2F2DA

Solution structure of the fk506-binding domain of human fkbp38
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
121
structure length
121
Chain Sequence
b'MREWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 38 kDa FK-506 binding protein homolog, FKBP38
publication title Solution Structure of the FK506-Binding Domain of Human FKBP38
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 11
structure length 121
sequence length 121
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2f2dA00
1ROUA 2RUCA 3O5KA 2KI3A 4ODRA 2XPAA 4JFJA 1BL4A 4DZ2A 4IQCA 2DG4A 3KZ7A 1QPLA 2XP7A 4NNRA 5HUAA 1J4HA 1M5YA 2M1IA 4BF8A 2MNTA 3NTPA 4GGQA 3TCZA 5HW8A 2MLYA 5HW6A 2ZQTA 4JFKA 4ODNA 4DRQA 3JXVA 4TNSA 5B8IC 4LAVA 4FAPA 2D9FA 2LGOA 2KE0A 1J4IA 5BXJA 4LAXA 1JVWA 3VAWA 4DT4A 2KFWA 1J6YA 2KO7A 4JFLA 4ODPA 4ODQA 1ROTA 1D7JA 1FKKA 1ZK6A 2JZVA 5HWCA 1L1PA 3NRKA 5HWBA 2MLZA 2PBCA 1FKLA 3UQBA 2M08A 2ZR6A 4W9OA 4DROA 2XP5A 1U79A 2MPHA 3KADA 1YW5A 3EY6A 3LUOA 3KACA 3KAIA 1FKGA 5HTGA 4DRIA 2MLXA 1FKSA 4FN2A 1Y0OA 4DRMA 1D6OA 2XP3A 3O5LA 1PINA 4R0XA 1FJDA 3O5DA 3UI4A 3H9RB 3WH0A 2RUQA 3IK8A 4GIVA 2KGJA 2K8IA 3O5QA 3ODKA 2PPNA 1Q6IA 1Q6UA 4QT2A 4TX0A 5GPGA 5HW7A 3NI6A 1FKIA 2F2DA 3KABA 2AWGA 5DIVA 1FAPA 1A7XA 2XPBA 3O5FA 1FKJA 1PBKA 4QT3A 2VCDA 4TW7A 2ZR4A 1KT0A 3O5MA 3JYJA 3IHZA 5HKGA 1Q1CA 2ZQUA 4MGVA 1D7IA 3UI5A 1B6CA 2LKNA 1QZ2A 3IKDA 4J4OA 4QIBA 1N1AA 3O5JA 1FD9A 2DG9A 2F21A 4DH0A 3JYMA 1FKHA 2XP4A 1BKFA 2MF9A 2FKEA 3O5IA 1NMWA 1FKDA 3CGMA 2PV1A 2N87A 1Q6HA 1QPFA 2LJ4A 4DIPA 2ZR5A 3PA7A 3UQAA 4ODOA 1F8AB 1EYMA 1D7HA 2VN1A 3O5RA 4DRJA 4O2TA 4JFIA 4DZ3A 3RGCA 1EQ3A 2PPOA 2M2AA 1YATA 4N19A 1W26A 2L2SA 2RQSA 1HXVA 4TW8A 1KT1A 5HT1A 3UQIA 2F4EA 2RUDA 3FAPA 1ZCNA 3PRDA 4TYOA 4U84A 3TC5A 2LPVA 3O5EA 3UF8A 4DRPA 3KAHA 3KAGA 3O5PA 1FKBA 2XP8A 5I98A 2RSEA 4DRHA 1FKFA 3O5GA 2OFNA 4U86A 3KAFA 3O5OA 2DG3A 1R9HA 4ITZA 1J4RA 4ODLA 2RURA 3GPKA 4IQ2A 2Y78A 3UI6A 2FAPA 3OOBA 5DITA 2PPPA 1NMVA 4ODKA 2XP9A 4TW6A 4G2PA 4JFMA 1F40A 4MSPA 4C02B 1FKRA 1FKTA 4LAWA 3B7XA 2IF4A 3MDYB 4J4NA 4ODMA 4LAYA 4U85A 4W9QA 2ITKA 2UZ5A 3I6CA 2ZQVA 5DIUA 1JNSA 4W9PA 2ZQSA 4DRKA 4JYSA 3CGNA 4G50A 2KR7A 5J6EA 4IPXA 3KCEA 3PRBA 1JNTA 4DRNA 5D75A 3TDBA 3IKGA 2PV2A 1T11A 1TCOC 2XP6A 1C9HA 2Q5AA 3RFWA 2PV3A 1P5QA 1NSGA
chains in the Genus database with same CATH superfamily
2KI3A 4JFJA 1BL4A 4Z2LA 2XP7A 1J4HA 1UR8A 3CHFA 2MLYA 2OLHA 3ARWA 4ODNA 4DRQA 1GPFA 1J4IA 3VAWA 1J6YA 2KFWA 3ARSA 3WIJA 1LG2A 1FKKA 1ZBWA 1W9UA 1HKKA 4P8XA 2MLZA 3UQBA 2AOSA 4W9OA 2XP5A 1U79A 2MPHA 3LUOA 1FKGA 4DRIA 1FKSA 4HBEA 1GOIA 3ARXA 3G6MA 3AROA 4MTVA 4DWSD 3O5DA 3UI4A 1HKJA 2K8IA 1X6NA 3ARVA 3ODKA 1Q6UA 1ZL1A 3BXWA 3PR9A 3OA5A 4Z2HA 2AWGA 1E6RA 1A7XA 3ALFA 1GUVA 2VCDA 5HKGA 4Z2IA 3ARTA 4MGVA 3ARYA 4ZPWR 1W9VA 2F23A 3CZ8A 3O5JA 2DG9A 4MNLA 2F21A 1FKHA 4Q22A 2XP4A 3O5IA 1NMWA 1FKDA 4KR0B 2LJ4A 3ARUA 4WJXA 3PA7A 2DSUA 3ARZA 3O5RA 3RGCA 2DSZA 5JH8A 3B8SA 1KT1A 5HT1A 2RUDA 3FAPA 1NWTA 2LPVA 3O5EA 4XAKA 4DWSC 3CHDA 3KAGA 3O5PA 1OGGA 1E15A 4DRHA 1LL4A 2B5UB 2O92A 1R9HA 1J4RA 3ARPA 1HJXA 4ODKA 1JNEA 4G2PA 4JFMA 4C02B 1FKRA 4J4NA 4ODMA 4LAYA 4U85A 4HBOA 2ZQVA 2PI6A 4LGXA 5J6EA 3PRBA 5D75A 1LQ0A 2PV2A 4TW6A 1C9HA 1ZBKA 1P5QA 3O5KA 2RUCA 3WD2A 2XPAA 4NSBA 2DG4A 4NNRA 2M1IA 3TCZA 5HW8A 1H0GA 2ZQTA 5B8IC 3JXVA 4TNSA 1IX5A 2WLYA 4LAXA 4DT4A 1XRVA 4ODQA 1ZK6A 2JZVA 5HWCA 3AS3A 2P4VA 4MNKA 2PBCA 2ZR6A 3KADA 1LG1A 3EY6A 3KACA 3KAIA 5HTGA 3WD3A 2XP3A 1PINA 1HJWA 1ZU8A 2RUQA 3EIPA 2KGJA 3W4RA 3O5QA 1OGBA 3QOKA 1W9PA 4TX0A 1LJYA 1EDQA 2ESCA 1NWSA 1E44A 3O5MA 1K9TA 3UI5A 4MPKA 4Z2JA 4QIBA 2A3BA 1FD9A 4L72B 3WKZA 3WD4A 2MF9A 4Q7NA 5HBFA 4UDMA 2N87A 4WK9A 1Q6HA 1QPFA 2A3EA 1F8AB 4W5UA 4DRJA 2PN0A 1EQ3A 1FFRA 3WD1A 2M2AA 4QZVB 4N19A 1W26A 2B31A 4TW8A 1X6LA 3UQIA 2YBTA 4DRPA 3KAHA 1EIBA 4AY1A 4U86A 3O5OA 2ETNA 4ITZA 4L3NA 4ODLA 4IQ2A 4DWSA 3OOBA 1NMVA 2DT2A 3CHEA 3AS2A 4KQZA 1E6NA 4MSPA 3AS0A 1W1TA 1E9LA 4DWSB 1D2KA 2UZ5A 4MAVA 1LL7A 1HJVA 1OWQA 4W9PA 2ZQSA 4JYSA 2A3CA 3CGNA 4IT4A 2YBUA 4WKHA 1VF8A 3TDBA 3IKGA 4MNJA 2DPEA 3RFWA 1NSGA 3WQVA 4ODRA 3RM4A 4IQCA 1M5YA 5HW6A 4JFKA 1E6PA 2D9FA 2O9OA 2KE0A 2KO7A 4ODPA 1EHNA 1ROTA 1D7JA 3ALGA 1GRJA 2A3AA 2M08A 4MNMA 4DROA 3WQWA 2WK2A 1SR0A 2MLXA 4FN2A 1RD6A 4DRMA 1D6OA 1LL6A 3IK8A 2DT1A 1WAWA 2PPNA 1Q6IA 2G41A 3NI6A 2F2DA 1H0IA 1FFQA 1FKJA 4QT3A 3GTYX 3JYJA 3IHZA 4ZPTR 3B9AA 1Q1CA 2DT0A 1B6CA 2LKNA 3IKDA 4J4OA 4DH0A 3JYMA 1ITXA 1JNDA 3AS1A 4ZS6A 2FKEA 3CGMA 4Z2GA 4R5EA 4DIPA 3UQAA 1D7HA 2VN1A 4DZ3A 4JFIA 1UR9A 1W1YA 1YATA 2L2SA 1TFVA 1HXVA 1HKMA 3GU0A 3PRDA 4U84A 3TC5A 1FKBA 3B9EA 5I98A 2RSEA 3O5GA 2OFNA 1HKIA 2DG3A 5BXJA 3UI6A 2RURA 3GPKA 2Y78A 2FAPA 2PPPA 1NWUA 1F40A 5GPRA 4NZCA 2G8ZA 3RM8A 3B7XA 3MDYB 4WKAA 1ZBCA 1KFWA 2ITKA 3I6CA 5DIUA 1JNSA 4S3KA 4DRKA 3ARQA 2DSVA 2KR7A 1ZB5A 4IPXA 3KCEA 1JNTA 1T11A 1TCOC 2XP6A 2Q5AA 2XPBA 2PV3A 4S3JA 2IUZA 1ROUA 1ZBVA 4P8UA 4DZ2A 1NH6A 3KZ7A 1QPLA 5HUAA 4BF8A 2MNTA 3NTPA 4GGQA 5DF0A 1XHGA 5DO2A 2QF8A 4LAVA 4FAPA 2LGOA 3CH9A 1JVWA 4WIWA 4JFLA 4URIA 4WKFA 5DEZA 1WNOA 1L1PA 3NRKA 5HWBA 1CTNA 1FKLA 1YW5A 4ZPVR 2DT3A 1Y0OA 3WL0A 3O5LA 3WD0A 4R0XA 1FJDA 3H9RB 4PTMA 1JCHB 4GIVA 2FDMA 5GPGA 3G6LA 4QT2A 5HW7A 3B9DA 1FKIA 3KABA 5DIVA 1FAPA 3O5FA 1PBKA 4TW7A 2ZR4A 1KT0A 4Z2KA 2ZQUA 1D7IA 1QZ2A 3WL1A 1N1AA 2EULA 3AQUA 1BKFA 2PV1A 2ZR5A 5GQBA 4ODOA 1EYMA 4O2TA 2PPOA 2RQSA 3ARRA 1W1VA 3FXYA 4ML4A 3RM9A 2F4EA 1ZCNA 4TYOA 3UF8A 2WLZA 2XP8A 3CHCA 1FKFA 3KAFA 4P8VA 3BMBA 5DITA 1WB0A 3PRAA 2DSWA 1E6ZA 2XP9A 3RMEA 1SYTA 1FKTA 4LAWA 2IF4A 4HARA 4W9QA 3FY1A 4P8WA 1NWRA 4IT6A 4G50A 4DRNA 1W1PA 1O6IA 2WM0A 3WH0A
chains in the Genus database with same CATH topology
2KI3A 4JFJA 1BL4A 4Z2LA 2XP7A 1J4HA 1UR8A 3CHFA 2MLYA 2OLHA 3ARWA 4ODNA 4DRQA 1GPFA 1J4IA 3VAWA 1J6YA 2KFWA 3ARSA 3WIJA 1LG2A 1FKKA 1ZBWA 1W9UA 1HKKA 4P8XA 2MLZA 3UQBA 2AOSA 4W9OA 2XP5A 1U79A 2MPHA 3LUOA 1FKGA 4DRIA 1FKSA 4HBEA 1GOIA 3ARXA 3G6MA 3AROA 4MTVA 4DWSD 3O5DA 3UI4A 1HKJA 2K8IA 1X6NA 3ARVA 3ODKA 1Q6UA 1ZL1A 3BXWA 3PR9A 3OA5A 4Z2HA 2AWGA 1E6RA 1A7XA 3ALFA 1GUVA 2VCDA 5HKGA 4Z2IA 3ARTA 4MGVA 3ARYA 4ZPWR 1W9VA 3CZ8A 3O5JA 2DG9A 4MNLA 2F21A 1FKHA 4Q22A 2XP4A 3O5IA 1NMWA 1FKDA 4KR0B 2LJ4A 3ARUA 4WJXA 3PA7A 2DSUA 3ARZA 3O5RA 3RGCA 2DSZA 5JH8A 3B8SA 1KT1A 5HT1A 2RUDA 3FAPA 1NWTA 2LPVA 3O5EA 4XAKA 4DWSC 3CHDA 3KAGA 3O5PA 1OGGA 1E15A 4DRHA 1LL4A 2O92A 1R9HA 1J4RA 3ARPA 1HJXA 4ODKA 1JNEA 4G2PA 4JFMA 4C02B 1FKRA 4J4NA 4ODMA 4LAYA 4U85A 4HBOA 2ZQVA 2PI6A 4LGXA 5J6EA 3PRBA 5D75A 1LQ0A 2PV2A 4TW6A 1C9HA 1ZBKA 1P5QA 3O5KA 2RUCA 3WD2A 2XPAA 4NSBA 2DG4A 4NNRA 2M1IA 3TCZA 5HW8A 1H0GA 2ZQTA 5B8IC 3JXVA 4TNSA 1IX5A 2WLYA 4LAXA 4DT4A 1XRVA 4ODQA 1ZK6A 2JZVA 5HWCA 3AS3A 4MNKA 2PBCA 2ZR6A 3KADA 1LG1A 3EY6A 3KACA 3KAIA 5HTGA 3WD3A 2XP3A 1PINA 1HJWA 1ZU8A 2RUQA 2KGJA 3W4RA 3O5QA 1OGBA 3QOKA 1W9PA 4TX0A 1LJYA 1EDQA 2ESCA 1NWSA 3O5MA 1K9TA 3UI5A 4MPKA 4Z2JA 4QIBA 2A3BA 1FD9A 4L72B 3WKZA 3WD4A 2MF9A 4Q7NA 5HBFA 2N87A 4WK9A 1Q6HA 1QPFA 2A3EA 1F8AB 4W5UA 4DRJA 1EQ3A 1FFRA 3WD1A 2M2AA 4QZVB 4N19A 1W26A 2B31A 4TW8A 1X6LA 3UQIA 2YBTA 4DRPA 3KAHA 1EIBA 4AY1A 4U86A 3O5OA 4ITZA 4ODLA 4L3NA 4IQ2A 4DWSA 3OOBA 1NMVA 2DT2A 3CHEA 3AS2A 4KQZA 1E6NA 4MSPA 3AS0A 1W1TA 1E9LA 4DWSB 1D2KA 2UZ5A 4MAVA 1LL7A 1HJVA 1OWQA 4W9PA 2ZQSA 4JYSA 2A3CA 3CGNA 4IT4A 2YBUA 4WKHA 1VF8A 3TDBA 3IKGA 4MNJA 2DPEA 3RFWA 1NSGA 3WQVA 4ODRA 3RM4A 4IQCA 1M5YA 5HW6A 4JFKA 1E6PA 2D9FA 2O9OA 2KE0A 2KO7A 4ODPA 1EHNA 1ROTA 1D7JA 3ALGA 2A3AA 2M08A 4MNMA 4DROA 3WQWA 2WK2A 1SR0A 2MLXA 4FN2A 1RD6A 4DRMA 1D6OA 1LL6A 3IK8A 2DT1A 1WAWA 2PPNA 1Q6IA 2G41A 3NI6A 2F2DA 1H0IA 1FFQA 1FKJA 4QT3A 3JYJA 3IHZA 4ZPTR 3B9AA 1Q1CA 2DT0A 1B6CA 2LKNA 3IKDA 4J4OA 4DH0A 3JYMA 1ITXA 1JNDA 3AS1A 4ZS6A 2FKEA 3CGMA 4Z2GA 4R5EA 4DIPA 3UQAA 1D7HA 2VN1A 4DZ3A 4JFIA 1UR9A 1W1YA 1YATA 2L2SA 1TFVA 1HXVA 1HKMA 3PRDA 4U84A 3TC5A 1FKBA 3B9EA 5I98A 2RSEA 3O5GA 2OFNA 1HKIA 2DG3A 5BXJA 3UI6A 2RURA 3GPKA 2Y78A 2FAPA 2PPPA 1NWUA 1F40A 5GPRA 4NZCA 2G8ZA 3RM8A 3B7XA 3MDYB 4WKAA 1ZBCA 1KFWA 2ITKA 3I6CA 5DIUA 1JNSA 4S3KA 4DRKA 3ARQA 2DSVA 2KR7A 1ZB5A 4IPXA 3KCEA 1JNTA 1T11A 1TCOC 2XP6A 2Q5AA 2XPBA 2PV3A 4S3JA 2IUZA 1ROUA 1ZBVA 4P8UA 4DZ2A 1NH6A 3KZ7A 1QPLA 5HUAA 4BF8A 2MNTA 3NTPA 4GGQA 5DF0A 1XHGA 5DO2A 2QF8A 4LAVA 4FAPA 2LGOA 3CH9A 1JVWA 4WIWA 4JFLA 4URIA 4WKFA 5DEZA 1WNOA 1L1PA 3NRKA 5HWBA 1CTNA 1FKLA 1YW5A 4ZPVR 2DT3A 1Y0OA 3WL0A 3O5LA 3WD0A 4R0XA 1FJDA 3H9RB 4PTMA 4GIVA 2FDMA 5GPGA 3G6LA 4QT2A 5HW7A 3B9DA 1FKIA 3KABA 5DIVA 1FAPA 3O5FA 1PBKA 4TW7A 2ZR4A 1KT0A 4Z2KA 2ZQUA 1D7IA 1QZ2A 3WL1A 1N1AA 3AQUA 1BKFA 2PV1A 2ZR5A 5GQBA 4ODOA 1EYMA 4O2TA 2PPOA 2RQSA 3ARRA 1W1VA 3FXYA 4ML4A 3RM9A 2F4EA 1ZCNA 4TYOA 3UF8A 2WLZA 2XP8A 3CHCA 1FKFA 3KAFA 4P8VA 5DITA 1WB0A 3PRAA 2DSWA 1E6ZA 2XP9A 3RMEA 1SYTA 1FKTA 4LAWA 2IF4A 4HARA 4W9QA 3FY1A 4P8WA 1NWRA 4IT6A 4G50A 4DRNA 1W1PA 1O6IA 2WM0A 3WH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROU A;  2RUC A;  3O5K A;  2KI3 A;  4ODR A;  2XPA A;  4JFJ A;  1BL4 A;  4DZ2 A;  4IQC A;  2DG4 A;  3KZ7 A;  1QPL A;  2XP7 A;  4NNR A;  5HUA A;  1J4H A;  1M5Y A;  2M1I A;  4BF8 A;  2MNT A;  3NTP A;  4GGQ A;  3TCZ A;  5HW8 A;  2MLY A;  5HW6 A;  2ZQT A;  4JFK A;  4ODN A;  4DRQ A;  3JXV A;  4TNS A;  5B8I C;  4LAV A;  4FAP A;  2D9F A;  2LGO A;  2KE0 A;  1J4I A;  5BXJ A;  4LAX A;  1JVW A;  3VAW A;  4DT4 A;  2KFW A;  1J6Y A;  2KO7 A;  4JFL A;  4ODP A;  4ODQ A;  1ROT A;  1D7J A;  1FKK A;  1ZK6 A;  2JZV A;  5HWC A;  1L1P A;  3NRK A;  5HWB A;  2MLZ A;  2PBC A;  1FKL A;  3UQB A;  2M08 A;  2ZR6 A;  4W9O A;  4DRO A;  2XP5 A;  1U79 A;  2MPH A;  3KAD A;  1YW5 A;  3EY6 A;  3LUO A;  3KAC A;  3KAI A;  1FKG A;  5HTG A;  4DRI A;  2MLX A;  1FKS A;  4FN2 A;  1Y0O A;  4DRM A;  1D6O A;  2XP3 A;  3O5L A;  1PIN A;  4R0X A;  1FJD A;  3O5D A;  3UI4 A;  3H9R B;  3WH0 A;  2RUQ A;  3IK8 A;  4GIV A;  2KGJ A;  2K8I A;  3O5Q A;  3ODK A;  2PPN A;  1Q6I A;  1Q6U A;  4QT2 A;  4TX0 A;  5GPG A;  5HW7 A;  3NI6 A;  1FKI A;  2F2D A;  3KAB A;  2AWG A;  5DIV A;  1FAP A;  1A7X A;  2XPB A;  3O5F A;  1FKJ A;  1PBK A;  4QT3 A;  2VCD A;  4TW7 A;  2ZR4 A;  1KT0 A;  3O5M A;  3JYJ A;  3IHZ A;  5HKG A;  1Q1C A;  2ZQU A;  4MGV A;  1D7I A;  3UI5 A;  1B6C A;  2LKN A;  1QZ2 A;  3IKD A;  4J4O A;  4QIB A;  1N1A A;  3O5J A;  1FD9 A;  2DG9 A;  2F21 A;  4DH0 A;  3JYM A;  1FKH A;  2XP4 A;  1BKF A;  2MF9 A;  2FKE A;  3O5I A;  1NMW A;  1FKD A;  3CGM A;  2PV1 A;  2N87 A;  1Q6H A;  1QPF A;  2LJ4 A;  4DIP A;  2ZR5 A;  3PA7 A;  3UQA A;  4ODO A;  1F8A B;  1EYM A;  1D7H A;  2VN1 A;  3O5R A;  4DRJ A;  4O2T A;  4JFI A;  4DZ3 A;  3RGC A;  1EQ3 A;  2PPO A;  2M2A A;  1YAT A;  4N19 A;  1W26 A;  2L2S A;  2RQS A;  1HXV A;  4TW8 A;  1KT1 A;  5HT1 A;  3UQI A;  2F4E A;  2RUD A;  3FAP A;  1ZCN A;  3PRD A;  4TYO A;  4U84 A;  3TC5 A;  2LPV A;  3O5E A;  3UF8 A;  4DRP A;  3KAH A;  3KAG A;  3O5P A;  1FKB A;  2XP8 A;  5I98 A;  2RSE A;  4DRH A;  1FKF A;  3O5G A;  2OFN A;  4U86 A;  3KAF A;  3O5O A;  2DG3 A;  1R9H A;  4ITZ A;  1J4R A;  4ODL A;  2RUR A;  3GPK A;  4IQ2 A;  2Y78 A;  3UI6 A;  2FAP A;  3OOB A;  5DIT A;  2PPP A;  1NMV A;  4ODK A;  2XP9 A;  4TW6 A;  4G2P A;  4JFM A;  1F40 A;  4MSP A;  4C02 B;  1FKR A;  1FKT A;  4LAW A;  3B7X A;  2IF4 A;  3MDY B;  4J4N A;  4ODM A;  4LAY A;  4U85 A;  4W9Q A;  2ITK A;  2UZ5 A;  3I6C A;  2ZQV A;  5DIU A;  1JNS A;  4W9P A;  2ZQS A;  4DRK A;  4JYS A;  3CGN A;  4G50 A;  2KR7 A;  5J6E A;  4IPX A;  3KCE A;  3PRB A;  1JNT A;  4DRN A;  5D75 A;  3TDB A;  3IKG A;  2PV2 A;  1T11 A;  1TCO C;  2XP6 A;  1C9H A;  2Q5A A;  3RFW A;  2PV3 A;  1P5Q A;  1NSG A; 
#chains in the Genus database with same CATH topology
 2KI3 A;  4JFJ A;  1BL4 A;  4Z2L A;  2XP7 A;  1J4H A;  1UR8 A;  3CHF A;  2MLY A;  2OLH A;  3ARW A;  4ODN A;  4DRQ A;  1GPF A;  1J4I A;  3VAW A;  1J6Y A;  2KFW A;  3ARS A;  3WIJ A;  1LG2 A;  1FKK A;  1ZBW A;  1W9U A;  1HKK A;  4P8X A;  2MLZ A;  3UQB A;  2AOS A;  4W9O A;  2XP5 A;  1U79 A;  2MPH A;  3LUO A;  1FKG A;  4DRI A;  1FKS A;  4HBE A;  1GOI A;  3ARX A;  3G6M A;  3ARO A;  4MTV A;  4DWS D;  3O5D A;  3UI4 A;  1HKJ A;  2K8I A;  1X6N A;  3ARV A;  3ODK A;  1Q6U A;  1ZL1 A;  3BXW A;  3PR9 A;  3OA5 A;  4Z2H A;  2AWG A;  1E6R A;  1A7X A;  3ALF A;  1GUV A;  2VCD A;  5HKG A;  4Z2I A;  3ART A;  4MGV A;  3ARY A;  4ZPW R;  1W9V A;  2F23 A;  3CZ8 A;  3O5J A;  2DG9 A;  4MNL A;  2F21 A;  1FKH A;  4Q22 A;  2XP4 A;  3O5I A;  1NMW A;  1FKD A;  4KR0 B;  2LJ4 A;  3ARU A;  4WJX A;  3PA7 A;  2DSU A;  3ARZ A;  3O5R A;  3RGC A;  2DSZ A;  5JH8 A;  3B8S A;  1KT1 A;  5HT1 A;  2RUD A;  3FAP A;  1NWT A;  2LPV A;  3O5E A;  4XAK A;  4DWS C;  3CHD A;  3KAG A;  3O5P A;  1OGG A;  1E15 A;  4DRH A;  1LL4 A;  2B5U B;  2O92 A;  1R9H A;  1J4R A;  3ARP A;  1HJX A;  4ODK A;  1JNE A;  4G2P A;  4JFM A;  4C02 B;  1FKR A;  4J4N A;  4ODM A;  4LAY A;  4U85 A;  4HBO A;  2ZQV A;  2PI6 A;  4LGX A;  5J6E A;  3PRB A;  5D75 A;  1LQ0 A;  2PV2 A;  4TW6 A;  1C9H A;  1ZBK A;  1P5Q A;  3O5K A;  2RUC A;  3WD2 A;  2XPA A;  4NSB A;  2DG4 A;  4NNR A;  2M1I A;  3TCZ A;  5HW8 A;  1H0G A;  2ZQT A;  5B8I C;  3JXV A;  4TNS A;  1IX5 A;  2WLY A;  4LAX A;  4DT4 A;  1XRV A;  4ODQ A;  1ZK6 A;  2JZV A;  5HWC A;  3AS3 A;  2P4V A;  4MNK A;  2PBC A;  2ZR6 A;  3KAD A;  1LG1 A;  3EY6 A;  3KAC A;  3KAI A;  5HTG A;  3WD3 A;  2XP3 A;  1PIN A;  1HJW A;  1ZU8 A;  2RUQ A;  3EIP A;  2KGJ A;  3W4R A;  3O5Q A;  1OGB A;  3QOK A;  1W9P A;  4TX0 A;  1LJY A;  1EDQ A;  2ESC A;  1NWS A;  1E44 A;  3O5M A;  1K9T A;  3UI5 A;  4MPK A;  4Z2J A;  4QIB A;  2A3B A;  1FD9 A;  4L72 B;  3WKZ A;  3WD4 A;  2MF9 A;  4Q7N A;  5HBF A;  4UDM A;  2N87 A;  4WK9 A;  1Q6H A;  1QPF A;  2A3E A;  1F8A B;  4W5U A;  4DRJ A;  2PN0 A;  1EQ3 A;  1FFR A;  3WD1 A;  2M2A A;  4QZV B;  4N19 A;  1W26 A;  2B31 A;  4TW8 A;  1X6L A;  3UQI A;  2YBT A;  4DRP A;  3KAH A;  1EIB A;  4AY1 A;  4U86 A;  3O5O A;  2ETN A;  4ITZ A;  4L3N A;  4ODL A;  4IQ2 A;  4DWS A;  3OOB A;  1NMV A;  2DT2 A;  3CHE A;  3AS2 A;  4KQZ A;  1E6N A;  4MSP A;  3AS0 A;  1W1T A;  1E9L A;  4DWS B;  1D2K A;  2UZ5 A;  4MAV A;  1LL7 A;  1HJV A;  1OWQ A;  4W9P A;  2ZQS A;  4JYS A;  2A3C A;  3CGN A;  4IT4 A;  2YBU A;  4WKH A;  1VF8 A;  3TDB A;  3IKG A;  4MNJ A;  2DPE A;  3RFW A;  1NSG A;  3WQV A;  4ODR A;  3RM4 A;  4IQC A;  1M5Y A;  5HW6 A;  4JFK A;  1E6P A;  2D9F A;  2O9O A;  2KE0 A;  2KO7 A;  4ODP A;  1EHN A;  1ROT A;  1D7J A;  3ALG A;  1GRJ A;  2A3A A;  2M08 A;  4MNM A;  4DRO A;  3WQW A;  2WK2 A;  1SR0 A;  2MLX A;  4FN2 A;  1RD6 A;  4DRM A;  1D6O A;  1LL6 A;  3IK8 A;  2DT1 A;  1WAW A;  2PPN A;  1Q6I A;  2G41 A;  3NI6 A;  2F2D A;  1H0I A;  1FFQ A;  1FKJ A;  4QT3 A;  3GTY X;  3JYJ A;  3IHZ A;  4ZPT R;  3B9A A;  1Q1C A;  2DT0 A;  1B6C A;  2LKN A;  3IKD A;  4J4O A;  4DH0 A;  3JYM A;  1ITX A;  1JND A;  3AS1 A;  4ZS6 A;  2FKE A;  3CGM A;  4Z2G A;  4R5E A;  4DIP A;  3UQA A;  1D7H A;  2VN1 A;  4DZ3 A;  4JFI A;  1UR9 A;  1W1Y A;  1YAT A;  2L2S A;  1TFV A;  1HXV A;  1HKM A;  3GU0 A;  3PRD A;  4U84 A;  3TC5 A;  1FKB A;  3B9E A;  5I98 A;  2RSE A;  3O5G A;  2OFN A;  1HKI A;  2DG3 A;  5BXJ A;  3UI6 A;  2RUR A;  3GPK A;  2Y78 A;  2FAP A;  2PPP A;  1NWU A;  1F40 A;  5GPR A;  4NZC A;  2G8Z A;  3RM8 A;  3B7X A;  3MDY B;  4WKA A;  1ZBC A;  1KFW A;  2ITK A;  3I6C A;  5DIU A;  1JNS A;  4S3K A;  4DRK A;  3ARQ A;  2DSV A;  2KR7 A;  1ZB5 A;  4IPX A;  3KCE A;  1JNT A;  1T11 A;  1TCO C;  2XP6 A;  2Q5A A;  2XPB A;  2PV3 A;  4S3J A;  2IUZ A;  1ROU A;  1ZBV A;  4P8U A;  4DZ2 A;  1NH6 A;  3KZ7 A;  1QPL A;  5HUA A;  4BF8 A;  2MNT A;  3NTP A;  4GGQ A;  5DF0 A;  1XHG A;  5DO2 A;  2QF8 A;  4LAV A;  4FAP A;  2LGO A;  3CH9 A;  1JVW A;  4WIW A;  4JFL A;  4URI A;  4WKF A;  5DEZ A;  1WNO A;  1L1P A;  3NRK A;  5HWB A;  1CTN A;  1FKL A;  1YW5 A;  4ZPV R;  2DT3 A;  1Y0O A;  3WL0 A;  3O5L A;  3WD0 A;  4R0X A;  1FJD A;  3H9R B;  4PTM A;  1JCH B;  4GIV A;  2FDM A;  5GPG A;  3G6L A;  4QT2 A;  5HW7 A;  3B9D A;  1FKI A;  3KAB A;  5DIV A;  1FAP A;  3O5F A;  1PBK A;  4TW7 A;  2ZR4 A;  1KT0 A;  4Z2K A;  2ZQU A;  1D7I A;  1QZ2 A;  3WL1 A;  1N1A A;  2EUL A;  3AQU A;  1BKF A;  2PV1 A;  2ZR5 A;  5GQB A;  4ODO A;  1EYM A;  4O2T A;  2PPO A;  2RQS A;  3ARR A;  1W1V A;  3FXY A;  4ML4 A;  3RM9 A;  2F4E A;  1ZCN A;  4TYO A;  3UF8 A;  2WLZ A;  2XP8 A;  3CHC A;  1FKF A;  3KAF A;  4P8V A;  3BMB A;  5DIT A;  1WB0 A;  3PRA A;  2DSW A;  1E6Z A;  2XP9 A;  3RME A;  1SYT A;  1FKT A;  4LAW A;  2IF4 A;  4HAR A;  4W9Q A;  3FY1 A;  4P8W A;  1NWR A;  4IT6 A;  4G50 A;  4DRN A;  1W1P A;  1O6I A;  2WM0 A;  3WH0 A; 
#chains in the Genus database with same CATH homology
 2KI3 A;  4JFJ A;  1BL4 A;  4Z2L A;  2XP7 A;  1J4H A;  1UR8 A;  3CHF A;  2MLY A;  2OLH A;  3ARW A;  4ODN A;  4DRQ A;  1GPF A;  1J4I A;  3VAW A;  1J6Y A;  2KFW A;  3ARS A;  3WIJ A;  1LG2 A;  1FKK A;  1ZBW A;  1W9U A;  1HKK A;  4P8X A;  2MLZ A;  3UQB A;  2AOS A;  4W9O A;  2XP5 A;  1U79 A;  2MPH A;  3LUO A;  1FKG A;  4DRI A;  1FKS A;  4HBE A;  1GOI A;  3ARX A;  3G6M A;  3ARO A;  4MTV A;  4DWS D;  3O5D A;  3UI4 A;  1HKJ A;  2K8I A;  1X6N A;  3ARV A;  3ODK A;  1Q6U A;  1ZL1 A;  3BXW A;  3PR9 A;  3OA5 A;  4Z2H A;  2AWG A;  1E6R A;  1A7X A;  3ALF A;  1GUV A;  2VCD A;  5HKG A;  4Z2I A;  3ART A;  4MGV A;  3ARY A;  4ZPW R;  1W9V A;  3CZ8 A;  3O5J A;  2DG9 A;  4MNL A;  2F21 A;  1FKH A;  4Q22 A;  2XP4 A;  3O5I A;  1NMW A;  1FKD A;  4KR0 B;  2LJ4 A;  3ARU A;  4WJX A;  3PA7 A;  2DSU A;  3ARZ A;  3O5R A;  3RGC A;  2DSZ A;  5JH8 A;  3B8S A;  1KT1 A;  5HT1 A;  2RUD A;  3FAP A;  1NWT A;  2LPV A;  3O5E A;  4XAK A;  4DWS C;  3CHD A;  3KAG A;  3O5P A;  1OGG A;  1E15 A;  4DRH A;  1LL4 A;  2O92 A;  1R9H A;  1J4R A;  3ARP A;  1HJX A;  4ODK A;  1JNE A;  4G2P A;  4JFM A;  4C02 B;  1FKR A;  4J4N A;  4ODM A;  4LAY A;  4U85 A;  4HBO A;  2ZQV A;  2PI6 A;  4LGX A;  5J6E A;  3PRB A;  5D75 A;  1LQ0 A;  2PV2 A;  4TW6 A;  1C9H A;  1ZBK A;  1P5Q A;  3O5K A;  2RUC A;  3WD2 A;  2XPA A;  4NSB A;  2DG4 A;  4NNR A;  2M1I A;  3TCZ A;  5HW8 A;  1H0G A;  2ZQT A;  5B8I C;  3JXV A;  4TNS A;  1IX5 A;  2WLY A;  4LAX A;  4DT4 A;  1XRV A;  4ODQ A;  1ZK6 A;  2JZV A;  5HWC A;  3AS3 A;  4MNK A;  2PBC A;  2ZR6 A;  3KAD A;  1LG1 A;  3EY6 A;  3KAC A;  3KAI A;  5HTG A;  3WD3 A;  2XP3 A;  1PIN A;  1HJW A;  1ZU8 A;  2RUQ A;  2KGJ A;  3W4R A;  3O5Q A;  1OGB A;  3QOK A;  1W9P A;  4TX0 A;  1LJY A;  1EDQ A;  2ESC A;  1NWS A;  3O5M A;  1K9T A;  3UI5 A;  4MPK A;  4Z2J A;  4QIB A;  2A3B A;  1FD9 A;  4L72 B;  3WKZ A;  3WD4 A;  2MF9 A;  4Q7N A;  5HBF A;  2N87 A;  4WK9 A;  1Q6H A;  1QPF A;  2A3E A;  1F8A B;  4W5U A;  4DRJ A;  1EQ3 A;  1FFR A;  3WD1 A;  2M2A A;  4QZV B;  4N19 A;  1W26 A;  2B31 A;  4TW8 A;  1X6L A;  3UQI A;  2YBT A;  4DRP A;  3KAH A;  1EIB A;  4AY1 A;  4U86 A;  3O5O A;  4ITZ A;  4ODL A;  4L3N A;  4IQ2 A;  4DWS A;  3OOB A;  1NMV A;  2DT2 A;  3CHE A;  3AS2 A;  4KQZ A;  1E6N A;  4MSP A;  3AS0 A;  1W1T A;  1E9L A;  4DWS B;  1D2K A;  2UZ5 A;  4MAV A;  1LL7 A;  1HJV A;  1OWQ A;  4W9P A;  2ZQS A;  4JYS A;  2A3C A;  3CGN A;  4IT4 A;  2YBU A;  4WKH A;  1VF8 A;  3TDB A;  3IKG A;  4MNJ A;  2DPE A;  3RFW A;  1NSG A;  3WQV A;  4ODR A;  3RM4 A;  4IQC A;  1M5Y A;  5HW6 A;  4JFK A;  1E6P A;  2D9F A;  2O9O A;  2KE0 A;  2KO7 A;  4ODP A;  1EHN A;  1ROT A;  1D7J A;  3ALG A;  2A3A A;  2M08 A;  4MNM A;  4DRO A;  3WQW A;  2WK2 A;  1SR0 A;  2MLX A;  4FN2 A;  1RD6 A;  4DRM A;  1D6O A;  1LL6 A;  3IK8 A;  2DT1 A;  1WAW A;  2PPN A;  1Q6I A;  2G41 A;  3NI6 A;  2F2D A;  1H0I A;  1FFQ A;  1FKJ A;  4QT3 A;  3JYJ A;  3IHZ A;  4ZPT R;  3B9A A;  1Q1C A;  2DT0 A;  1B6C A;  2LKN A;  3IKD A;  4J4O A;  4DH0 A;  3JYM A;  1ITX A;  1JND A;  3AS1 A;  4ZS6 A;  2FKE A;  3CGM A;  4Z2G A;  4R5E A;  4DIP A;  3UQA A;  1D7H A;  2VN1 A;  4DZ3 A;  4JFI A;  1UR9 A;  1W1Y A;  1YAT A;  2L2S A;  1TFV A;  1HXV A;  1HKM A;  3PRD A;  4U84 A;  3TC5 A;  1FKB A;  3B9E A;  5I98 A;  2RSE A;  3O5G A;  2OFN A;  1HKI A;  2DG3 A;  5BXJ A;  3UI6 A;  2RUR A;  3GPK A;  2Y78 A;  2FAP A;  2PPP A;  1NWU A;  1F40 A;  5GPR A;  4NZC A;  2G8Z A;  3RM8 A;  3B7X A;  3MDY B;  4WKA A;  1ZBC A;  1KFW A;  2ITK A;  3I6C A;  5DIU A;  1JNS A;  4S3K A;  4DRK A;  3ARQ A;  2DSV A;  2KR7 A;  1ZB5 A;  4IPX A;  3KCE A;  1JNT A;  1T11 A;  1TCO C;  2XP6 A;  2Q5A A;  2XPB A;  2PV3 A;  4S3J A;  2IUZ A;  1ROU A;  1ZBV A;  4P8U A;  4DZ2 A;  1NH6 A;  3KZ7 A;  1QPL A;  5HUA A;  4BF8 A;  2MNT A;  3NTP A;  4GGQ A;  5DF0 A;  1XHG A;  5DO2 A;  2QF8 A;  4LAV A;  4FAP A;  2LGO A;  3CH9 A;  1JVW A;  4WIW A;  4JFL A;  4URI A;  4WKF A;  5DEZ A;  1WNO A;  1L1P A;  3NRK A;  5HWB A;  1CTN A;  1FKL A;  1YW5 A;  4ZPV R;  2DT3 A;  1Y0O A;  3WL0 A;  3O5L A;  3WD0 A;  4R0X A;  1FJD A;  3H9R B;  4PTM A;  4GIV A;  2FDM A;  5GPG A;  3G6L A;  4QT2 A;  5HW7 A;  3B9D A;  1FKI A;  3KAB A;  5DIV A;  1FAP A;  3O5F A;  1PBK A;  4TW7 A;  2ZR4 A;  1KT0 A;  4Z2K A;  2ZQU A;  1D7I A;  1QZ2 A;  3WL1 A;  1N1A A;  3AQU A;  1BKF A;  2PV1 A;  2ZR5 A;  5GQB A;  4ODO A;  1EYM A;  4O2T A;  2PPO A;  2RQS A;  3ARR A;  1W1V A;  3FXY A;  4ML4 A;  3RM9 A;  2F4E A;  1ZCN A;  4TYO A;  3UF8 A;  2WLZ A;  2XP8 A;  3CHC A;  1FKF A;  3KAF A;  4P8V A;  5DIT A;  1WB0 A;  3PRA A;  2DSW A;  1E6Z A;  2XP9 A;  3RME A;  1SYT A;  1FKT A;  4LAW A;  2IF4 A;  4HAR A;  4W9Q A;  3FY1 A;  4P8W A;  1NWR A;  4IT6 A;  4G50 A;  4DRN A;  1W1P A;  1O6I A;  2WM0 A;  3WH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...