3CGMA

Crystal structure of thermophilic slyd
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
157
structure length
157
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 35
structure length 157
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgmA00
3I6CA 4G50A 4JYSA 2RUQA 4C02B 5BXJA 1YATA 1ZCNA 4N19A 1Y0OA 5GPGA 3O5MA 4DRJA 2F21A 3LUOA 4ODPA 4DRQA 2Y78A 4DRNA 4QT3A 1D7JA 1Q6IA 4JFJA 3MDYB 2ZR5A 1FAPA 2VCDA 4TNSA 1J4HA 4DH0A 4J4NA 4DIPA 3KAFA 3PRDA 4ODOA 2L2SA 4DRMA 3O5EA 3UQAA 1JNSA 3UQIA 2XP6A 1FKBA 4DRPA 4ITZA 4FAPA 1YW5A 1P5QA 2ZQVA 3JYMA 2D9FA 3UF8A 2PPPA 3IK8A 1D7HA 1FKDA 1EYMA 3NTPA 3O5JA 1ZK6A 2ZQSA 1M5YA 2DG9A 2MLYA 2PBCA 2RSEA 2ZQTA 3CGNA 3IHZA 4LAWA 4DZ2A 2XP3A 1W26A 1FKJA 1BKFA 3JYJA 3O5RA 1D6OA 1T11A 1FKFA 3KZ7A 3O5GA 3PA7A 4IQ2A 4IPXA 1FKTA 2LKNA 2MLZA 3KABA 4QT2A 1KT1A 2MPHA 5D75A 5B8IC 3KACA 2OFNA 5HWBA 3O5LA 1FKIA 3UI5A 2KI3A 1JVWA 2XPAA 5HTGA 3IKGA 4J4OA 4TW6A 4DRHA 3TCZA 4JFMA 1F8AB 4IQCA 4TW7A 2ZQUA 3RFWA 1JNTA 1FKGA 4U85A 1NMWA 3VAWA 2F2DA 1F40A 3EY6A 2XP7A 1KT0A 2ZR4A 1Q6HA 3O5IA 4ODQA 2PPOA 4W9QA 1L1PA 2KGJA 2MNTA 4JFKA 3NRKA 2ZR6A 2ITKA 3KAHA 1Q1CA 1FKLA 3TC5A 4ODMA 3ODKA 2FAPA 4MSPA 4ODNA 3O5QA 1C9HA 4ODRA 2IF4A 2DG4A 4ODLA 4DROA 2M08A 2PV1A 5HW7A 2MLXA 2PV3A 1QPLA 1A7XA 2LGOA 3KCEA 2KE0A 1J4IA 1FD9A 3FAPA 4NNRA 2XP4A 1NMVA 3GPKA 5HKGA 4LAYA 1J6YA 2XP5A 4TX0A 4ODKA 4FN2A 4BF8A 1Q6UA 5I98A 2MF9A 2K8IA 2JZVA 4MGVA 4O2TA 5HW6A 1ROTA 3O5PA 1BL4A 1QPFA 2KR7A 4JFIA 1QZ2A 2PV2A 1FKRA 2N87A 3UQBA 1B6CA 2KFWA 1FKSA 1NSGA 2KO7A 2VN1A 4W9OA 5J6EA 1FJDA 3TDBA 1N1AA 4U86A 3H9RB 2Q5AA 3JXVA 4DT4A 3UI6A 2FKEA 2LJ4A 2M2AA 4DRIA 1FKHA 2RQSA 4DRKA 2DG3A 2F4EA 1TCOC 4QIBA 3KAGA 4U84A 4LAVA 2AWGA 4W9PA 3KADA 2PPNA 4TYOA 5DIUA 5HUAA 4DZ3A 1ROUA 1FKKA 5HW8A 3O5OA 3WH0A 2M1IA 4R0XA 1J4RA 3PRBA 4G2PA 4TW8A 3OOBA 3B7XA 5DITA 2XP9A 3NI6A 5HT1A 2XPBA 5HWCA 3CGMA 3O5KA 1EQ3A 1PINA 2RUDA 1U79A 3O5DA 1D7IA 4LAXA 2XP8A 4GIVA 5DIVA 2RUCA 1PBKA 3RGCA 3IKDA 2RURA 2UZ5A 3KAIA 3O5FA 4GGQA 2LPVA 3UI4A 1R9HA 4JFLA 1HXVA
chains in the Genus database with same CATH superfamily
2PI6A 4G50A 1JNDA 1ZCNA 4ODPA 3FXYA 2Y78A 5DEZA 4QT3A 1D7JA 4DROA 1CTNA 3MDYB 1FAPA 2VCDA 4TNSA 2DT3A 2L2SA 3UQAA 3UQIA 2XP6A 3CHEA 4MNLA 4ITZA 1YW5A 5DF0A 1VF8A 3UF8A 3WIJA 2PPPA 1FFQA 1E9LA 3NTPA 1UR9A 1KFWA 1M5YA 2DG9A 3IHZA 4WIWA 2WM0A 4LAWA 1FKJA 1BKFA 3JYJA 4DWSA 1LG2A 1D6OA 1T11A 4IPXA 4IQ2A 3RM8A 2MLZA 1HJXA 3KACA 5HWBA 1TFVA 1GOIA 4J4OA 4TW7A 4ZPVR 3RFWA 2ZQUA 2AOSA 1JNTA 1NMWA 3VAWA 2F2DA 2XP7A 4Z2IA 1E6ZA 2ZR6A 2ITKA 4DWSB 1Q1CA 3WD1A 4ODNA 4ODRA 2IF4A 1LQ0A 2PV1A 3CHDA 1A7XA 3ARWA 3KCEA 4Q22A 4ZS6A 2KE0A 4MAVA 4NNRA 2XP4A 1O6IA 3WD2A 5HKGA 4LAYA 2XP5A 4TX0A 2OLHA 4FN2A 2MF9A 4MGVA 4O2TA 1ROTA 4Z2JA 2ETNA 1EDQA 1FKRA 1QZ2A 3W4RA 1WAWA 3TDBA 1N1AA 2Q5AA 4DT4A 2M2AA 4DRIA 1FKHA 3EIPA 4DRKA 2DG3A 2F4EA 1UR8A 1EIBA 1ROUA 1FKKA 4ML4A 3O5OA 2DPEA 1SYTA 1J4RA 3B7XA 4P8XA 4MNJA 1ZL1A 4LAXA 3RGCA 4WKHA 4PTMA 1NWUA 3UI4A 3ALGA 3OA5A 4N19A 4XAKA 4DRJA 4DRQA 4ZPWR 2A3CA 4DIPA 1FFRA 4DRMA 3WD3A 5DO2A 4DRPA 4FAPA 1ZBKA 1P5QA 3JYMA 2B5UB 2F23A 1D2KA 2O9OA 1LJYA 2MLYA 2ZQTA 4Z2KA 3CGNA 1W26A 3KZ7A 1FKFA 1FKTA 2LKNA 5D75A 3KABA 1KT1A 2MPHA 3AS3A 1GUVA 3O5LA 1E6RA 1FKIA 3UI5A 3BXWA 2KI3A 1JVWA 2XPAA 2YBUA 3ARQA 3TCZA 4MPKA 4JFMA 5JH8A 3ARVA 4U85A 1FKGA 1GRJA 1KT0A 1Q6HA 2DSUA 4JFKA 1W9UA 1HJWA 2FAPA 4MSPA 3AS0A 3WKZA 1IX5A 2MLXA 4LGXA 4QZVB 2B31A 1J4IA 3GU0A 3FAPA 2G8ZA 1K9TA 4L72B 4S3KA 2A3EA 2JZVA 2K8IA 3ARXA 3CHFA 1H0IA 2KR7A 2PV2A 3ARYA 3ARPA 2N87A 2YBTA 1E44A 1B6CA 4HBEA 3UQBA 1OGGA 1W1PA 4R5EA 4P8UA 4U86A 4WKAA 2LJ4A 2FDMA 2RQSA 2WLZA 4W9PA 3B8SA 4LAVA 2AWGA 3G6MA 3ALFA 4DZ3A 3WH0A 1EHNA 4P8WA 5DITA 5HT1A 2RUDA 2DT2A 1U79A 1D7IA 2P4VA 2XP8A 3AROA 4GIVA 5DIVA 1PBKA 1ZBWA 3IKDA 2RURA 2UZ5A 3KAIA 3O5FA 4ODMA 1E6NA 3I6CA 1LL7A 4JYSA 4C02B 4Z2GA 5BXJA 1YATA 5GPGA 2F21A 3CZ8A 3LUOA 1W1TA 4JFJA 1J4HA 2DT1A 4DH0A 3O5EA 1JNSA 1W9PA 4NZCA 3RM4A 2ESCA 3WQWA 3ARSA 2ZQVA 2D9FA 1XRVA 4DWSC 3QOKA 3IK8A 1D7HA 1JNEA 2DT0A 2WLYA 1W1VA 1ZK6A 3ARZA 4DZ2A 3RM9A 3O5GA 1E15A 3PA7A 4QT2A 5B8IC 3B9EA 1NWTA 2DSVA 1NWRA 1ZBCA 5HTGA 3IKGA 4DRHA 4Z2HA 3WD0A 1F8AB 1WB0A 1F40A 4S3JA 4ODQA 4W9QA 1L1PA 2KGJA 2MNTA 1ITXA 1LG1A 3AS2A 3KAHA 1HJVA 2G41A 3O5QA 4HBOA 2DG4A 1X6LA 4P8VA 3FY1A 2PV3A 1OGBA 1FD9A 4IT6A 3GPKA 2DSZA 1LL6A 1J6YA 2QF8A 1OWQA 3WQVA 5I98A 1JCHB 5HW6A 3PR9A 3WL0A 4Q7NA 1XHGA 1NH6A 4Z2LA 2KFWA 2KO7A 4UDMA 2VN1A 1FJDA 3JXVA 4MNMA 1ZU8A 4MNKA 4U84A 1TCOC 4QIBA 4WK9A 4WJXA 5DIUA 5HUAA 3ARTA 5HW8A 4TW8A 3PRBA 1SR0A 2XP9A 3NI6A 2XPBA 3O5DA 4AY1A 1RD6A 4GGQA 3ARUA 1HKKA 4JFLA 1HXVA 2EULA 2RUQA 5GPRA 1Y0OA 1GPFA 3O5MA 1NWSA 4MTVA 4DRNA 3AQUA 1Q6IA 4URIA 2ZR5A 4J4NA 3KAFA 3PRDA 4ODOA 2WK2A 4WKFA 4NSBA 3GTYX 1FKBA 1WNOA 4L3NA 5HBFA 2DSWA 1FKDA 1EYMA 3O5JA 2ZQSA 2PBCA 2RSEA 4ZPTR 4KQZA 2XP3A 3CHCA 3O5RA 1HKIA 3WD4A 2OFNA 1W1YA 4TW6A 1X6NA 1HKMA 4IQCA 4HARA 3EY6A 2ZR4A 1H0GA 3BMBA 3O5IA 4KR0B 2PPOA 3NRKA 1FKLA 3TC5A 3ODKA 2PN0A 1C9HA 4ODLA 2A3AA 1W9VA 2M08A 5HW7A 3ARRA 1QPLA 2LGOA 3B9AA 1NMVA 3B9DA 4ODKA 4BF8A 1ZB5A 1Q6UA 1E6PA 1ZBVA 3O5PA 1BL4A 1QPFA 4JFIA 2O92A 3G6LA 3WL1A 1HKJA 1FKSA 3PRAA 1NSGA 4W9OA 5J6EA 3H9RB 3CH9A 3UI6A 2FKEA 1LL4A 4W5UA 2A3BA 3AS1A 3KAGA 3KADA 2PPNA 4TYOA 2M1IA 5GQBA 4R0XA 4G2PA 3OOBA 4DWSD 5HWCA 3CGMA 3O5KA 4IT4A 1PINA 1EQ3A 2IUZA 2RUCA 3RMEA 2LPVA 1R9HA
chains in the Genus database with same CATH topology
2PI6A 4G50A 1JNDA 1ZCNA 4ODPA 3FXYA 2Y78A 5DEZA 4QT3A 1D7JA 4DROA 1CTNA 3MDYB 1FAPA 2VCDA 4TNSA 2DT3A 2L2SA 3UQAA 3UQIA 2XP6A 3CHEA 4MNLA 4ITZA 1YW5A 5DF0A 1VF8A 3UF8A 3WIJA 2PPPA 1FFQA 1E9LA 3NTPA 1UR9A 1KFWA 1M5YA 2DG9A 3IHZA 4WIWA 2WM0A 4LAWA 1FKJA 1BKFA 3JYJA 4DWSA 1LG2A 1D6OA 1T11A 4IPXA 4IQ2A 3RM8A 2MLZA 1HJXA 3KACA 5HWBA 1TFVA 1GOIA 4J4OA 4TW7A 4ZPVR 3RFWA 2ZQUA 2AOSA 1JNTA 1NMWA 3VAWA 2F2DA 2XP7A 4Z2IA 1E6ZA 2ZR6A 2ITKA 4DWSB 1Q1CA 3WD1A 4ODNA 4ODRA 2IF4A 1LQ0A 2PV1A 3CHDA 1A7XA 3ARWA 3KCEA 4Q22A 4ZS6A 2KE0A 4MAVA 4NNRA 2XP4A 1O6IA 3WD2A 5HKGA 4LAYA 2XP5A 4TX0A 2OLHA 4FN2A 2MF9A 4MGVA 4O2TA 1ROTA 4Z2JA 1EDQA 1FKRA 1QZ2A 3W4RA 1WAWA 3TDBA 1N1AA 2Q5AA 4DT4A 2M2AA 4DRIA 1FKHA 4DRKA 2DG3A 2F4EA 1UR8A 1EIBA 1ROUA 1FKKA 4ML4A 3O5OA 2DPEA 1SYTA 1J4RA 3B7XA 4P8XA 4MNJA 1ZL1A 4LAXA 3RGCA 4WKHA 4PTMA 1NWUA 3UI4A 3ALGA 3OA5A 4N19A 4XAKA 4DRJA 4DRQA 4ZPWR 2A3CA 4DIPA 1FFRA 4DRMA 3WD3A 5DO2A 4DRPA 4FAPA 1ZBKA 1P5QA 3JYMA 1D2KA 2O9OA 1LJYA 2MLYA 2ZQTA 4Z2KA 3CGNA 1W26A 3KZ7A 1FKFA 1FKTA 2LKNA 5D75A 3KABA 1KT1A 2MPHA 3AS3A 1GUVA 3O5LA 1E6RA 1FKIA 3UI5A 3BXWA 2KI3A 1JVWA 2XPAA 2YBUA 3ARQA 3TCZA 4MPKA 4JFMA 5JH8A 3ARVA 4U85A 1FKGA 1KT0A 1Q6HA 2DSUA 4JFKA 1W9UA 1HJWA 2FAPA 4MSPA 3AS0A 3WKZA 1IX5A 2MLXA 4LGXA 4QZVB 2B31A 1J4IA 3FAPA 2G8ZA 1K9TA 4L72B 4S3KA 2A3EA 2JZVA 2K8IA 3ARXA 3CHFA 1H0IA 2KR7A 2PV2A 3ARYA 3ARPA 2N87A 2YBTA 4HBEA 1B6CA 3UQBA 1OGGA 1W1PA 4R5EA 4P8UA 4U86A 4WKAA 2LJ4A 2FDMA 2RQSA 2WLZA 4W9PA 3B8SA 4LAVA 2AWGA 3G6MA 3ALFA 4DZ3A 3WH0A 1EHNA 4P8WA 5DITA 5HT1A 2RUDA 2DT2A 1U79A 1D7IA 5DIVA 2XP8A 3AROA 4GIVA 1PBKA 1ZBWA 3IKDA 2RURA 2UZ5A 3KAIA 3O5FA 4ODMA 1E6NA 3I6CA 1LL7A 4JYSA 4C02B 4Z2GA 5BXJA 1YATA 5GPGA 2F21A 3CZ8A 3LUOA 1W1TA 4JFJA 1J4HA 2DT1A 4DH0A 3O5EA 1JNSA 1W9PA 4NZCA 3RM4A 2ESCA 3WQWA 3ARSA 2ZQVA 2D9FA 1XRVA 4DWSC 3QOKA 3IK8A 1D7HA 1JNEA 2DT0A 2WLYA 1W1VA 1ZK6A 3ARZA 4DZ2A 3RM9A 3O5GA 1E15A 3PA7A 4QT2A 5B8IC 3B9EA 1NWTA 2DSVA 1NWRA 1ZBCA 5HTGA 3IKGA 4DRHA 4Z2HA 3WD0A 1F8AB 1WB0A 1F40A 4S3JA 4ODQA 4W9QA 1L1PA 2KGJA 2MNTA 1ITXA 1LG1A 3AS2A 3KAHA 1HJVA 2G41A 3O5QA 4HBOA 2DG4A 1X6LA 4P8VA 3FY1A 2PV3A 1OGBA 1FD9A 4IT6A 3GPKA 2DSZA 1LL6A 1J6YA 2QF8A 1OWQA 3WQVA 5I98A 5HW6A 3PR9A 3WL0A 4Q7NA 1XHGA 1NH6A 4Z2LA 2KFWA 2KO7A 2VN1A 1FJDA 3JXVA 4MNMA 1ZU8A 4MNKA 4U84A 1TCOC 4QIBA 4WK9A 4WJXA 5DIUA 5HUAA 3ARTA 5HW8A 4TW8A 3PRBA 1SR0A 2XP9A 3NI6A 2XPBA 3O5DA 4AY1A 1RD6A 4GGQA 3ARUA 1HKKA 4JFLA 1HXVA 2RUQA 5GPRA 1Y0OA 1GPFA 3O5MA 1NWSA 4MTVA 4DRNA 3AQUA 1Q6IA 4URIA 2ZR5A 4J4NA 3KAFA 3PRDA 4ODOA 2WK2A 4WKFA 4NSBA 1FKBA 1WNOA 4L3NA 5HBFA 2DSWA 1FKDA 1EYMA 3O5JA 2ZQSA 2PBCA 2RSEA 4ZPTR 4KQZA 2XP3A 3CHCA 3O5RA 1HKIA 3WD4A 2OFNA 1W1YA 4TW6A 1X6NA 1HKMA 4IQCA 4HARA 3EY6A 2ZR4A 1H0GA 3O5IA 4KR0B 2PPOA 3NRKA 1FKLA 3TC5A 3ODKA 1C9HA 4ODLA 2A3AA 1W9VA 2M08A 5HW7A 3ARRA 1QPLA 2LGOA 3B9AA 1NMVA 3B9DA 4ODKA 4BF8A 1ZB5A 1Q6UA 1E6PA 1ZBVA 3O5PA 1BL4A 1QPFA 4JFIA 2O92A 3G6LA 3WL1A 1HKJA 1FKSA 3PRAA 1NSGA 4W9OA 5J6EA 3H9RB 3CH9A 3UI6A 2FKEA 1LL4A 4W5UA 2A3BA 3AS1A 3KAGA 3KADA 2PPNA 4TYOA 2M1IA 5GQBA 4R0XA 4G2PA 3OOBA 4DWSD 5HWCA 3CGMA 3O5KA 4IT4A 1PINA 1EQ3A 2IUZA 2RUCA 3RMEA 2LPVA 1R9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6C A;  4G50 A;  4JYS A;  2RUQ A;  4C02 B;  5BXJ A;  1YAT A;  1ZCN A;  4N19 A;  1Y0O A;  5GPG A;  3O5M A;  4DRJ A;  2F21 A;  3LUO A;  4ODP A;  4DRQ A;  2Y78 A;  4DRN A;  4QT3 A;  1D7J A;  1Q6I A;  4JFJ A;  3MDY B;  2ZR5 A;  1FAP A;  2VCD A;  4TNS A;  1J4H A;  4DH0 A;  4J4N A;  4DIP A;  3KAF A;  3PRD A;  4ODO A;  2L2S A;  4DRM A;  3O5E A;  3UQA A;  1JNS A;  3UQI A;  2XP6 A;  1FKB A;  4DRP A;  4ITZ A;  4FAP A;  1YW5 A;  1P5Q A;  2ZQV A;  3JYM A;  2D9F A;  3UF8 A;  2PPP A;  3IK8 A;  1D7H A;  1FKD A;  1EYM A;  3NTP A;  3O5J A;  1ZK6 A;  2ZQS A;  1M5Y A;  2DG9 A;  2MLY A;  2PBC A;  2RSE A;  2ZQT A;  3CGN A;  3IHZ A;  4LAW A;  4DZ2 A;  2XP3 A;  1W26 A;  1FKJ A;  1BKF A;  3JYJ A;  3O5R A;  1D6O A;  1T11 A;  1FKF A;  3KZ7 A;  3O5G A;  3PA7 A;  4IQ2 A;  4IPX A;  1FKT A;  2LKN A;  2MLZ A;  3KAB A;  4QT2 A;  1KT1 A;  2MPH A;  5D75 A;  5B8I C;  3KAC A;  2OFN A;  5HWB A;  3O5L A;  1FKI A;  3UI5 A;  2KI3 A;  1JVW A;  2XPA A;  5HTG A;  3IKG A;  4J4O A;  4TW6 A;  4DRH A;  3TCZ A;  4JFM A;  1F8A B;  4IQC A;  4TW7 A;  2ZQU A;  3RFW A;  1JNT A;  1FKG A;  4U85 A;  1NMW A;  3VAW A;  2F2D A;  1F40 A;  3EY6 A;  2XP7 A;  1KT0 A;  2ZR4 A;  1Q6H A;  3O5I A;  4ODQ A;  2PPO A;  4W9Q A;  1L1P A;  2KGJ A;  2MNT A;  4JFK A;  3NRK A;  2ZR6 A;  2ITK A;  3KAH A;  1Q1C A;  1FKL A;  3TC5 A;  4ODM A;  3ODK A;  2FAP A;  4MSP A;  4ODN A;  3O5Q A;  1C9H A;  4ODR A;  2IF4 A;  2DG4 A;  4ODL A;  4DRO A;  2M08 A;  2PV1 A;  5HW7 A;  2MLX A;  2PV3 A;  1QPL A;  1A7X A;  2LGO A;  3KCE A;  2KE0 A;  1J4I A;  1FD9 A;  3FAP A;  4NNR A;  2XP4 A;  1NMV A;  3GPK A;  5HKG A;  4LAY A;  1J6Y A;  2XP5 A;  4TX0 A;  4ODK A;  4FN2 A;  4BF8 A;  1Q6U A;  5I98 A;  2MF9 A;  2K8I A;  2JZV A;  4MGV A;  4O2T A;  5HW6 A;  1ROT A;  3O5P A;  1BL4 A;  1QPF A;  2KR7 A;  4JFI A;  1QZ2 A;  2PV2 A;  1FKR A;  2N87 A;  3UQB A;  1B6C A;  2KFW A;  1FKS A;  1NSG A;  2KO7 A;  2VN1 A;  4W9O A;  5J6E A;  1FJD A;  3TDB A;  1N1A A;  4U86 A;  3H9R B;  2Q5A A;  3JXV A;  4DT4 A;  3UI6 A;  2FKE A;  2LJ4 A;  2M2A A;  4DRI A;  1FKH A;  2RQS A;  4DRK A;  2DG3 A;  2F4E A;  1TCO C;  4QIB A;  3KAG A;  4U84 A;  4LAV A;  2AWG A;  4W9P A;  3KAD A;  2PPN A;  4TYO A;  5DIU A;  5HUA A;  4DZ3 A;  1ROU A;  1FKK A;  5HW8 A;  3O5O A;  3WH0 A;  2M1I A;  4R0X A;  1J4R A;  3PRB A;  4G2P A;  4TW8 A;  3OOB A;  3B7X A;  5DIT A;  2XP9 A;  3NI6 A;  5HT1 A;  2XPB A;  5HWC A;  3CGM A;  3O5K A;  1EQ3 A;  1PIN A;  2RUD A;  1U79 A;  3O5D A;  1D7I A;  4LAX A;  2XP8 A;  4GIV A;  5DIV A;  2RUC A;  1PBK A;  3RGC A;  3IKD A;  2RUR A;  2UZ5 A;  3KAI A;  3O5F A;  4GGQ A;  2LPV A;  3UI4 A;  1R9H A;  4JFL A;  1HXV A; 
#chains in the Genus database with same CATH topology
 2PI6 A;  4G50 A;  1JND A;  1ZCN A;  4ODP A;  3FXY A;  2Y78 A;  5DEZ A;  4QT3 A;  1D7J A;  4DRO A;  1CTN A;  3MDY B;  1FAP A;  2VCD A;  4TNS A;  2DT3 A;  2L2S A;  3UQA A;  3UQI A;  2XP6 A;  3CHE A;  4MNL A;  4ITZ A;  1YW5 A;  5DF0 A;  1VF8 A;  3UF8 A;  3WIJ A;  2PPP A;  1FFQ A;  1E9L A;  3NTP A;  1UR9 A;  1KFW A;  1M5Y A;  2DG9 A;  3IHZ A;  4WIW A;  2WM0 A;  4LAW A;  1FKJ A;  1BKF A;  3JYJ A;  4DWS A;  1LG2 A;  1D6O A;  1T11 A;  4IPX A;  4IQ2 A;  3RM8 A;  2MLZ A;  1HJX A;  3KAC A;  5HWB A;  1TFV A;  1GOI A;  4J4O A;  4TW7 A;  4ZPV R;  3RFW A;  2ZQU A;  2AOS A;  1JNT A;  1NMW A;  3VAW A;  2F2D A;  2XP7 A;  4Z2I A;  1E6Z A;  2ZR6 A;  2ITK A;  4DWS B;  1Q1C A;  3WD1 A;  4ODN A;  4ODR A;  2IF4 A;  1LQ0 A;  2PV1 A;  3CHD A;  1A7X A;  3ARW A;  3KCE A;  4Q22 A;  4ZS6 A;  2KE0 A;  4MAV A;  4NNR A;  2XP4 A;  1O6I A;  3WD2 A;  5HKG A;  4LAY A;  2XP5 A;  4TX0 A;  2OLH A;  4FN2 A;  2MF9 A;  4MGV A;  4O2T A;  1ROT A;  4Z2J A;  2ETN A;  1EDQ A;  1FKR A;  1QZ2 A;  3W4R A;  1WAW A;  3TDB A;  1N1A A;  2Q5A A;  4DT4 A;  2M2A A;  4DRI A;  1FKH A;  3EIP A;  4DRK A;  2DG3 A;  2F4E A;  1UR8 A;  1EIB A;  1ROU A;  1FKK A;  4ML4 A;  3O5O A;  2DPE A;  1SYT A;  1J4R A;  3B7X A;  4P8X A;  4MNJ A;  1ZL1 A;  4LAX A;  3RGC A;  4WKH A;  4PTM A;  1NWU A;  3UI4 A;  3ALG A;  3OA5 A;  4N19 A;  4XAK A;  4DRJ A;  4DRQ A;  4ZPW R;  2A3C A;  4DIP A;  1FFR A;  4DRM A;  3WD3 A;  5DO2 A;  4DRP A;  4FAP A;  1ZBK A;  1P5Q A;  3JYM A;  2B5U B;  2F23 A;  1D2K A;  2O9O A;  1LJY A;  2MLY A;  2ZQT A;  4Z2K A;  3CGN A;  1W26 A;  3KZ7 A;  1FKF A;  1FKT A;  2LKN A;  5D75 A;  3KAB A;  1KT1 A;  2MPH A;  3AS3 A;  1GUV A;  3O5L A;  1E6R A;  1FKI A;  3UI5 A;  3BXW A;  2KI3 A;  1JVW A;  2XPA A;  2YBU A;  3ARQ A;  3TCZ A;  4MPK A;  4JFM A;  5JH8 A;  3ARV A;  4U85 A;  1FKG A;  1GRJ A;  1KT0 A;  1Q6H A;  2DSU A;  4JFK A;  1W9U A;  1HJW A;  2FAP A;  4MSP A;  3AS0 A;  3WKZ A;  1IX5 A;  2MLX A;  4LGX A;  4QZV B;  2B31 A;  1J4I A;  3GU0 A;  3FAP A;  2G8Z A;  1K9T A;  4L72 B;  4S3K A;  2A3E A;  2JZV A;  2K8I A;  3ARX A;  3CHF A;  1H0I A;  2KR7 A;  2PV2 A;  3ARY A;  3ARP A;  2N87 A;  2YBT A;  1E44 A;  1B6C A;  4HBE A;  3UQB A;  1OGG A;  1W1P A;  4R5E A;  4P8U A;  4U86 A;  4WKA A;  2LJ4 A;  2FDM A;  2RQS A;  2WLZ A;  4W9P A;  3B8S A;  4LAV A;  2AWG A;  3G6M A;  3ALF A;  4DZ3 A;  3WH0 A;  1EHN A;  4P8W A;  5DIT A;  5HT1 A;  2RUD A;  2DT2 A;  1U79 A;  1D7I A;  2P4V A;  2XP8 A;  3ARO A;  4GIV A;  5DIV A;  1PBK A;  1ZBW A;  3IKD A;  2RUR A;  2UZ5 A;  3KAI A;  3O5F A;  4ODM A;  1E6N A;  3I6C A;  1LL7 A;  4JYS A;  4C02 B;  4Z2G A;  5BXJ A;  1YAT A;  5GPG A;  2F21 A;  3CZ8 A;  3LUO A;  1W1T A;  4JFJ A;  1J4H A;  2DT1 A;  4DH0 A;  3O5E A;  1JNS A;  1W9P A;  4NZC A;  3RM4 A;  2ESC A;  3WQW A;  3ARS A;  2ZQV A;  2D9F A;  1XRV A;  4DWS C;  3QOK A;  3IK8 A;  1D7H A;  1JNE A;  2DT0 A;  2WLY A;  1W1V A;  1ZK6 A;  3ARZ A;  4DZ2 A;  3RM9 A;  3O5G A;  1E15 A;  3PA7 A;  4QT2 A;  5B8I C;  3B9E A;  1NWT A;  2DSV A;  1NWR A;  1ZBC A;  5HTG A;  3IKG A;  4DRH A;  4Z2H A;  3WD0 A;  1F8A B;  1WB0 A;  1F40 A;  4S3J A;  4ODQ A;  4W9Q A;  1L1P A;  2KGJ A;  2MNT A;  1ITX A;  1LG1 A;  3AS2 A;  3KAH A;  1HJV A;  2G41 A;  3O5Q A;  4HBO A;  2DG4 A;  1X6L A;  4P8V A;  3FY1 A;  2PV3 A;  1OGB A;  1FD9 A;  4IT6 A;  3GPK A;  2DSZ A;  1LL6 A;  1J6Y A;  2QF8 A;  1OWQ A;  3WQV A;  5I98 A;  1JCH B;  5HW6 A;  3PR9 A;  3WL0 A;  4Q7N A;  1XHG A;  1NH6 A;  4Z2L A;  2KFW A;  2KO7 A;  4UDM A;  2VN1 A;  1FJD A;  3JXV A;  4MNM A;  1ZU8 A;  4MNK A;  4U84 A;  1TCO C;  4QIB A;  4WK9 A;  4WJX A;  5DIU A;  5HUA A;  3ART A;  5HW8 A;  4TW8 A;  3PRB A;  1SR0 A;  2XP9 A;  3NI6 A;  2XPB A;  3O5D A;  4AY1 A;  1RD6 A;  4GGQ A;  3ARU A;  1HKK A;  4JFL A;  1HXV A;  2EUL A;  2RUQ A;  5GPR A;  1Y0O A;  1GPF A;  3O5M A;  1NWS A;  4MTV A;  4DRN A;  3AQU A;  1Q6I A;  4URI A;  2ZR5 A;  4J4N A;  3KAF A;  3PRD A;  4ODO A;  2WK2 A;  4WKF A;  4NSB A;  3GTY X;  1FKB A;  1WNO A;  4L3N A;  5HBF A;  2DSW A;  1FKD A;  1EYM A;  3O5J A;  2ZQS A;  2PBC A;  2RSE A;  4ZPT R;  4KQZ A;  2XP3 A;  3CHC A;  3O5R A;  1HKI A;  3WD4 A;  2OFN A;  1W1Y A;  4TW6 A;  1X6N A;  1HKM A;  4IQC A;  4HAR A;  3EY6 A;  2ZR4 A;  1H0G A;  3BMB A;  3O5I A;  4KR0 B;  2PPO A;  3NRK A;  1FKL A;  3TC5 A;  3ODK A;  2PN0 A;  1C9H A;  4ODL A;  2A3A A;  1W9V A;  2M08 A;  5HW7 A;  3ARR A;  1QPL A;  2LGO A;  3B9A A;  1NMV A;  3B9D A;  4ODK A;  4BF8 A;  1ZB5 A;  1Q6U A;  1E6P A;  1ZBV A;  3O5P A;  1BL4 A;  1QPF A;  4JFI A;  2O92 A;  3G6L A;  3WL1 A;  1HKJ A;  1FKS A;  3PRA A;  1NSG A;  4W9O A;  5J6E A;  3H9R B;  3CH9 A;  3UI6 A;  2FKE A;  1LL4 A;  4W5U A;  2A3B A;  3AS1 A;  3KAG A;  3KAD A;  2PPN A;  4TYO A;  2M1I A;  5GQB A;  4R0X A;  4G2P A;  3OOB A;  4DWS D;  5HWC A;  3CGM A;  3O5K A;  4IT4 A;  1PIN A;  1EQ3 A;  2IUZ A;  2RUC A;  3RME A;  2LPV A;  1R9H A; 
#chains in the Genus database with same CATH homology
 2PI6 A;  4G50 A;  1JND A;  1ZCN A;  4ODP A;  3FXY A;  2Y78 A;  5DEZ A;  4QT3 A;  1D7J A;  4DRO A;  1CTN A;  3MDY B;  1FAP A;  2VCD A;  4TNS A;  2DT3 A;  2L2S A;  3UQA A;  3UQI A;  2XP6 A;  3CHE A;  4MNL A;  4ITZ A;  1YW5 A;  5DF0 A;  1VF8 A;  3UF8 A;  3WIJ A;  2PPP A;  1FFQ A;  1E9L A;  3NTP A;  1UR9 A;  1KFW A;  1M5Y A;  2DG9 A;  3IHZ A;  4WIW A;  2WM0 A;  4LAW A;  1FKJ A;  1BKF A;  3JYJ A;  4DWS A;  1LG2 A;  1D6O A;  1T11 A;  4IPX A;  4IQ2 A;  3RM8 A;  2MLZ A;  1HJX A;  3KAC A;  5HWB A;  1TFV A;  1GOI A;  4J4O A;  4TW7 A;  4ZPV R;  3RFW A;  2ZQU A;  2AOS A;  1JNT A;  1NMW A;  3VAW A;  2F2D A;  2XP7 A;  4Z2I A;  1E6Z A;  2ZR6 A;  2ITK A;  4DWS B;  1Q1C A;  3WD1 A;  4ODN A;  4ODR A;  2IF4 A;  1LQ0 A;  2PV1 A;  3CHD A;  1A7X A;  3ARW A;  3KCE A;  4Q22 A;  4ZS6 A;  2KE0 A;  4MAV A;  4NNR A;  2XP4 A;  1O6I A;  3WD2 A;  5HKG A;  4LAY A;  2XP5 A;  4TX0 A;  2OLH A;  4FN2 A;  2MF9 A;  4MGV A;  4O2T A;  1ROT A;  4Z2J A;  1EDQ A;  1FKR A;  1QZ2 A;  3W4R A;  1WAW A;  3TDB A;  1N1A A;  2Q5A A;  4DT4 A;  2M2A A;  4DRI A;  1FKH A;  4DRK A;  2DG3 A;  2F4E A;  1UR8 A;  1EIB A;  1ROU A;  1FKK A;  4ML4 A;  3O5O A;  2DPE A;  1SYT A;  1J4R A;  3B7X A;  4P8X A;  4MNJ A;  1ZL1 A;  4LAX A;  3RGC A;  4WKH A;  4PTM A;  1NWU A;  3UI4 A;  3ALG A;  3OA5 A;  4N19 A;  4XAK A;  4DRJ A;  4DRQ A;  4ZPW R;  2A3C A;  4DIP A;  1FFR A;  4DRM A;  3WD3 A;  5DO2 A;  4DRP A;  4FAP A;  1ZBK A;  1P5Q A;  3JYM A;  1D2K A;  2O9O A;  1LJY A;  2MLY A;  2ZQT A;  4Z2K A;  3CGN A;  1W26 A;  3KZ7 A;  1FKF A;  1FKT A;  2LKN A;  5D75 A;  3KAB A;  1KT1 A;  2MPH A;  3AS3 A;  1GUV A;  3O5L A;  1E6R A;  1FKI A;  3UI5 A;  3BXW A;  2KI3 A;  1JVW A;  2XPA A;  2YBU A;  3ARQ A;  3TCZ A;  4MPK A;  4JFM A;  5JH8 A;  3ARV A;  4U85 A;  1FKG A;  1KT0 A;  1Q6H A;  2DSU A;  4JFK A;  1W9U A;  1HJW A;  2FAP A;  4MSP A;  3AS0 A;  3WKZ A;  1IX5 A;  2MLX A;  4LGX A;  4QZV B;  2B31 A;  1J4I A;  3FAP A;  2G8Z A;  1K9T A;  4L72 B;  4S3K A;  2A3E A;  2JZV A;  2K8I A;  3ARX A;  3CHF A;  1H0I A;  2KR7 A;  2PV2 A;  3ARY A;  3ARP A;  2N87 A;  2YBT A;  4HBE A;  1B6C A;  3UQB A;  1OGG A;  1W1P A;  4R5E A;  4P8U A;  4U86 A;  4WKA A;  2LJ4 A;  2FDM A;  2RQS A;  2WLZ A;  4W9P A;  3B8S A;  4LAV A;  2AWG A;  3G6M A;  3ALF A;  4DZ3 A;  3WH0 A;  1EHN A;  4P8W A;  5DIT A;  5HT1 A;  2RUD A;  2DT2 A;  1U79 A;  1D7I A;  5DIV A;  2XP8 A;  3ARO A;  4GIV A;  1PBK A;  1ZBW A;  3IKD A;  2RUR A;  2UZ5 A;  3KAI A;  3O5F A;  4ODM A;  1E6N A;  3I6C A;  1LL7 A;  4JYS A;  4C02 B;  4Z2G A;  5BXJ A;  1YAT A;  5GPG A;  2F21 A;  3CZ8 A;  3LUO A;  1W1T A;  4JFJ A;  1J4H A;  2DT1 A;  4DH0 A;  3O5E A;  1JNS A;  1W9P A;  4NZC A;  3RM4 A;  2ESC A;  3WQW A;  3ARS A;  2ZQV A;  2D9F A;  1XRV A;  4DWS C;  3QOK A;  3IK8 A;  1D7H A;  1JNE A;  2DT0 A;  2WLY A;  1W1V A;  1ZK6 A;  3ARZ A;  4DZ2 A;  3RM9 A;  3O5G A;  1E15 A;  3PA7 A;  4QT2 A;  5B8I C;  3B9E A;  1NWT A;  2DSV A;  1NWR A;  1ZBC A;  5HTG A;  3IKG A;  4DRH A;  4Z2H A;  3WD0 A;  1F8A B;  1WB0 A;  1F40 A;  4S3J A;  4ODQ A;  4W9Q A;  1L1P A;  2KGJ A;  2MNT A;  1ITX A;  1LG1 A;  3AS2 A;  3KAH A;  1HJV A;  2G41 A;  3O5Q A;  4HBO A;  2DG4 A;  1X6L A;  4P8V A;  3FY1 A;  2PV3 A;  1OGB A;  1FD9 A;  4IT6 A;  3GPK A;  2DSZ A;  1LL6 A;  1J6Y A;  2QF8 A;  1OWQ A;  3WQV A;  5I98 A;  5HW6 A;  3PR9 A;  3WL0 A;  4Q7N A;  1XHG A;  1NH6 A;  4Z2L A;  2KFW A;  2KO7 A;  2VN1 A;  1FJD A;  3JXV A;  4MNM A;  1ZU8 A;  4MNK A;  4U84 A;  1TCO C;  4QIB A;  4WK9 A;  4WJX A;  5DIU A;  5HUA A;  3ART A;  5HW8 A;  4TW8 A;  3PRB A;  1SR0 A;  2XP9 A;  3NI6 A;  2XPB A;  3O5D A;  4AY1 A;  1RD6 A;  4GGQ A;  3ARU A;  1HKK A;  4JFL A;  1HXV A;  2RUQ A;  5GPR A;  1Y0O A;  1GPF A;  3O5M A;  1NWS A;  4MTV A;  4DRN A;  3AQU A;  1Q6I A;  4URI A;  2ZR5 A;  4J4N A;  3KAF A;  3PRD A;  4ODO A;  2WK2 A;  4WKF A;  4NSB A;  1FKB A;  1WNO A;  4L3N A;  5HBF A;  2DSW A;  1FKD A;  1EYM A;  3O5J A;  2ZQS A;  2PBC A;  2RSE A;  4ZPT R;  4KQZ A;  2XP3 A;  3CHC A;  3O5R A;  1HKI A;  3WD4 A;  2OFN A;  1W1Y A;  4TW6 A;  1X6N A;  1HKM A;  4IQC A;  4HAR A;  3EY6 A;  2ZR4 A;  1H0G A;  3O5I A;  4KR0 B;  2PPO A;  3NRK A;  1FKL A;  3TC5 A;  3ODK A;  1C9H A;  4ODL A;  2A3A A;  1W9V A;  2M08 A;  5HW7 A;  3ARR A;  1QPL A;  2LGO A;  3B9A A;  1NMV A;  3B9D A;  4ODK A;  4BF8 A;  1ZB5 A;  1Q6U A;  1E6P A;  1ZBV A;  3O5P A;  1BL4 A;  1QPF A;  4JFI A;  2O92 A;  3G6L A;  3WL1 A;  1HKJ A;  1FKS A;  3PRA A;  1NSG A;  4W9O A;  5J6E A;  3H9R B;  3CH9 A;  3UI6 A;  2FKE A;  1LL4 A;  4W5U A;  2A3B A;  3AS1 A;  3KAG A;  3KAD A;  2PPN A;  4TYO A;  2M1I A;  5GQB A;  4R0X A;  4G2P A;  3OOB A;  4DWS D;  5HWC A;  3CGM A;  3O5K A;  4IT4 A;  1PIN A;  1EQ3 A;  2IUZ A;  2RUC A;  3RME A;  2LPV A;  1R9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...