;  2WM0 A;  1EDQ A;  1GOI A;  2M2A A;  2M08 A;  2ZQU A;  3O5R A;  4FN2 A;  1W9U A;  3MDY B;  2ESC A;  1SYT A;  2ZR6 A;  1FKG A;  2IUZ A;  1ITX A;  2ZR5 A;  1FFR A;  4TX0 A;  1UR9 A;  3ALG A;  2KR7 A;  4ML4 A;  1NMV A;  4PTM A;  4ZPV R;  4GIV A;  2LPV A;  2PI6 A;  3PRB A;  3B7X A;  4Z2L A;  1EHN A;  1NSG A;  4WJX A;  1E15 A;  1XRV A;  1D7H A;  1WNO A;  4URI A;  2F21 A;  4ODR A;  5DO2 A;  4ITZ A;  3FXY A;  4DWS B;  1Q1C A;  3WQW A;  1F8A B;  1QPL A;  2DSZ A;  2XP5 A;  4P8X A;  2DG4 A;  4FAP A;  2G8Z A;  3GPK A;  3H9R B;  2YBU A;  4DZ2 A;  2DT3 A;  3B9D A;  1FKJ A;  4DWS C;  3TDB A;  3PRD A;  4KQZ A;  3UQA A;  1D7I A;  2OLH A;  2IF4 A;  3KAI A;  3FY1 A;  3UI6 A;  3UQI A;  2MF9 A;  1FFQ A;  4IPX A;  2DT1 A;  4Z2K A;  1UR8 A;  3AS2 A;  4P8W A;  5HT1 A;  2L2S A;  4JFK A;  4U85 A;  3RFW A;  4G2P A;  1W9P A;  4TYO A;  5DIV A;  4Q22 A;  1FKH A;  3VAW A;  5DEZ A;  5HTG A;  2Q5A A;  4Z2H A;  1TCO C;  5GPG A;  3WL0 A;  1FKK A;  3KAH A;  1E6P A;  1NWU A;  4AY1 A;  1EYM A;  1JND A;  2ZQS A;  3ARR A;  4MNL A;  3O5O A;  2D9F A;  2UZ5 A;  2A3A A;  3O5M A;  3CHF A;  2ZQV A;  3PRA A;  3IKG A;  1L1P A;  4JFM A;  1HKJ A;  1E9L A;  3KZ7 A;  1HKI A;  4J4O A;  3O5E A;  4ODL A;  3CHD A;  3WIJ A;  2ZQT A;  4P8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...