3CGMA

Crystal structure of thermophilic slyd
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
157
structure length
157
Chain Sequence
b'MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 35
structure length 157
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgmA00
1QPLA 1JNSA 5HW6A 3PRDA 4ODMA 4JFLA 3EY6A 4DRNA 4NNRA 1FD9A 1U79A 1B6CA 1FKHA 3NI6A 1FKBA 4MSPA 2MF9A 4DROA 5HW7A 2PPOA 2KO7A 5DIUA 1T11A 3OOBA 2KFWA 1QZ2A 3B7XA 4QIBA 3KCEA 2PV1A 2RQSA 4JFIA 3O5DA 1FKFA 2M08A 2PV3A 1ROTA 3WH0A 4C02B 2L2SA 5HWBA 4J4OA 2FAPA 3NTPA 4TNSA 4W9OA 3IK8A 2RSEA 3O5OA 4ODQA 2F2DA 2LJ4A 1FKLA 2UZ5A 2PPPA 2XP9A 3LUOA 5J6EA 4DRPA 5B8IC 4DRKA 1FKDA 2ZQUA 3O5LA 4ITZA 3JXVA 3ODKA 3JYJA 5HT1A 4DZ3A 2XPBA 3O5RA 1ZK6A 3JYMA 4LAWA 3UI5A 3UQIA 4JFMA 1FKIA 2PPNA 3O5EA 1EQ3A 1A7XA 3KACA 3O5QA 1L1PA 1Q6IA 3H9RB 3O5JA 1D7IA 3VAWA 4W9QA 3UQAA 1NMWA 1W26A 4J4NA 3TC5A 1YW5A 1ZCNA 2DG3A 1J4IA 2DG4A 2MPHA 2VN1A 2RURA 4ODNA 4TW6A 3CGMA 4R0XA 1D7HA 2AWGA 2RUQA 2XP3A 1R9HA 2N87A 3O5MA 4ODKA 3TDBA 4DH0A 5D75A 4DRHA 5HKGA 2XP8A 4LAYA 2D9FA 2ZR6A 4GGQA 1PINA 3KAIA 2LGOA 4JYSA 3O5FA 4QT3A 2KR7A 2F21A 3NRKA 4DRJA 2XPAA 2ITKA 1Y0OA 5I98A 2KE0A 3O5IA 4LAVA 1KT0A 2XP7A 4TYOA 1Q6UA 5HTGA 1P5QA 5HUAA 4IPXA 4IQ2A 3RGCA 4JFJA 4U84A 5DIVA 2K8IA 4U86A 2PV2A 1J4RA 4DRMA 4BF8A 2XP6A 3UQBA 3UI4A 1EYMA 1FKKA 1NSGA 4MGVA 4ODPA 3IKDA 1HXVA 1J4HA 1FKGA 2KGJA 4W9PA 1BKFA 4ODRA 2IF4A 2MLYA 2MNTA 1J6YA 3MDYB 5HW8A 5HWCA 1QPFA 4GIVA 3KABA 4QT2A 1C9HA 4DRIA 2MLZA 1FKTA 3FAPA 1NMVA 2ZQTA 1F40A 4FAPA 3PRBA 2ZQVA 4ODOA 4TW8A 3UI6A 2DG9A 2ZQSA 3KAFA 1KT1A 4DIPA 3O5KA 1JVWA 2Q5AA 3IKGA 1YATA 1FKRA 2ZR5A 1ROUA 2M1IA 2VCDA 4ODLA 5DITA 5BXJA 2JZVA 4DT4A 2RUDA 4FN2A 1M5YA 3UF8A 3KAHA 1PBKA 1BL4A 2M2AA 1D6OA 4O2TA 3I6CA 1TCOC 2MLXA 2F4EA 3IHZA 2LPVA 2XP5A 2XP4A 3PA7A 4LAXA 2LKNA 1F8AB 3GPKA 2ZR4A 4JFKA 2Y78A 1FJDA 1D7JA 3KZ7A 1Q6HA 1FKJA 4G2PA 1N1AA 2FKEA 4N19A 3KADA 4U85A 4DRQA 1JNTA 3RFWA 3TCZA 1Q1CA 3O5PA 1FKSA 2PBCA 2RUCA 4G50A 4TW7A 3KAGA 4TX0A 1FAPA 4DZ2A 3CGNA 3O5GA 2OFNA 4IQCA 2KI3A 5GPGA
chains in the Genus database with same CATH superfamily
1QPLA 4JFLA 4MNJA 1FD9A 1FKBA 1NH6A 2KFWA 1HJXA 1QZ2A 4NZCA 1EHNA 1FKFA 4C02B 4MNKA 2RSEA 3CHFA 4ODQA 1GUVA 2UZ5A 1NWRA 4HBOA 5J6EA 3ARPA 1E6ZA 3FXYA 4ML4A 5B8IC 1W1PA 2WM0A 1FKDA 4ITZA 3JYJA 1ZK6A 4LAWA 1UR9A 4JFMA 1FKIA 3O5EA 1A7XA 4Q7NA 3KACA 1L1PA 1Q6IA 3O5JA 1D7IA 3VAWA 4LGXA 4W9QA 3WQVA 3UQAA 3TC5A 5GQBA 1D2KA 4ODNA 1HJVA 2AWGA 3O5MA 1R9HA 2DSUA 5DEZA 2D9FA 4GGQA 3KAIA 1FFRA 1OGGA 2ITKA 4IT6A 2KE0A 3O5IA 2DT2A 4LAVA 4KR0B 5DO2A 4IPXA 3RGCA 1EDQA 1GPFA 2K8IA 3ARWA 3ARRA 1EYMA 1FKKA 1HXVA 2DSZA 5HWCA 3KABA 4DRIA 3FAPA 2ZQVA 4WKFA 1SYTA 1JVWA 3IKGA 1ROUA 2M1IA 2VCDA 5BXJA 4P8VA 2RUDA 4FN2A 1M5YA 4HARA 4MPKA 1PBKA 1LL4A 2DPEA 2LKNA 3AS2A 1FJDA 1D7JA 1ZL1A 3ARTA 3PRAA 1JNTA 3RFWA 3G6MA 3O5PA 2RUCA 4URIA 3KAGA 4Z2LA 3CGNA 1W1YA 2OFNA 3CH9A 1W9VA 5GPRA 1JNSA 4DRNA 3ARSA 4QZVB 1LG1A 1U79A 1B6CA 1FKHA 1ZBVA 4DROA 4Z2JA 1T11A 3OOBA 3KCEA 2PV1A 4JFIA 2YBUA 5HWBA 4J4OA 2FAPA 3NTPA 4TNSA 3CHCA 3IK8A 3O5OA 4MTVA 2ESCA 1H0GA 3LUOA 1XRVA 1FFQA 4DRPA 2G8ZA 3AS0A 3O5LA 4AY1A 3ODKA 5HT1A 3O5RA 3JYMA 3UI5A 3UQIA 1NWSA 2YBTA 3O5QA 4KQZA 4WKHA 1TFVA 1ZU8A 3RM9A 1W26A 2DG4A 4TW6A 2RURA 3CGMA 1D7HA 2RUQA 4JYSA 3O5FA 5DF0A 2KR7A 3CZ8A 2XPAA 1Y0OA 1KT0A 2WK2A 3GU0A 1Q6UA 3WIJA 1W1TA 4XAKA 5HUAA 1GRJA 4MNMA 4WIWA 2PV2A 3UQBA 3IKDA 2ETNA 1J4HA 1FKGA 2KGJA 4NSBA 1BKFA 4P8XA 2MNTA 3MDYB 5HW8A 4QT2A 1F40A 4FAPA 4ODOA 3UI6A 2ZQSA 1SR0A 3O5KA 2PI6A 1YATA 2DSVA 2ZR5A 4ODLA 5DITA 1FKRA 2JZVA 2A3EA 2M2AA 1E6PA 1E6NA 1TCOC 3GPKA 4L3NA 4ZS6A 1Q6HA 1GOIA 4TW7A 4TX0A 1JNDA 2AOSA 4DZ2A 3QOKA 4IT4A 2DSWA 1ZCNA 5GPGA 5HW6A 1HJWA 3PRDA 3WD4A 4NNRA 3G6LA 2IUZA 3WD2A 5HW7A 1X6NA 1WNOA 4DWSD 2KO7A 4S3KA 5DIUA 3WD3A 4P8WA 3BMBA 3ARYA 3O5DA 3WH0A 2EULA 1ZBKA 3AS1A 4S3JA 2F2DA 5HBFA 1IX5A 1WB0A 2ZQUA 3AS3A 3B9DA 2OLHA 2PPNA 3EIPA 4Z2HA 1EQ3A 1ZBWA 2B5UB 2WLYA 1E44A 2F23A 1NMWA 4J4NA 3RMEA 3AROA 4W5UA 4Q22A 2VN1A 1HKMA 2N87A 2A3CA 4ZPVR 2O92A 4QT3A 4DRJA 1P5QA 4U84A 1W9UA 3RM4A 4DWSA 4U86A 4DRMA 1J4RA 2XP6A 1NSGA 4MGVA 3AQUA 4W9PA 2IF4A 1ZB5A 3OA5A 2MLYA 4Z2GA 1ZBCA 1QPFA 4GIVA 2B31A 1FKTA 2ZQTA 1HKJA 1CTNA 4TW8A 1RD6A 3ARUA 1OGBA 1NWUA 1KT1A 3B9AA 2G41A 2DT1A 1KFWA 3KAHA 4O2TA 3I6CA 4LAXA 3IHZA 2F4EA 2XP4A 3ARZA 1E15A 1F8AB 2ZR4A 3KZ7A 1N1AA 4DRQA 4U85A 3KADA 3WL1A 3ARXA 1VF8A 1Q1CA 1FKSA 2PBCA 4G50A 3WQWA 3PR9A 4PTMA 4Z2KA 3O5GA 4IQCA 2KI3A 5HKGA 4WJXA 2QF8A 4ODMA 3EY6A 1EIBA 2DT0A 4WKAA 3NI6A 4MSPA 2MF9A 3BXWA 2PPOA 1LQ0A 1NWTA 1LL7A 3B7XA 4QIBA 4DWSB 2RQSA 4L72B 1LL6A 2M08A 2PV3A 1ROTA 2L2SA 4ZPTR 4W9OA 1HKIA 3WKZA 2LJ4A 1FKLA 3CHEA 2PN0A 2PPPA 4UDMA 2XP9A 4Z2IA 3B9EA 4DRKA 1WAWA 3JXVA 4DZ3A 2XPBA 1UR8A 2FDMA 1OWQA 1LG2A 3H9RB 1YW5A 2DG3A 1J4IA 3RM8A 3ALGA 2MPHA 1JNEA 1W9PA 4DT4A 4R0XA 4ODKA 2XP3A 3TDBA 4DH0A 4DRHA 5D75A 3WD0A 2XP8A 4LAYA 2ZR6A 1PINA 2LGOA 1H0IA 2DT3A 3ARVA 2F21A 1ITXA 3NRKA 5I98A 1O6IA 4TYOA 2XP7A 4HBEA 1X6LA 5HTGA 1HKKA 4IQ2A 4JFJA 5DIVA 2O9OA 4BF8A 1XHGA 3UI4A 4DWSC 4ODPA 4ODRA 4P8UA 1J6YA 4WK9A 3CHDA 1C9HA 2MLZA 4R5EA 2A3BA 3FY1A 1NMVA 3PRBA 2DG9A 3KAFA 4ZPWR 4DIPA 2Q5AA 1K9TA 5JH8A 3ALFA 2A3AA 3W4RA 2P4VA 3UF8A 1BL4A 1D6OA 2MLXA 2LPVA 2XP5A 3PA7A 3WD1A 1E9LA 4JFKA 2Y78A 3ARQA 4G2PA 1FKJA 2FKEA 4N19A 1JCHB 2WLZA 4MNLA 3WL0A 4MAVA 3TCZA 1W1VA 1E6RA 1FAPA 3GTYX 1LJYA 3B8SA
chains in the Genus database with same CATH topology
1QPLA 4JFLA 4MNJA 1FD9A 1FKBA 1NH6A 2KFWA 1HJXA 1QZ2A 4NZCA 1EHNA 1FKFA 4C02B 4MNKA 2RSEA 3CHFA 4ODQA 1GUVA 2UZ5A 1NWRA 4HBOA 5J6EA 3ARPA 1E6ZA 3FXYA 4ML4A 5B8IC 1W1PA 2WM0A 1FKDA 4ITZA 3JYJA 1ZK6A 4LAWA 1UR9A 4JFMA 1FKIA 3O5EA 1A7XA 4Q7NA 3KACA 1L1PA 1Q6IA 3O5JA 1D7IA 3VAWA 4LGXA 4W9QA 3WQVA 3UQAA 3TC5A 5GQBA 1D2KA 4ODNA 1HJVA 2AWGA 3O5MA 1R9HA 2DSUA 5DEZA 2D9FA 4GGQA 3KAIA 1FFRA 1OGGA 2ITKA 4IT6A 2KE0A 3O5IA 2DT2A 4LAVA 4KR0B 5DO2A 4IPXA 3RGCA 1EDQA 1GPFA 2K8IA 3ARWA 3ARRA 1EYMA 1FKKA 1HXVA 2DSZA 5HWCA 3KABA 4DRIA 3FAPA 2ZQVA 4WKFA 1SYTA 1JVWA 3IKGA 1ROUA 2M1IA 2VCDA 5BXJA 4P8VA 2RUDA 4FN2A 1M5YA 4HARA 4MPKA 1PBKA 1LL4A 2DPEA 2LKNA 3AS2A 1FJDA 1D7JA 1ZL1A 3ARTA 3PRAA 1JNTA 3RFWA 3G6MA 3O5PA 2RUCA 4URIA 3KAGA 4Z2LA 3CGNA 1W1YA 2OFNA 3CH9A 1W9VA 5GPRA 1JNSA 4DRNA 3ARSA 4QZVB 1LG1A 1U79A 1B6CA 1FKHA 1ZBVA 4DROA 4Z2JA 1T11A 3OOBA 3KCEA 2PV1A 4JFIA 2YBUA 5HWBA 4J4OA 2FAPA 3NTPA 4TNSA 3CHCA 3IK8A 3O5OA 4MTVA 2ESCA 1H0GA 3LUOA 1XRVA 1FFQA 4DRPA 2G8ZA 3AS0A 3O5LA 4AY1A 3ODKA 5HT1A 3O5RA 3JYMA 3UI5A 3UQIA 1NWSA 2YBTA 3O5QA 4KQZA 4WKHA 1TFVA 1ZU8A 3RM9A 1W26A 2DG4A 4TW6A 2RURA 3CGMA 1D7HA 2RUQA 4JYSA 3O5FA 5DF0A 2KR7A 3CZ8A 2XPAA 1Y0OA 1KT0A 2WK2A 1Q6UA 3WIJA 1W1TA 4XAKA 5HUAA 4MNMA 4WIWA 2PV2A 3UQBA 3IKDA 1J4HA 1FKGA 2KGJA 4NSBA 1BKFA 4P8XA 2MNTA 3MDYB 5HW8A 4QT2A 1F40A 4FAPA 4ODOA 3UI6A 2ZQSA 1SR0A 3O5KA 2PI6A 1YATA 2DSVA 2ZR5A 4ODLA 5DITA 1FKRA 2JZVA 2A3EA 2M2AA 1E6PA 1E6NA 1TCOC 3GPKA 4L3NA 4ZS6A 1Q6HA 1GOIA 4TW7A 4TX0A 1JNDA 2AOSA 4DZ2A 3QOKA 4IT4A 2DSWA 1ZCNA 5GPGA 5HW6A 1HJWA 3PRDA 3WD4A 4NNRA 3G6LA 2IUZA 3WD2A 5HW7A 1X6NA 1WNOA 4DWSD 2KO7A 4S3KA 5DIUA 3WD3A 4P8WA 3ARYA 3O5DA 3WH0A 1ZBKA 3AS1A 4S3JA 2F2DA 5HBFA 1IX5A 1WB0A 2ZQUA 3AS3A 3B9DA 2OLHA 2PPNA 4Z2HA 1EQ3A 1ZBWA 2WLYA 1NMWA 4J4NA 3RMEA 3AROA 4W5UA 4Q22A 2VN1A 1HKMA 2N87A 2A3CA 4ZPVR 2O92A 4QT3A 4DRJA 1P5QA 4U84A 1W9UA 3RM4A 4DWSA 4U86A 4DRMA 1J4RA 2XP6A 1NSGA 4MGVA 3AQUA 4W9PA 2IF4A 1ZB5A 3OA5A 2MLYA 4Z2GA 1ZBCA 1QPFA 4GIVA 2B31A 1FKTA 2ZQTA 1HKJA 1CTNA 4TW8A 1RD6A 3ARUA 1OGBA 1NWUA 1KT1A 3B9AA 2G41A 2DT1A 1KFWA 3KAHA 4O2TA 3I6CA 4LAXA 3IHZA 2F4EA 2XP4A 3ARZA 1E15A 1F8AB 2ZR4A 3KZ7A 1N1AA 4DRQA 4U85A 3KADA 3WL1A 3ARXA 1VF8A 1Q1CA 1FKSA 2PBCA 4G50A 3WQWA 3PR9A 4PTMA 4Z2KA 3O5GA 4IQCA 2KI3A 5HKGA 4WJXA 2QF8A 4ODMA 3EY6A 1EIBA 2DT0A 4WKAA 3NI6A 4MSPA 2MF9A 3BXWA 2PPOA 1LQ0A 1NWTA 1LL7A 3B7XA 4QIBA 4DWSB 2RQSA 4L72B 1LL6A 2M08A 2PV3A 1ROTA 2L2SA 4ZPTR 4W9OA 1HKIA 3WKZA 2LJ4A 1FKLA 3CHEA 2PPPA 2XP9A 4Z2IA 3B9EA 4DRKA 1WAWA 3JXVA 4DZ3A 2XPBA 1UR8A 2FDMA 1OWQA 1LG2A 3H9RB 1YW5A 2DG3A 1J4IA 3RM8A 3ALGA 2MPHA 1JNEA 1W9PA 4DT4A 4R0XA 4ODKA 2XP3A 3TDBA 4DH0A 4DRHA 5D75A 3WD0A 2XP8A 4LAYA 2ZR6A 1PINA 2LGOA 1H0IA 2DT3A 3ARVA 2F21A 1ITXA 3NRKA 5I98A 1O6IA 4TYOA 2XP7A 4HBEA 1X6LA 5HTGA 1HKKA 4IQ2A 4JFJA 5DIVA 2O9OA 4BF8A 1XHGA 3UI4A 4DWSC 4ODPA 4ODRA 4P8UA 1J6YA 4WK9A 3CHDA 1C9HA 2MLZA 4R5EA 2A3BA 3FY1A 1NMVA 3PRBA 2DG9A 3KAFA 4ZPWR 4DIPA 2Q5AA 1K9TA 5JH8A 3ALFA 2A3AA 3W4RA 3UF8A 1BL4A 1D6OA 2MLXA 2LPVA 2XP5A 3PA7A 3WD1A 1E9LA 4JFKA 2Y78A 3ARQA 4G2PA 1FKJA 2FKEA 4N19A 2WLZA 4MNLA 3WL0A 4MAVA 3TCZA 1W1VA 1E6RA 1FAPA 1LJYA 3B8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPL A;  1JNS A;  5HW6 A;  3PRD A;  4ODM A;  4JFL A;  3EY6 A;  4DRN A;  4NNR A;  1FD9 A;  1U79 A;  1B6C A;  1FKH A;  3NI6 A;  1FKB A;  4MSP A;  2MF9 A;  4DRO A;  5HW7 A;  2PPO A;  2KO7 A;  5DIU A;  1T11 A;  3OOB A;  2KFW A;  1QZ2 A;  3B7X A;  4QIB A;  3KCE A;  2PV1 A;  2RQS A;  4JFI A;  3O5D A;  1FKF A;  2M08 A;  2PV3 A;  1ROT A;  3WH0 A;  4C02 B;  2L2S A;  5HWB A;  4J4O A;  2FAP A;  3NTP A;  4TNS A;  4W9O A;  3IK8 A;  2RSE A;  3O5O A;  4ODQ A;  2F2D A;  2LJ4 A;  1FKL A;  2UZ5 A;  2PPP A;  2XP9 A;  3LUO A;  5J6E A;  4DRP A;  5B8I C;  4DRK A;  1FKD A;  2ZQU A;  3O5L A;  4ITZ A;  3JXV A;  3ODK A;  3JYJ A;  5HT1 A;  4DZ3 A;  2XPB A;  3O5R A;  1ZK6 A;  3JYM A;  4LAW A;  3UI5 A;  3UQI A;  4JFM A;  1FKI A;  2PPN A;  3O5E A;  1EQ3 A;  1A7X A;  3KAC A;  3O5Q A;  1L1P A;  1Q6I A;  3H9R B;  3O5J A;  1D7I A;  3VAW A;  4W9Q A;  3UQA A;  1NMW A;  1W26 A;  4J4N A;  3TC5 A;  1YW5 A;  1ZCN A;  2DG3 A;  1J4I A;  2DG4 A;  2MPH A;  2VN1 A;  2RUR A;  4ODN A;  4TW6 A;  3CGM A;  4R0X A;  1D7H A;  2AWG A;  2RUQ A;  2XP3 A;  1R9H A;  2N87 A;  3O5M A;  4ODK A;  3TDB A;  4DH0 A;  5D75 A;  4DRH A;  5HKG A;  2XP8 A;  4LAY A;  2D9F A;  2ZR6 A;  4GGQ A;  1PIN A;  3KAI A;  2LGO A;  4JYS A;  3O5F A;  4QT3 A;  2KR7 A;  2F21 A;  3NRK A;  4DRJ A;  2XPA A;  2ITK A;  1Y0O A;  5I98 A;  2KE0 A;  3O5I A;  4LAV A;  1KT0 A;  2XP7 A;  4TYO A;  1Q6U A;  5HTG A;  1P5Q A;  5HUA A;  4IPX A;  4IQ2 A;  3RGC A;  4JFJ A;  4U84 A;  5DIV A;  2K8I A;  4U86 A;  2PV2 A;  1J4R A;  4DRM A;  4BF8 A;  2XP6 A;  3UQB A;  3UI4 A;  1EYM A;  1FKK A;  1NSG A;  4MGV A;  4ODP A;  3IKD A;  1HXV A;  1J4H A;  1FKG A;  2KGJ A;  4W9P A;  1BKF A;  4ODR A;  2IF4 A;  2MLY A;  2MNT A;  1J6Y A;  3MDY B;  5HW8 A;  5HWC A;  1QPF A;  4GIV A;  3KAB A;  4QT2 A;  1C9H A;  4DRI A;  2MLZ A;  1FKT A;  3FAP A;  1NMV A;  2ZQT A;  1F40 A;  4FAP A;  3PRB A;  2ZQV A;  4ODO A;  4TW8 A;  3UI6 A;  2DG9 A;  2ZQS A;  3KAF A;  1KT1 A;  4DIP A;  3O5K A;  1JVW A;  2Q5A A;  3IKG A;  1YAT A;  1FKR A;  2ZR5 A;  1ROU A;  2M1I A;  2VCD A;  4ODL A;  5DIT A;  5BXJ A;  2JZV A;  4DT4 A;  2RUD A;  4FN2 A;  1M5Y A;  3UF8 A;  3KAH A;  1PBK A;  1BL4 A;  2M2A A;  1D6O A;  4O2T A;  3I6C A;  1TCO C;  2MLX A;  2F4E A;  3IHZ A;  2LPV A;  2XP5 A;  2XP4 A;  3PA7 A;  4LAX A;  2LKN A;  1F8A B;  3GPK A;  2ZR4 A;  4JFK A;  2Y78 A;  1FJD A;  1D7J A;  3KZ7 A;  1Q6H A;  1FKJ A;  4G2P A;  1N1A A;  2FKE A;  4N19 A;  3KAD A;  4U85 A;  4DRQ A;  1JNT A;  3RFW A;  3TCZ A;  1Q1C A;  3O5P A;  1FKS A;  2PBC A;  2RUC A;  4G50 A;  4TW7 A;  3KAG A;  4TX0 A;  1FAP A;  4DZ2 A;  3CGN A;  3O5G A;  2OFN A;  4IQC A;  2KI3 A;  5GPG A; 
#chains in the Genus database with same CATH topology
 1QPL A;  4JFL A;  4MNJ A;  1FD9 A;  1FKB A;  1NH6 A;  2KFW A;  1HJX A;  1QZ2 A;  4NZC A;  1EHN A;  1FKF A;  4C02 B;  4MNK A;  2RSE A;  3CHF A;  4ODQ A;  1GUV A;  2UZ5 A;  1NWR A;  4HBO A;  5J6E A;  3ARP A;  1E6Z A;  3FXY A;  4ML4 A;  5B8I C;  1W1P A;  2WM0 A;  1FKD A;  4ITZ A;  3JYJ A;  1ZK6 A;  4LAW A;  1UR9 A;  4JFM A;  1FKI A;  3O5E A;  1A7X A;  4Q7N A;  3KAC A;  1L1P A;  1Q6I A;  3O5J A;  1D7I A;  3VAW A;  4LGX A;  4W9Q A;  3WQV A;  3UQA A;  3TC5 A;  5GQB A;  1D2K A;  4ODN A;  1HJV A;  2AWG A;  3O5M A;  1R9H A;  2DSU A;  5DEZ A;  2D9F A;  4GGQ A;  3KAI A;  1FFR A;  1OGG A;  2ITK A;  4IT6 A;  2KE0 A;  3O5I A;  2DT2 A;  4LAV A;  4KR0 B;  5DO2 A;  4IPX A;  3RGC A;  1EDQ A;  1GPF A;  2K8I A;  3ARW A;  3ARR A;  1EYM A;  1FKK A;  1HXV A;  2DSZ A;  5HWC A;  3KAB A;  4DRI A;  3FAP A;  2ZQV A;  4WKF A;  1SYT A;  1JVW A;  3IKG A;  1ROU A;  2M1I A;  2VCD A;  5BXJ A;  4P8V A;  2RUD A;  4FN2 A;  1M5Y A;  4HAR A;  4MPK A;  1PBK A;  1LL4 A;  2DPE A;  2LKN A;  3AS2 A;  1FJD A;  1D7J A;  1ZL1 A;  3ART A;  3PRA A;  1JNT A;  3RFW A;  3G6M A;  3O5P A;  2RUC A;  4URI A;  3KAG A;  4Z2L A;  3CGN A;  1W1Y A;  2OFN A;  3CH9 A;  1W9V A;  5GPR A;  1JNS A;  4DRN A;  3ARS A;  4QZV B;  1LG1 A;  1U79 A;  1B6C A;  1FKH A;  1ZBV A;  4DRO A;  4Z2J A;  1T11 A;  3OOB A;  3KCE A;  2PV1 A;  4JFI A;  2YBU A;  5HWB A;  4J4O A;  2FAP A;  3NTP A;  4TNS A;  3CHC A;  3IK8 A;  3O5O A;  4MTV A;  2ESC A;  1H0G A;  3LUO A;  1XRV A;  1FFQ A;  4DRP A;  2G8Z A;  3AS0 A;  3O5L A;  4AY1 A;  3ODK A;  5HT1 A;  3O5R A;  3JYM A;  3UI5 A;  3UQI A;  1NWS A;  2YBT A;  3O5Q A;  4KQZ A;  4WKH A;  1TFV A;  1ZU8 A;  3RM9 A;  1W26 A;  2DG4 A;  4TW6 A;  2RUR A;  3CGM A;  1D7H A;  2RUQ A;  4JYS A;  3O5F A;  5DF0 A;  2KR7 A;  3CZ8 A;  2XPA A;  1Y0O A;  1KT0 A;  2WK2 A;  3GU0 A;  1Q6U A;  3WIJ A;  1W1T A;  4XAK A;  5HUA A;  1GRJ A;  4MNM A;  4WIW A;  2PV2 A;  3UQB A;  3IKD A;  2ETN A;  1J4H A;  1FKG A;  2KGJ A;  4NSB A;  1BKF A;  4P8X A;  2MNT A;  3MDY B;  5HW8 A;  4QT2 A;  1F40 A;  4FAP A;  4ODO A;  3UI6 A;  2ZQS A;  1SR0 A;  3O5K A;  2PI6 A;  1YAT A;  2DSV A;  2ZR5 A;  4ODL A;  5DIT A;  1FKR A;  2JZV A;  2A3E A;  2M2A A;  1E6P A;  1E6N A;  1TCO C;  3GPK A;  4L3N A;  4ZS6 A;  1Q6H A;  1GOI A;  4TW7 A;  4TX0 A;  1JND A;  2AOS A;  4DZ2 A;  3QOK A;  4IT4 A;  2DSW A;  1ZCN A;  5GPG A;  5HW6 A;  1HJW A;  3PRD A;  3WD4 A;  4NNR A;  3G6L A;  2IUZ A;  3WD2 A;  5HW7 A;  1X6N A;  1WNO A;  4DWS D;  2KO7 A;  4S3K A;  5DIU A;  3WD3 A;  4P8W A;  3BMB A;  3ARY A;  3O5D A;  3WH0 A;  2EUL A;  1ZBK A;  3AS1 A;  4S3J A;  2F2D A;  5HBF A;  1IX5 A;  1WB0 A;  2ZQU A;  3AS3 A;  3B9D A;  2OLH A;  2PPN A;  3EIP A;  4Z2H A;  1EQ3 A;  1ZBW A;  2B5U B;  2WLY A;  1E44 A;  2F23 A;  1NMW A;  4J4N A;  3RME A;  3ARO A;  4W5U A;  4Q22 A;  2VN1 A;  1HKM A;  2N87 A;  2A3C A;  4ZPV R;  2O92 A;  4QT3 A;  4DRJ A;  1P5Q A;  4U84 A;  1W9U A;  3RM4 A;  4DWS A;  4U86 A;  4DRM A;  1J4R A;  2XP6 A;  1NSG A;  4MGV A;  3AQU A;  4W9P A;  2IF4 A;  1ZB5 A;  3OA5 A;  2MLY A;  4Z2G A;  1ZBC A;  1QPF A;  4GIV A;  2B31 A;  1FKT A;  2ZQT A;  1HKJ A;  1CTN A;  4TW8 A;  1RD6 A;  3ARU A;  1OGB A;  1NWU A;  1KT1 A;  3B9A A;  2G41 A;  2DT1 A;  1KFW A;  3KAH A;  4O2T A;  3I6C A;  4LAX A;  3IHZ A;  2F4E A;  2XP4 A;  3ARZ A;  1E15 A;  1F8A B;  2ZR4 A;  3KZ7 A;  1N1A A;  4DRQ A;  4U85 A;  3KAD A;  3WL1 A;  3ARX A;  1VF8 A;  1Q1C A;  1FKS A;  2PBC A;  4G50 A;  3WQW A;  3PR9 A;  4PTM A;  4Z2K A;  3O5G A;  4IQC A;  2KI3 A;  5HKG A;  4WJX A;  2QF8 A;  4ODM A;  3EY6 A;  1EIB A;  2DT0 A;  4WKA A;  3NI6 A;  4MSP A;  2MF9 A;  3BXW A;  2PPO A;  1LQ0 A;  1NWT A;  1LL7 A;  3B7X A;  4QIB A;  4DWS B;  2RQS A;  4L72 B;  1LL6 A;  2M08 A;  2PV3 A;  1ROT A;  2L2S A;  4ZPT R;  4W9O A;  1HKI A;  3WKZ A;  2LJ4 A;  1FKL A;  3CHE A;  2PN0 A;  2PPP A;  4UDM A;  2XP9 A;  4Z2I A;  3B9E A;  4DRK A;  1WAW A;  3JXV A;  4DZ3 A;  2XPB A;  1UR8 A;  2FDM A;  1OWQ A;  1LG2 A;  3H9R B;  1YW5 A;  2DG3 A;  1J4I A;  3RM8 A;  3ALG A;  2MPH A;  1JNE A;  1W9P A;  4DT4 A;  4R0X A;  4ODK A;  2XP3 A;  3TDB A;  4DH0 A;  4DRH A;  5D75 A;  3WD0 A;  2XP8 A;  4LAY A;  2ZR6 A;  1PIN A;  2LGO A;  1H0I A;  2DT3 A;  3ARV A;  2F21 A;  1ITX A;  3NRK A;  5I98 A;  1O6I A;  4TYO A;  2XP7 A;  4HBE A;  1X6L A;  5HTG A;  1HKK A;  4IQ2 A;  4JFJ A;  5DIV A;  2O9O A;  4BF8 A;  1XHG A;  3UI4 A;  4DWS C;  4ODP A;  4ODR A;  4P8U A;  1J6Y A;  4WK9 A;  3CHD A;  1C9H A;  2MLZ A;  4R5E A;  2A3B A;  3FY1 A;  1NMV A;  3PRB A;  2DG9 A;  3KAF A;  4ZPW R;  4DIP A;  2Q5A A;  1K9T A;  5JH8 A;  3ALF A;  2A3A A;  3W4R A;  2P4V A;  3UF8 A;  1BL4 A;  1D6O A;  2MLX A;  2LPV A;  2XP5 A;  3PA7 A;  3WD1 A;  1E9L A;  4JFK A;  2Y78 A;  3ARQ A;  4G2P A;  1FKJ A;  2FKE A;  4N19 A;  1JCH B;  2WLZ A;  4MNL A;  3WL0 A;  4MAV A;  3TCZ A;  1W1V A;  1E6R A;  1FAP A;  3GTY X;  1LJY A;  3B8S A; 
#chains in the Genus database with same CATH homology
 1QPL A;  4JFL A;  4MNJ A;  1FD9 A;  1FKB A;  1NH6 A;  2KFW A;  1HJX A;  1QZ2 A;  4NZC A;  1EHN A;  1FKF A;  4C02 B;  4MNK A;  2RSE A;  3CHF A;  4ODQ A;  1GUV A;  2UZ5 A;  1NWR A;  4HBO A;  5J6E A;  3ARP A;  1E6Z A;  3FXY A;  4ML4 A;  5B8I C;  1W1P A;  2WM0 A;  1FKD A;  4ITZ A;  3JYJ A;  1ZK6 A;  4LAW A;  1UR9 A;  4JFM A;  1FKI A;  3O5E A;  1A7X A;  4Q7N A;  3KAC A;  1L1P A;  1Q6I A;  3O5J A;  1D7I A;  3VAW A;  4LGX A;  4W9Q A;  3WQV A;  3UQA A;  3TC5 A;  5GQB A;  1D2K A;  4ODN A;  1HJV A;  2AWG A;  3O5M A;  1R9H A;  2DSU A;  5DEZ A;  2D9F A;  4GGQ A;  3KAI A;  1FFR A;  1OGG A;  2ITK A;  4IT6 A;  2KE0 A;  3O5I A;  2DT2 A;  4LAV A;  4KR0 B;  5DO2 A;  4IPX A;  3RGC A;  1EDQ A;  1GPF A;  2K8I A;  3ARW A;  3ARR A;  1EYM A;  1FKK A;  1HXV A;  2DSZ A;  5HWC A;  3KAB A;  4DRI A;  3FAP A;  2ZQV A;  4WKF A;  1SYT A;  1JVW A;  3IKG A;  1ROU A;  2M1I A;  2VCD A;  5BXJ A;  4P8V A;  2RUD A;  4FN2 A;  1M5Y A;  4HAR A;  4MPK A;  1PBK A;  1LL4 A;  2DPE A;  2LKN A;  3AS2 A;  1FJD A;  1D7J A;  1ZL1 A;  3ART A;  3PRA A;  1JNT A;  3RFW A;  3G6M A;  3O5P A;  2RUC A;  4URI A;  3KAG A;  4Z2L A;  3CGN A;  1W1Y A;  2OFN A;  3CH9 A;  1W9V A;  5GPR A;  1JNS A;  4DRN A;  3ARS A;  4QZV B;  1LG1 A;  1U79 A;  1B6C A;  1FKH A;  1ZBV A;  4DRO A;  4Z2J A;  1T11 A;  3OOB A;  3KCE A;  2PV1 A;  4JFI A;  2YBU A;  5HWB A;  4J4O A;  2FAP A;  3NTP A;  4TNS A;  3CHC A;  3IK8 A;  3O5O A;  4MTV A;  2ESC A;  1H0G A;  3LUO A;  1XRV A;  1FFQ A;  4DRP A;  2G8Z A;  3AS0 A;  3O5L A;  4AY1 A;  3ODK A;  5HT1 A;  3O5R A;  3JYM A;  3UI5 A;  3UQI A;  1NWS A;  2YBT A;  3O5Q A;  4KQZ A;  4WKH A;  1TFV A;  1ZU8 A;  3RM9 A;  1W26 A;  2DG4 A;  4TW6 A;  2RUR A;  3CGM A;  1D7H A;  2RUQ A;  4JYS A;  3O5F A;  5DF0 A;  2KR7 A;  3CZ8 A;  2XPA A;  1Y0O A;  1KT0 A;  2WK2 A;  1Q6U A;  3WIJ A;  1W1T A;  4XAK A;  5HUA A;  4MNM A;  4WIW A;  2PV2 A;  3UQB A;  3IKD A;  1J4H A;  1FKG A;  2KGJ A;  4NSB A;  1BKF A;  4P8X A;  2MNT A;  3MDY B;  5HW8 A;  4QT2 A;  1F40 A;  4FAP A;  4ODO A;  3UI6 A;  2ZQS A;  1SR0 A;  3O5K A;  2PI6 A;  1YAT A;  2DSV A;  2ZR5 A;  4ODL A;  5DIT A;  1FKR A;  2JZV A;  2A3E A;  2M2A A;  1E6P A;  1E6N A;  1TCO C;  3GPK A;  4L3N A;  4ZS6 A;  1Q6H A;  1GOI A;  4TW7 A;  4TX0 A;  1JND A;  2AOS A;  4DZ2 A;  3QOK A;  4IT4 A;  2DSW A;  1ZCN A;  5GPG A;  5HW6 A;  1HJW A;  3PRD A;  3WD4 A;  4NNR A;  3G6L A;  2IUZ A;  3WD2 A;  5HW7 A;  1X6N A;  1WNO A;  4DWS D;  2KO7 A;  4S3K A;  5DIU A;  3WD3 A;  4P8W A;  3ARY A;  3O5D A;  3WH0 A;  1ZBK A;  3AS1 A;  4S3J A;  2F2D A;  5HBF A;  1IX5 A;  1WB0 A;  2ZQU A;  3AS3 A;  3B9D A;  2OLH A;  2PPN A;  4Z2H A;  1EQ3 A;  1ZBW A;  2WLY A;  1NMW A;  4J4N A;  3RME A;  3ARO A;  4W5U A;  4Q22 A;  2VN1 A;  1HKM A;  2N87 A;  2A3C A;  4ZPV R;  2O92 A;  4QT3 A;  4DRJ A;  1P5Q A;  4U84 A;  1W9U A;  3RM4 A;  4DWS A;  4U86 A;  4DRM A;  1J4R A;  2XP6 A;  1NSG A;  4MGV A;  3AQU A;  4W9P A;  2IF4 A;  1ZB5 A;  3OA5 A;  2MLY A;  4Z2G A;  1ZBC A;  1QPF A;  4GIV A;  2B31 A;  1FKT A;  2ZQT A;  1HKJ A;  1CTN A;  4TW8 A;  1RD6 A;  3ARU A;  1OGB A;  1NWU A;  1KT1 A;  3B9A A;  2G41 A;  2DT1 A;  1KFW A;  3KAH A;  4O2T A;  3I6C A;  4LAX A;  3IHZ A;  2F4E A;  2XP4 A;  3ARZ A;  1E15 A;  1F8A B;  2ZR4 A;  3KZ7 A;  1N1A A;  4DRQ A;  4U85 A;  3KAD A;  3WL1 A;  3ARX A;  1VF8 A;  1Q1C A;  1FKS A;  2PBC A;  4G50 A;  3WQW A;  3PR9 A;  4PTM A;  4Z2K A;  3O5G A;  4IQC A;  2KI3 A;  5HKG A;  4WJX A;  2QF8 A;  4ODM A;  3EY6 A;  1EIB A;  2DT0 A;  4WKA A;  3NI6 A;  4MSP A;  2MF9 A;  3BXW A;  2PPO A;  1LQ0 A;  1NWT A;  1LL7 A;  3B7X A;  4QIB A;  4DWS B;  2RQS A;  4L72 B;  1LL6 A;  2M08 A;  2PV3 A;  1ROT A;  2L2S A;  4ZPT R;  4W9O A;  1HKI A;  3WKZ A;  2LJ4 A;  1FKL A;  3CHE A;  2PPP A;  2XP9 A;  4Z2I A;  3B9E A;  4DRK A;  1WAW A;  3JXV A;  4DZ3 A;  2XPB A;  1UR8 A;  2FDM A;  1OWQ A;  1LG2 A;  3H9R B;  1YW5 A;  2DG3 A;  1J4I A;  3RM8 A;  3ALG A;  2MPH A;  1JNE A;  1W9P A;  4DT4 A;  4R0X A;  4ODK A;  2XP3 A;  3TDB A;  4DH0 A;  4DRH A;  5D75 A;  3WD0 A;  2XP8 A;  4LAY A;  2ZR6 A;  1PIN A;  2LGO A;  1H0I A;  2DT3 A;  3ARV A;  2F21 A;  1ITX A;  3NRK A;  5I98 A;  1O6I A;  4TYO A;  2XP7 A;  4HBE A;  1X6L A;  5HTG A;  1HKK A;  4IQ2 A;  4JFJ A;  5DIV A;  2O9O A;  4BF8 A;  1XHG A;  3UI4 A;  4DWS C;  4ODP A;  4ODR A;  4P8U A;  1J6Y A;  4WK9 A;  3CHD A;  1C9H A;  2MLZ A;  4R5E A;  2A3B A;  3FY1 A;  1NMV A;  3PRB A;  2DG9 A;  3KAF A;  4ZPW R;  4DIP A;  2Q5A A;  1K9T A;  5JH8 A;  3ALF A;  2A3A A;  3W4R A;  3UF8 A;  1BL4 A;  1D6O A;  2MLX A;  2LPV A;  2XP5 A;  3PA7 A;  3WD1 A;  1E9L A;  4JFK A;  2Y78 A;  3ARQ A;  4G2P A;  1FKJ A;  2FKE A;  4N19 A;  2WLZ A;  4MNL A;  3WL0 A;  4MAV A;  3TCZ A;  1W1V A;  1E6R A;  1FAP A;  1LJY A;  3B8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...