2F2DA

Solution structure of the fk506-binding domain of human fkbp38
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
121
structure length
121
Chain Sequence
MREWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the FK506-Binding Domain of Human FKBP38
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords 38 kDa FK-506 binding protein homolog, FKBP38
total genus 11
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f2dA00
2XP9A 2F21A 1TCOC 2MPHA 4QT3A 2Y78A 1ZK6A 2VCDA 2ZQTA 4ODNA 4DRQA 1KT1A 3O5IA 2JZVA 2M1IA 2RURA 2D9FA 1QPLA 1FKLA 3JYMA 4ODMA 2LKNA 3NI6A 4JYSA 1ROTA 1FKBA 2PPOA 2PV2A 5HW6A 3PRDA 1R9HA 5GPGA 1N1AA 3CGNA 1J6YA 1BL4A 1Q1CA 2ZR4A 3EY6A 2LPVA 3KAHA 2F2DA 2FKEA 4LAYA 5D75A 4FAPA 4GIVA 1J4RA 4ODQA 3TDBA 4DRMA 1D7JA 2XP6A 1Q6HA 4DH0A 3TC5A 2MLXA 3NRKA 4ODRA 1EYMA 4DRKA 4DRHA 2XP4A 3H9RB 4ODLA 2RUCA 3MDYB 4U84A 1Q6IA 1QZ2A 2XP3A 4FN2A 5DIUA 1JVWA 3RFWA 1FKHA 2Q5AA 1C9HA 3O5GA 4IQ2A 4DRJA 1KT0A 4JFMA 3KAIA 4W9OA 2F4EA 3O5RA 4DRIA 1L1PA 4DZ3A 3TCZA 3UQBA 2RUQA 5DIVA 1FKKA 5DITA 2LJ4A 2KI3A 3O5DA 3PA7A 3O5OA 2M2AA 5HW8A 1FKIA 2XP5A 1PBKA 4MSPA 4TW6A 2RUDA 5HKGA 3OOBA 4TYOA 1F40A 2KGJA 2L2SA 4DT4A 2ZQUA 5B8IC 3UQAA 2RSEA 1BKFA 5BXJA 4G50A 1U79A 2MF9A 3JYJA 1J4IA 4N19A 3KZ7A 3UI4A 3JXVA 2DG9A 4W9PA 3RGCA 5I98A 3KADA 4JFKA 2ITKA 4MGVA 1A7XA 4JFIA 1B6CA 2MLZA 2ZR6A 3VAWA 4DIPA 1P5QA 2XPAA 4DZ2A 4TNSA 4TW8A 4J4OA 1FKSA 2IF4A 5HUAA 4QIBA 4JFJA 2OFNA 3PRBA 2AWGA 4LAVA 1T11A 3O5EA 3O5PA 3UQIA 3GPKA 2LGOA 2PV3A 1M5YA 1ZCNA 4C02B 4DROA 1FKJA 4O2TA 1Q6UA 1FKFA 3KACA 1W26A 4U86A 5HTGA 3O5QA 1YATA 5HW7A 5HWCA 2MLYA 3UI6A 2VN1A 1F8AB 1NSGA 3KABA 4U85A 3IK8A 1FKGA 4IQCA 1Y0OA 1QPFA 4TW7A 3O5MA 4IPXA 3IKGA 5J6EA 3LUOA 4JFLA 1FD9A 3NTPA 2PV1A 2DG4A 1NMWA 3WH0A 1EQ3A 2PPNA 4ODOA 5HT1A 5HWBA 4G2PA 1PINA 2PBCA 3B7XA 2XP8A 2N87A 3I6CA 3KAFA 1HXVA 3UI5A 4DRNA 1FKDA 2ZQSA 4QT2A 3KCEA 1FJDA 1JNSA 2KO7A 4LAWA 3CGMA 4W9QA 4LAXA 3IHZA 1FAPA 1FKRA 2PPPA 3O5FA 2ZQVA 4GGQA 2XPBA 1J4HA 4J4NA 3FAPA 3O5KA 2KR7A 2MNTA 3O5JA 4ODPA 2RQSA 1D7IA 1D7HA 1D6OA 1YW5A 1NMVA 3ODKA 3O5LA 2K8IA 4NNRA 4DRPA 1ROUA 4R0XA 3UF8A 3IKDA 1JNTA 2DG3A 2FAPA 2XP7A 4ITZA 4TX0A 2KFWA 4ODKA 3KAGA 2UZ5A 2KE0A 2M08A 1FKTA 2ZR5A 4BF8A
chains in the Genus database with same CATH superfamily
2ZQTA 2D9FA 1TFVA 1ROTA 1FKBA 1W9PA 5HW6A 1R9HA 1J6YA 3CZ8A 4WKAA 1W1VA 3GU0A 3KAHA 1J4RA 3TDBA 1GRJA 1EHNA 4DH0A 1LG2A 3TC5A 4DRHA 3RM9A 4MNLA 2RUCA 1Q6IA 2XP3A 4URIA 1JVWA 3RFWA 1ZU8A 5JH8A 4DWSD 3O5GA 4PTMA 3RM8A 3KAIA 4DRIA 3UQBA 2RUQA 5DITA 2LJ4A 1PBKA 2WLYA 4QZVB 1ZBCA 1E9LA 3AS3A 3FXYA 3UQAA 3QOKA 5BXJA 3WL0A 1W9UA 4N19A 2MF9A 3AS0A 3FY1A 5I98A 2ITKA 1ZBVA 4JFIA 2MLZA 4DIPA 4ZPVR 4ZPTR 4TW8A 4S3KA 1K9TA 3B8SA 4R5EA 4QIBA 3WQVA 4JFJA 1E44A 2OFNA 2PI6A 1T11A 3O5PA 1UR9A 2G8ZA 1ZCNA 4O2TA 1YATA 3IK8A 3O5MA 3B9DA 4IPXA 5J6EA 4L3NA 3LUOA 1HKKA 4Z2IA 4ODOA 4MNKA 3B7XA 3I6CA 3WD3A 1HXVA 5DEZA 4QT2A 1JNSA 4LAWA 4W9QA 2DT1A 3PRAA 1FKRA 4KQZA 4J4NA 1D7IA 1D7HA 1D6OA 1YW5A 3BXWA 1GOIA 2WK2A 1JNTA 2A3AA 4WJXA 2DSUA 2KFWA 1FKTA 4DWSB 3KADA 4BF8A 1TCOC 2MPHA 4DRQA 2Y78A 3O5IA 1LL7A 3ARUA 3WD1A 3NI6A 4WIWA 3ARXA 3CHDA 3G6MA 2PV2A 3PRDA 5GPGA 1N1AA 4P8WA 3EY6A 2ZR4A 1VF8A 4Z2GA 4FAPA 2FKEA 1LL4A 2PN0A 2XP6A 1EYMA 3H9RB 4U84A 1FKHA 3AS2A 3PR9A 4IQ2A 2F4EA 1L1PA 5GPRA 1W1YA 1EDQA 3PA7A 2M2AA 2XP5A 1ZBKA 1LQ0A 1UR8A 4DT4A 5B8IC 4NZCA 1LL6A 1J4IA 2QF8A 3JYJA 4WKFA 3CHFA 4IT6A 4Z2LA 4MAVA 3ALGA 4S3JA 1A7XA 2ZR6A 2O9OA 4DZ2A 5DO2A 1X6LA 1HKMA 4LAVA 2P4VA 3GPKA 3ARRA 3B9EA 4Z2JA 3ARPA 3CHEA 1W1TA 1F8AB 3WQWA 4TW7A 1HJWA 2G41A 3NTPA 2DG4A 1NMWA 3OA5A 1EQ3A 5HT1A 4HBEA 5HWBA 1PINA 2PBCA 4P8VA 3UI5A 4DRNA 4UDMA 3KCEA 1W9VA 1FJDA 3CGMA 2XPBA 3WD2A 2KR7A 1ITXA 1RD6A 4NNRA 1GUVA 4DWSA 2DSVA 3CHCA 3IKDA 2DG3A 2FAPA 4ITZA 4MPKA 2UZ5A 3WD0A 2DT0A 1OGGA 1WNOA 4QT3A 3EIPA 2OLHA 1ZB5A 4XAKA 2JZVA 2M1IA 1ZL1A 2LKNA 2PPOA 1E6ZA 3CGNA 5GQBA 3ALFA 1XHGA 4AY1A 2F2DA 4LAYA 2B31A 1LJYA 2DSWA 1GPFA 2MLXA 3NRKA 4Q22A 2XP4A 5DIUA 1JNEA 1QZ2A 2Q5AA 3WD4A 1C9HA 3ARVA 4W9OA 4WK9A 2A3CA 1HKJA 1JCHB 4MNMA 2ESCA 3ARZA 3RM4A 3O5OA 4HARA 1FKIA 4Q7NA 4MSPA 4TW6A 1X6NA 3G6LA 4TYOA 2F23A 2ETNA 2A3BA 2ZQUA 1BKFA 4G50A 1U79A 4KR0B 3KZ7A 3UI4A 3GTYX 3JXVA 3WL1A 4W9PA 1NH6A 1D2KA 4MGVA 1B6CA 2O92A 1P5QA 2DT3A 2XPAA 4TNSA 4J4OA 2DPEA 5HBFA 2AWGA 3O5EA 3UQIA 2LGOA 2PV3A 1M5YA 2YBTA 2IUZA 4C02B 1EIBA 3W4RA 1Q6UA 3KACA 5HTGA 3O5QA 4ML4A 2VN1A 3KABA 1JNDA 1FKGA 1ZBWA 1QPFA 3WH0A 1FD9A 1KFWA 2PV1A 4P8XA 4L72B 4G2PA 1HKIA 1E15A 2XP8A 3KAFA 1FKDA 5DF0A 4LAXA 1CTNA 4WKHA 3O5FA 1J4HA 3AQUA 3O5KA 3ARTA 4ODPA 3ODKA 4ODLA 5HW8A 4DRPA 2EULA 2K8IA 3O5LA 1NWRA 2XP7A 4TX0A 4ODKA 3ARSA 2M08A 1HJXA 2WM0A 2ZR5A 4Z2KA 2XP9A 2F21A 1ZK6A 2VCDA 4ODNA 2WLZA 1KT1A 4MTVA 3AS1A 2RURA 1QPLA 1FKLA 3ARYA 3JYMA 4IT4A 4ODMA 4JYSA 1FFRA 4DWSC 2B5UB 1NWUA 1BL4A 1E6RA 1Q1CA 2LPVA 5D75A 4ZS6A 4GIVA 4ODQA 4DRMA 1D7JA 1Q6HA 4Z2HA 4ODRA 4DRKA 4P8UA 5HW7A 3MDYB 4FN2A 1E6PA 4DRJA 1KT0A 4JFMA 3O5RA 4W5UA 4DZ3A 3TCZA 5DIVA 3WKZA 1FKKA 2KI3A 3O5DA 3AROA 3CH9A 2RUDA 1XRVA 5HKGA 3OOBA 1IX5A 1F40A 2KGJA 2L2SA 3ARWA 2RSEA 1SR0A 2DG9A 3RGCA 4JFKA 1FFQA 1HJVA 1SYTA 3VAWA 4HBOA 1FKSA 2FDMA 2AOSA 2IF4A 5HUAA 1E6NA 3PRBA 4ZPWR 3RMEA 4DROA 1FKJA 1FKFA 1W26A 4U86A 5HWCA 2MLYA 3UI6A 1NSGA 4U85A 1OWQA 4IQCA 1NWTA 1Y0OA 4LGXA 3IKGA 3ARQA 4JFLA 1H0IA 3WIJA 2PPNA 4MNJA 1WB0A 2N87A 2DT2A 1WAWA 2ZQSA 4NSBA 2KO7A 3IHZA 1FAPA 2A3EA 1NWSA 2PPPA 2ZQVA 4GGQA 1H0GA 3FAPA 2MNTA 3O5JA 1W1PA 2RQSA 1NMVA 1ROUA 1LG1A 2DSZA 4R0XA 3UF8A 1O6IA 3KAGA 2KE0A 3B9AA 2YBUA 3BMBA 1OGBA
chains in the Genus database with same CATH topology
2ZQTA 2D9FA 1TFVA 1ROTA 1FKBA 1W9PA 5HW6A 1R9HA 1J6YA 3CZ8A 4WKAA 1W1VA 3KAHA 1J4RA 3TDBA 1EHNA 4DH0A 1LG2A 3TC5A 4DRHA 3RM9A 4MNLA 2RUCA 1Q6IA 2XP3A 4URIA 1JVWA 3RFWA 1ZU8A 5JH8A 4DWSD 3O5GA 4PTMA 3RM8A 3KAIA 4DRIA 3UQBA 2RUQA 5DITA 2LJ4A 1PBKA 2WLYA 4QZVB 1ZBCA 1E9LA 3AS3A 3FXYA 3UQAA 3QOKA 5BXJA 3WL0A 1W9UA 4N19A 2MF9A 3AS0A 3FY1A 5I98A 2ITKA 1ZBVA 4JFIA 2MLZA 4DIPA 4ZPVR 4ZPTR 4TW8A 4S3KA 1K9TA 3B8SA 4R5EA 4QIBA 3WQVA 4JFJA 2OFNA 2PI6A 1T11A 3O5PA 1UR9A 2G8ZA 1ZCNA 4O2TA 1YATA 3IK8A 3O5MA 3B9DA 4IPXA 5J6EA 4L3NA 3LUOA 1HKKA 4Z2IA 4ODOA 4MNKA 3B7XA 3I6CA 3WD3A 1HXVA 5DEZA 4QT2A 1JNSA 4LAWA 4W9QA 2DT1A 3PRAA 1FKRA 4KQZA 4J4NA 1D7IA 1D7HA 1D6OA 1YW5A 3BXWA 1GOIA 2WK2A 1JNTA 2A3AA 4WJXA 2DSUA 2KFWA 1FKTA 4DWSB 3KADA 4BF8A 1TCOC 2MPHA 4DRQA 2Y78A 3O5IA 1LL7A 3ARUA 3WD1A 3NI6A 4WIWA 3ARXA 3CHDA 3G6MA 2PV2A 3PRDA 5GPGA 1N1AA 4P8WA 3EY6A 2ZR4A 1VF8A 4Z2GA 4FAPA 2FKEA 1LL4A 2XP6A 1EYMA 3H9RB 4U84A 1FKHA 3AS2A 3PR9A 4IQ2A 2F4EA 1L1PA 5GPRA 1W1YA 1EDQA 3PA7A 2M2AA 2XP5A 1ZBKA 1LQ0A 1UR8A 4DT4A 5B8IC 4NZCA 1LL6A 1J4IA 2QF8A 3JYJA 4WKFA 3CHFA 4IT6A 4Z2LA 4MAVA 3ALGA 4S3JA 1A7XA 2ZR6A 2O9OA 4DZ2A 5DO2A 1X6LA 1HKMA 4LAVA 3GPKA 3ARRA 3B9EA 4Z2JA 3ARPA 3CHEA 1W1TA 1F8AB 3WQWA 4TW7A 1HJWA 2G41A 3NTPA 2DG4A 1NMWA 3OA5A 1EQ3A 5HT1A 4HBEA 5HWBA 1PINA 2PBCA 4P8VA 3UI5A 4DRNA 3KCEA 1W9VA 1FJDA 3CGMA 2XPBA 3WD2A 2KR7A 1ITXA 1RD6A 4NNRA 1GUVA 4DWSA 2DSVA 3CHCA 3IKDA 2DG3A 2FAPA 4ITZA 4MPKA 2UZ5A 3WD0A 2DT0A 1OGGA 1WNOA 4QT3A 2OLHA 1ZB5A 4XAKA 2JZVA 2M1IA 1ZL1A 2LKNA 2PPOA 1E6ZA 3CGNA 5GQBA 3ALFA 1XHGA 4AY1A 2F2DA 4LAYA 2B31A 1LJYA 2DSWA 1GPFA 2MLXA 3NRKA 4Q22A 2XP4A 5DIUA 1JNEA 1QZ2A 2Q5AA 3WD4A 1C9HA 3ARVA 4W9OA 4WK9A 2A3CA 1HKJA 4MNMA 2ESCA 3ARZA 3RM4A 3O5OA 4HARA 1FKIA 4Q7NA 4MSPA 4TW6A 1X6NA 3G6LA 4TYOA 2A3BA 2ZQUA 1BKFA 4G50A 1U79A 4KR0B 3KZ7A 3UI4A 3JXVA 3WL1A 4W9PA 1NH6A 1D2KA 4MGVA 1B6CA 2O92A 1P5QA 2DT3A 2XPAA 4TNSA 4J4OA 2DPEA 5HBFA 2AWGA 3O5EA 3UQIA 2LGOA 2PV3A 1M5YA 2YBTA 2IUZA 4C02B 1EIBA 3W4RA 1Q6UA 3KACA 5HTGA 3O5QA 4ML4A 2VN1A 3KABA 1JNDA 1FKGA 1ZBWA 1QPFA 3WH0A 1FD9A 1KFWA 2PV1A 4P8XA 4L72B 4G2PA 1HKIA 1E15A 2XP8A 3KAFA 1FKDA 5DF0A 4LAXA 1CTNA 4WKHA 3O5FA 1J4HA 3AQUA 3O5KA 3ARTA 4ODPA 3ODKA 4ODLA 5HW8A 4DRPA 3O5LA 2K8IA 1NWRA 2XP7A 4TX0A 4ODKA 3ARSA 2M08A 1HJXA 2WM0A 2ZR5A 4Z2KA 2XP9A 2F21A 1ZK6A 2VCDA 4ODNA 2WLZA 1KT1A 4MTVA 3AS1A 2RURA 1QPLA 1FKLA 3ARYA 3JYMA 4IT4A 4ODMA 4JYSA 1FFRA 4DWSC 1NWUA 1BL4A 1E6RA 1Q1CA 2LPVA 5D75A 4ZS6A 4GIVA 4ODQA 4DRMA 1D7JA 1Q6HA 4Z2HA 4ODRA 4DRKA 4P8UA 5HW7A 3MDYB 4FN2A 1E6PA 4DRJA 1KT0A 4JFMA 3O5RA 4W5UA 4DZ3A 3TCZA 5DIVA 3WKZA 1FKKA 2KI3A 3O5DA 3AROA 3CH9A 2RUDA 1XRVA 5HKGA 3OOBA 1IX5A 1F40A 2KGJA 2L2SA 3ARWA 2RSEA 1SR0A 2DG9A 3RGCA 4JFKA 1FFQA 1HJVA 1SYTA 3VAWA 4HBOA 1FKSA 2FDMA 2AOSA 2IF4A 5HUAA 1E6NA 3PRBA 4ZPWR 3RMEA 4DROA 1FKJA 1FKFA 1W26A 4U86A 5HWCA 2MLYA 3UI6A 1NSGA 4U85A 1OWQA 4IQCA 1NWTA 1Y0OA 4LGXA 3IKGA 3ARQA 4JFLA 1H0IA 3WIJA 2PPNA 4MNJA 1WB0A 2N87A 2DT2A 1WAWA 2ZQSA 4NSBA 2KO7A 3IHZA 1FAPA 2A3EA 1NWSA 2PPPA 2ZQVA 4GGQA 1H0GA 3FAPA 2MNTA 3O5JA 1W1PA 2RQSA 1NMVA 1ROUA 1LG1A 2DSZA 4R0XA 3UF8A 1O6IA 3KAGA 2KE0A 3B9AA 2YBUA 1OGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP9 A;  2F21 A;  1TCO C;  2MPH A;  4QT3 A;  2Y78 A;  1ZK6 A;  2VCD A;  2ZQT A;  4ODN A;  4DRQ A;  1KT1 A;  3O5I A;  2JZV A;  2M1I A;  2RUR A;  2D9F A;  1QPL A;  1FKL A;  3JYM A;  4ODM A;  2LKN A;  3NI6 A;  4JYS A;  1ROT A;  1FKB A;  2PPO A;  2PV2 A;  5HW6 A;  3PRD A;  1R9H A;  5GPG A;  1N1A A;  3CGN A;  1J6Y A;  1BL4 A;  1Q1C A;  2ZR4 A;  3EY6 A;  2LPV A;  3KAH A;  2F2D A;  2FKE A;  4LAY A;  5D75 A;  4FAP A;  4GIV A;  1J4R A;  4ODQ A;  3TDB A;  4DRM A;  1D7J A;  2XP6 A;  1Q6H A;  4DH0 A;  3TC5 A;  2MLX A;  3NRK A;  4ODR A;  1EYM A;  4DRK A;  4DRH A;  2XP4 A;  3H9R B;  4ODL A;  2RUC A;  3MDY B;  4U84 A;  1Q6I A;  1QZ2 A;  2XP3 A;  4FN2 A;  5DIU A;  1JVW A;  3RFW A;  1FKH A;  2Q5A A;  1C9H A;  3O5G A;  4IQ2 A;  4DRJ A;  1KT0 A;  4JFM A;  3KAI A;  4W9O A;  2F4E A;  3O5R A;  4DRI A;  1L1P A;  4DZ3 A;  3TCZ A;  3UQB A;  2RUQ A;  5DIV A;  1FKK A;  5DIT A;  2LJ4 A;  2KI3 A;  3O5D A;  3PA7 A;  3O5O A;  2M2A A;  5HW8 A;  1FKI A;  2XP5 A;  1PBK A;  4MSP A;  4TW6 A;  2RUD A;  5HKG A;  3OOB A;  4TYO A;  1F40 A;  2KGJ A;  2L2S A;  4DT4 A;  2ZQU A;  5B8I C;  3UQA A;  2RSE A;  1BKF A;  5BXJ A;  4G50 A;  1U79 A;  2MF9 A;  3JYJ A;  1J4I A;  4N19 A;  3KZ7 A;  3UI4 A;  3JXV A;  2DG9 A;  4W9P A;  3RGC A;  5I98 A;  3KAD A;  4JFK A;  2ITK A;  4MGV A;  1A7X A;  4JFI A;  1B6C A;  2MLZ A;  2ZR6 A;  3VAW A;  4DIP A;  1P5Q A;  2XPA A;  4DZ2 A;  4TNS A;  4TW8 A;  4J4O A;  1FKS A;  2IF4 A;  5HUA A;  4QIB A;  4JFJ A;  2OFN A;  3PRB A;  2AWG A;  4LAV A;  1T11 A;  3O5E A;  3O5P A;  3UQI A;  3GPK A;  2LGO A;  2PV3 A;  1M5Y A;  1ZCN A;  4C02 B;  4DRO A;  1FKJ A;  4O2T A;  1Q6U A;  1FKF A;  3KAC A;  1W26 A;  4U86 A;  5HTG A;  3O5Q A;  1YAT A;  5HW7 A;  5HWC A;  2MLY A;  3UI6 A;  2VN1 A;  1F8A B;  1NSG A;  3KAB A;  4U85 A;  3IK8 A;  1FKG A;  4IQC A;  1Y0O A;  1QPF A;  4TW7 A;  3O5M A;  4IPX A;  3IKG A;  5J6E A;  3LUO A;  4JFL A;  1FD9 A;  3NTP A;  2PV1 A;  2DG4 A;  1NMW A;  3WH0 A;  1EQ3 A;  2PPN A;  4ODO A;  5HT1 A;  5HWB A;  4G2P A;  1PIN A;  2PBC A;  3B7X A;  2XP8 A;  2N87 A;  3I6C A;  3KAF A;  1HXV A;  3UI5 A;  4DRN A;  1FKD A;  2ZQS A;  4QT2 A;  3KCE A;  1FJD A;  1JNS A;  2KO7 A;  4LAW A;  3CGM A;  4W9Q A;  4LAX A;  3IHZ A;  1FAP A;  1FKR A;  2PPP A;  3O5F A;  2ZQV A;  4GGQ A;  2XPB A;  1J4H A;  4J4N A;  3FAP A;  3O5K A;  2KR7 A;  2MNT A;  3O5J A;  4ODP A;  2RQS A;  1D7I A;  1D7H A;  1D6O A;  1YW5 A;  1NMV A;  3ODK A;  3O5L A;  2K8I A;  4NNR A;  4DRP A;  1ROU A;  4R0X A;  3UF8 A;  3IKD A;  1JNT A;  2DG3 A;  2FAP A;  2XP7 A;  4ITZ A;  4TX0 A;  2KFW A;  4ODK A;  3KAG A;  2UZ5 A;  2KE0 A;  2M08 A;  1FKT A;  2ZR5 A;  4BF8 A; 
#chains in the Genus database with same CATH topology
 2ZQT A;  2D9F A;  1TFV A;  1ROT A;  1FKB A;  1W9P A;  5HW6 A;  1R9H A;  1J6Y A;  3CZ8 A;  4WKA A;  1W1V A;  3GU0 A;  3KAH A;  1J4R A;  3TDB A;  1GRJ A;  1EHN A;  4DH0 A;  1LG2 A;  3TC5 A;  4DRH A;  3RM9 A;  4MNL A;  2RUC A;  1Q6I A;  2XP3 A;  4URI A;  1JVW A;  3RFW A;  1ZU8 A;  5JH8 A;  4DWS D;  3O5G A;  4PTM A;  3RM8 A;  3KAI A;  4DRI A;  3UQB A;  2RUQ A;  5DIT A;  2LJ4 A;  1PBK A;  2WLY A;  4QZV B;  1ZBC A;  1E9L A;  3AS3 A;  3FXY A;  3UQA A;  3QOK A;  5BXJ A;  3WL0 A;  1W9U A;  4N19 A;  2MF9 A;  3AS0 A;  3FY1 A;  5I98 A;  2ITK A;  1ZBV A;  4JFI A;  2MLZ A;  4DIP A;  4ZPV R;  4ZPT R;  4TW8 A;  4S3K A;  1K9T A;  3B8S A;  4R5E A;  4QIB A;  3WQV A;  4JFJ A;  1E44 A;  2OFN A;  2PI6 A;  1T11 A;  3O5P A;  1UR9 A;  2G8Z A;  1ZCN A;  4O2T A;  1YAT A;  3IK8 A;  3O5M A;  3B9D A;  4IPX A;  5J6E A;  4L3N A;  3LUO A;  1HKK A;  4Z2I A;  4ODO A;  4MNK A;  3B7X A;  3I6C A;  3WD3 A;  1HXV A;  5DEZ A;  4QT2 A;  1JNS A;  4LAW A;  4W9Q A;  2DT1 A;  3PRA A;  1FKR A;  4KQZ A;  4J4N A;  1D7I A;  1D7H A;  1D6O A;  1YW5 A;  3BXW A;  1GOI A;  2WK2 A;  1JNT A;  2A3A A;  4WJX A;  2DSU A;  2KFW A;  1FKT A;  4DWS B;  3KAD A;  4BF8 A;  1TCO C;  2MPH A;  4DRQ A;  2Y78 A;  3O5I A;  1LL7 A;  3ARU A;  3WD1 A;  3NI6 A;  4WIW A;  3ARX A;  3CHD A;  3G6M A;  2PV2 A;  3PRD A;  5GPG A;  1N1A A;  4P8W A;  3EY6 A;  2ZR4 A;  1VF8 A;  4Z2G A;  4FAP A;  2FKE A;  1LL4 A;  2PN0 A;  2XP6 A;  1EYM A;  3H9R B;  4U84 A;  1FKH A;  3AS2 A;  3PR9 A;  4IQ2 A;  2F4E A;  1L1P A;  5GPR A;  1W1Y A;  1EDQ A;  3PA7 A;  2M2A A;  2XP5 A;  1ZBK A;  1LQ0 A;  1UR8 A;  4DT4 A;  5B8I C;  4NZC A;  1LL6 A;  1J4I A;  2QF8 A;  3JYJ A;  4WKF A;  3CHF A;  4IT6 A;  4Z2L A;  4MAV A;  3ALG A;  4S3J A;  1A7X A;  2ZR6 A;  2O9O A;  4DZ2 A;  5DO2 A;  1X6L A;  1HKM A;  4LAV A;  2P4V A;  3GPK A;  3ARR A;  3B9E A;  4Z2J A;  3ARP A;  3CHE A;  1W1T A;  1F8A B;  3WQW A;  4TW7 A;  1HJW A;  2G41 A;  3NTP A;  2DG4 A;  1NMW A;  3OA5 A;  1EQ3 A;  5HT1 A;  4HBE A;  5HWB A;  1PIN A;  2PBC A;  4P8V A;  3UI5 A;  4DRN A;  4UDM A;  3KCE A;  1W9V A;  1FJD A;  3CGM A;  2XPB A;  3WD2 A;  2KR7 A;  1ITX A;  1RD6 A;  4NNR A;  1GUV A;  4DWS A;  2DSV A;  3CHC A;  3IKD A;  2DG3 A;  2FAP A;  4ITZ A;  4MPK A;  2UZ5 A;  3WD0 A;  2DT0 A;  1OGG A;  1WNO A;  4QT3 A;  3EIP A;  2OLH A;  1ZB5 A;  4XAK A;  2JZV A;  2M1I A;  1ZL1 A;  2LKN A;  2PPO A;  1E6Z A;  3CGN A;  5GQB A;  3ALF A;  1XHG A;  4AY1 A;  2F2D A;  4LAY A;  2B31 A;  1LJY A;  2DSW A;  1GPF A;  2MLX A;  3NRK A;  4Q22 A;  2XP4 A;  5DIU A;  1JNE A;  1QZ2 A;  2Q5A A;  3WD4 A;  1C9H A;  3ARV A;  4W9O A;  4WK9 A;  2A3C A;  1HKJ A;  1JCH B;  4MNM A;  2ESC A;  3ARZ A;  3RM4 A;  3O5O A;  4HAR A;  1FKI A;  4Q7N A;  4MSP A;  4TW6 A;  1X6N A;  3G6L A;  4TYO A;  2F23 A;  2ETN A;  2A3B A;  2ZQU A;  1BKF A;  4G50 A;  1U79 A;  4KR0 B;  3KZ7 A;  3UI4 A;  3GTY X;  3JXV A;  3WL1 A;  4W9P A;  1NH6 A;  1D2K A;  4MGV A;  1B6C A;  2O92 A;  1P5Q A;  2DT3 A;  2XPA A;  4TNS A;  4J4O A;  2DPE A;  5HBF A;  2AWG A;  3O5E A;  3UQI A;  2LGO A;  2PV3 A;  1M5Y A;  2YBT A;  2IUZ A;  4C02 B;  1EIB A;  3W4R A;  1Q6U A;  3KAC A;  5HTG A;  3O5Q A;  4ML4 A;  2VN1 A;  3KAB A;  1JND A;  1FKG A;  1ZBW A;  1QPF A;  3WH0 A;  1FD9 A;  1KFW A;  2PV1 A;  4P8X A;  4L72 B;  4G2P A;  1HKI A;  1E15 A;  2XP8 A;  3KAF A;  1FKD A;  5DF0 A;  4LAX A;  1CTN A;  4WKH A;  3O5F A;  1J4H A;  3AQU A;  3O5K A;  3ART A;  4ODP A;  3ODK A;  4ODL A;  5HW8 A;  4DRP A;  2EUL A;  2K8I A;  3O5L A;  1NWR A;  2XP7 A;  4TX0 A;  4ODK A;  3ARS A;  2M08 A;  1HJX A;  2WM0 A;  2ZR5 A;  4Z2K A;  2XP9 A;  2F21 A;  1ZK6 A;  2VCD A;  4ODN A;  2WLZ A;  1KT1 A;  4MTV A;  3AS1 A;  2RUR A;  1QPL A;  1FKL A;  3ARY A;  3JYM A;  4IT4 A;  4ODM A;  4JYS A;  1FFR A;  4DWS C;  2B5U B;  1NWU A;  1BL4 A;  1E6R A;  1Q1C A;  2LPV A;  5D75 A;  4ZS6 A;  4GIV A;  4ODQ A;  4DRM A;  1D7J A;  1Q6H A;  4Z2H A;  4ODR A;  4DRK A;  4P8U A;  5HW7 A;  3MDY B;  4FN2 A;  1E6P A;  4DRJ A;  1KT0 A;  4JFM A;  3O5R A;  4W5U A;  4DZ3 A;  3TCZ A;  5DIV A;  3WKZ A;  1FKK A;  2KI3 A;  3O5D A;  3ARO A;  3CH9 A;  2RUD A;  1XRV A;  5HKG A;  3OOB A;  1IX5 A;  1F40 A;  2KGJ A;  2L2S A;  3ARW A;  2RSE A;  1SR0 A;  2DG9 A;  3RGC A;  4JFK A;  1FFQ A;  1HJV A;  1SYT A;  3VAW A;  4HBO A;  1FKS A;  2FDM A;  2AOS A;  2IF4 A;  5HUA A;  1E6N A;  3PRB A;  4ZPW R;  3RME A;  4DRO A;  1FKJ A;  1FKF A;  1W26 A;  4U86 A;  5HWC A;  2MLY A;  3UI6 A;  1NSG A;  4U85 A;  1OWQ A;  4IQC A;  1NWT A;  1Y0O A;  4LGX A;  3IKG A;  3ARQ A;  4JFL A;  1H0I A;  3WIJ A;  2PPN A;  4MNJ A;  1WB0 A;  2N87 A;  2DT2 A;  1WAW A;  2ZQS A;  4NSB A;  2KO7 A;  3IHZ A;  1FAP A;  2A3E A;  1NWS A;  2PPP A;  2ZQV A;  4GGQ A;  1H0G A;  3FAP A;  2MNT A;  3O5J A;  1W1P A;  2RQS A;  1NMV A;  1ROU A;  1LG1 A;  2DSZ A;  4R0X A;  3UF8 A;  1O6I A;  3KAG A;  2KE0 A;  3B9A A;  2YBU A;  3BMB A;  1OGB A; 
#chains in the Genus database with same CATH homology
 2ZQT A;  2D9F A;  1TFV A;  1ROT A;  1FKB A;  1W9P A;  5HW6 A;  1R9H A;  1J6Y A;  3CZ8 A;  4WKA A;  1W1V A;  3KAH A;  1J4R A;  3TDB A;  1EHN A;  4DH0 A;  1LG2 A;  3TC5 A;  4DRH A;  3RM9 A;  4MNL A;  2RUC A;  1Q6I A;  2XP3 A;  4URI A;  1JVW A;  3RFW A;  1ZU8 A;  5JH8 A;  4DWS D;  3O5G A;  4PTM A;  3RM8 A;  3KAI A;  4DRI A;  3UQB A;  2RUQ A;  5DIT A;  2LJ4 A;  1PBK A;  2WLY A;  4QZV B;  1ZBC A;  1E9L A;  3AS3 A;  3FXY A;  3UQA A;  3QOK A;  5BXJ A;  3WL0 A;  1W9U A;  4N19 A;  2MF9 A;  3AS0 A;  3FY1 A;  5I98 A;  2ITK A;  1ZBV A;  4JFI A;  2MLZ A;  4DIP A;  4ZPV R;  4ZPT R;  4TW8 A;  4S3K A;  1K9T A;  3B8S A;  4R5E A;  4QIB A;  3WQV A;  4JFJ A;  2OFN A;  2PI6 A;  1T11 A;  3O5P A;  1UR9 A;  2G8Z A;  1ZCN A;  4O2T A;  1YAT A;  3IK8 A;  3O5M A;  3B9D A;  4IPX A;  5J6E A;  4L3N A;  3LUO A;  1HKK A;  4Z2I A;  4ODO A;  4MNK A;  3B7X A;  3I6C A;  3WD3 A;  1HXV A;  5DEZ A;  4QT2 A;  1JNS A;  4LAW A;  4W9Q A;  2DT1 A;  3PRA A;  1FKR A;  4KQZ A;  4J4N A;  1D7I A;  1D7H A;  1D6O A;  1YW5 A;  3BXW A;  1GOI A;  2WK2 A;  1JNT A;  2A3A A;  4WJX A;  2DSU A;  2KFW A;  1FKT A;  4DWS B;  3KAD A;  4BF8 A;  1TCO C;  2MPH A;  4DRQ A;  2Y78 A;  3O5I A;  1LL7 A;  3ARU A;  3WD1 A;  3NI6 A;  4WIW A;  3ARX A;  3CHD A;  3G6M A;  2PV2 A;  3PRD A;  5GPG A;  1N1A A;  4P8W A;  3EY6 A;  2ZR4 A;  1VF8 A;  4Z2G A;  4FAP A;  2FKE A;  1LL4 A;  2XP6 A;  1EYM A;  3H9R B;  4U84 A;  1FKH A;  3AS2 A;  3PR9 A;  4IQ2 A;  2F4E A;  1L1P A;  5GPR A;  1W1Y A;  1EDQ A;  3PA7 A;  2M2A A;  2XP5 A;  1ZBK A;  1LQ0 A;  1UR8 A;  4DT4 A;  5B8I C;  4NZC A;  1LL6 A;  1J4I A;  2QF8 A;  3JYJ A;  4WKF A;  3CHF A;  4IT6 A;  4Z2L A;  4MAV A;  3ALG A;  4S3J A;  1A7X A;  2ZR6 A;  2O9O A;  4DZ2 A;  5DO2 A;  1X6L A;  1HKM A;  4LAV A;  3GPK A;  3ARR A;  3B9E A;  4Z2J A;  3ARP A;  3CHE A;  1W1T A;  1F8A B;  3WQW A;  4TW7 A;  1HJW A;  2G41 A;  3NTP A;  2DG4 A;  1NMW A;  3OA5 A;  1EQ3 A;  5HT1 A;  4HBE A;  5HWB A;  1PIN A;  2PBC A;  4P8V A;  3UI5 A;  4DRN A;  3KCE A;  1W9V A;  1FJD A;  3CGM A;  2XPB A;  3WD2 A;  2KR7 A;  1ITX A;  1RD6 A;  4NNR A;  1GUV A;  4DWS A;  2DSV A;  3CHC A;  3IKD A;  2DG3 A;  2FAP A;  4ITZ A;  4MPK A;  2UZ5 A;  3WD0 A;  2DT0 A;  1OGG A;  1WNO A;  4QT3 A;  2OLH A;  1ZB5 A;  4XAK A;  2JZV A;  2M1I A;  1ZL1 A;  2LKN A;  2PPO A;  1E6Z A;  3CGN A;  5GQB A;  3ALF A;  1XHG A;  4AY1 A;  2F2D A;  4LAY A;  2B31 A;  1LJY A;  2DSW A;  1GPF A;  2MLX A;  3NRK A;  4Q22 A;  2XP4 A;  5DIU A;  1JNE A;  1QZ2 A;  2Q5A A;  3WD4 A;  1C9H A;  3ARV A;  4W9O A;  4WK9 A;  2A3C A;  1HKJ A;  4MNM A;  2ESC A;  3ARZ A;  3RM4 A;  3O5O A;  4HAR A;  1FKI A;  4Q7N A;  4MSP A;  4TW6 A;  1X6N A;  3G6L A;  4TYO A;  2A3B A;  2ZQU A;  1BKF A;  4G50 A;  1U79 A;  4KR0 B;  3KZ7 A;  3UI4 A;  3JXV A;  3WL1 A;  4W9P A;  1NH6 A;  1D2K A;  4MGV A;  1B6C A;  2O92 A;  1P5Q A;  2DT3 A;  2XPA A;  4TNS A;  4J4O A;  2DPE A;  5HBF A;  2AWG A;  3O5E A;  3UQI A;  2LGO A;  2PV3 A;  1M5Y A;  2YBT A;  2IUZ A;  4C02 B;  1EIB A;  3W4R A;  1Q6U A;  3KAC A;  5HTG A;  3O5Q A;  4ML4 A;  2VN1 A;  3KAB A;  1JND A;  1FKG A;  1ZBW A;  1QPF A;  3WH0 A;  1FD9 A;  1KFW A;  2PV1 A;  4P8X A;  4L72 B;  4G2P A;  1HKI A;  1E15 A;  2XP8 A;  3KAF A;  1FKD A;  5DF0 A;  4LAX A;  1CTN A;  4WKH A;  3O5F A;  1J4H A;  3AQU A;  3O5K A;  3ART A;  4ODP A;  3ODK A;  4ODL A;  5HW8 A;  4DRP A;  3O5L A;  2K8I A;  1NWR A;  2XP7 A;  4TX0 A;  4ODK A;  3ARS A;  2M08 A;  1HJX A;  2WM0 A;  2ZR5 A;  4Z2K A;  2XP9 A;  2F21 A;  1ZK6 A;  2VCD A;  4ODN A;  2WLZ A;  1KT1 A;  4MTV A;  3AS1 A;  2RUR A;  1QPL A;  1FKL A;  3ARY A;  3JYM A;  4IT4 A;  4ODM A;  4JYS A;  1FFR A;  4DWS C;  1NWU A;  1BL4 A;  1E6R A;  1Q1C A;  2LPV A;  5D75 A;  4ZS6 A;  4GIV A;  4ODQ A;  4DRM A;  1D7J A;  1Q6H A;  4Z2H A;  4ODR A;  4DRK A;  4P8U A;  5HW7 A;  3MDY B;  4FN2 A;  1E6P A;  4DRJ A;  1KT0 A;  4JFM A;  3O5R A;  4W5U A;  4DZ3 A;  3TCZ A;  5DIV A;  3WKZ A;  1FKK A;  2KI3 A;  3O5D A;  3ARO A;  3CH9 A;  2RUD A;  1XRV A;  5HKG A;  3OOB A;  1IX5 A;  1F40 A;  2KGJ A;  2L2S A;  3ARW A;  2RSE A;  1SR0 A;  2DG9 A;  3RGC A;  4JFK A;  1FFQ A;  1HJV A;  1SYT A;  3VAW A;  4HBO A;  1FKS A;  2FDM A;  2AOS A;  2IF4 A;  5HUA A;  1E6N A;  3PRB A;  4ZPW R;  3RME A;  4DRO A;  1FKJ A;  1FKF A;  1W26 A;  4U86 A;  5HWC A;  2MLY A;  3UI6 A;  1NSG A;  4U85 A;  1OWQ A;  4IQC A;  1NWT A;  1Y0O A;  4LGX A;  3IKG A;  3ARQ A;  4JFL A;  1H0I A;  3WIJ A;  2PPN A;  4MNJ A;  1WB0 A;  2N87 A;  2DT2 A;  1WAW A;  2ZQS A;  4NSB A;  2KO7 A;  3IHZ A;  1FAP A;  2A3E A;  1NWS A;  2PPP A;  2ZQV A;  4GGQ A;  1H0G A;  3FAP A;  2MNT A;  3O5J A;  1W1P A;  2RQS A;  1NMV A;  1ROU A;  1LG1 A;  2DSZ A;  4R0X A;  3UF8 A;  1O6I A;  3KAG A;  2KE0 A;  3B9A A;  2YBU A;  1OGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...