3CGMA

Crystal structure of thermophilic slyd
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
157
structure length
157
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 35
structure length 157
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgmA00
3O5PA 5HUAA 1KT1A 3IHZA 2KR7A 1Q6UA 2KE0A 1D7HA 2ZR4A 3KACA 3KADA 4FN2A 3RFWA 3UI6A 1TCOC 3JXVA 4BF8A 1ROUA 1Q6IA 3FAPA 2UZ5A 3H9RB 3VAWA 2OFNA 4U85A 4DRKA 2DG9A 1B6CA 1QZ2A 1ROTA 2ZR5A 1D6OA 3O5GA 3CGMA 4DIPA 4FAPA 3KAHA 5HWBA 4JFLA 5J6EA 2XP9A 4DRJA 4LAVA 4JFIA 3EY6A 4ODOA 4C02B 1ZCNA 1HXVA 4ODKA 2ZQTA 2PPPA 2Y78A 3NI6A 2ZQSA 4W9QA 2LPVA 4DZ3A 1JNSA 2RUCA 3UQBA 1D7IA 1W26A 3PRDA 2VN1A 4J4NA 2DG4A 2ZQVA 4MSPA 4GGQA 1FKKA 3TC5A 5GPGA 4LAXA 1Y0OA 1FKIA 1J4IA 3KAGA 5HW7A 3O5OA 3O5FA 4JFMA 4N19A 1D7JA 2ITKA 4DRQA 4ODQA 2LGOA 1BL4A 2RQSA 3NRKA 2Q5AA 2RSEA 1P5QA 1U79A 1YW5A 3O5QA 3UF8A 3UQAA 1FKTA 3TCZA 5B8IC 3IKGA 3WH0A 4O2TA 2MF9A 2XP7A 1C9HA 3IK8A 3MDYB 4ODMA 3UQIA 4G2PA 4G50A 4TW7A 5HTGA 2FKEA 4QT3A 5DITA 4ODNA 2F21A 2M2AA 3KAFA 1FKJA 2LJ4A 4IPXA 4W9PA 2RUDA 2DG3A 2XP5A 4W9OA 4JFJA 4MGVA 1FKBA 3O5RA 2JZVA 1FJDA 1FKRA 1FKGA 1FKFA 5HW8A 4TX0A 1J6YA 1QPFA 2L2SA 1NSGA 5I98A 1F8AB 1FKDA 3PRBA 3IKDA 4TW8A 4DRHA 5HW6A 4IQCA 4JFKA 1L1PA 3O5IA 2RUQA 2IF4A 4TNSA 5DIVA 1M5YA 2PV2A 1A7XA 1FKSA 3KABA 4LAYA 1R9HA 4ODPA 4R0XA 2MLZA 5HKGA 1F40A 4DT4A 2KGJA 1BKFA 1N1AA 2PBCA 4QIBA 4QT2A 4J4OA 3LUOA 4JYSA 3ODKA 2XP6A 1QPLA 4DRNA 1JVWA 1EQ3A 5HT1A 1YATA 1Q6HA 3O5JA 2XP4A 4NNRA 2MPHA 2KI3A 1NMWA 2FAPA 2ZR6A 3CGNA 2D9FA 3O5DA 4U86A 2VCDA 4ODRA 3JYMA 4IQ2A 1FAPA 3KCEA 3RGCA 4U84A 2MNTA 1FD9A 4DROA 2PV3A 2ZQUA 2PV1A 2KFWA 1JNTA 3KAIA 1EYMA 3O5MA 4TYOA 2LKNA 4DZ2A 3UI5A 2F2DA 5DIUA 2AWGA 3GPKA 1PINA 1T11A 3I6CA 3NTPA 3PA7A 2N87A 4LAWA 1FKHA 2KO7A 1FKLA 2PPOA 4TW6A 2M1IA 3O5LA 4DRMA 3KZ7A 1Q1CA 3O5KA 4DH0A 2K8IA 1ZK6A 4ITZA 2XP8A 3O5EA 1J4RA 1KT0A 2MLXA 2XPAA 1NMVA 1J4HA 3OOBA 2MLYA 5D75A 1PBKA 2XP3A 3JYJA 5HWCA 4GIVA 4DRIA 3UI4A 5BXJA 4DRPA 2M08A 2PPNA 2RURA 2XPBA 4ODLA 3B7XA 2F4EA 3TDBA
chains in the Genus database with same CATH superfamily
2KE0A 3RFWA 2F23A 1LJYA 1ROUA 1Q6IA 3H9RB 2UZ5A 2OFNA 1HKJA 1QZ2A 4L72B 3ARXA 4QZVB 4C02B 1HXVA 2PPPA 4W9QA 4DZ3A 1JNSA 1ZB5A 3EIPA 2DG4A 2ZQVA 4AY1A 4LAXA 1OWQA 3O5FA 1OGGA 1D7JA 2LGOA 2RQSA 3NRKA 3OA5A 1YW5A 3UF8A 3UQAA 3B9DA 1FKTA 2A3EA 4WK9A 4W9PA 5DO2A 4W9OA 1GUVA 1FKBA 1FFQA 1FKGA 1ZU8A 2DT0A 5HW8A 1GRJA 1J6YA 2ESCA 4MAVA 1UR9A 1FKDA 2B31A 4P8UA 1NWSA 4IQCA 2RUQA 2IF4A 3ARPA 4R0XA 5I98A 1RD6A 4WKFA 3AQUA 2FDMA 4QIBA 4J4OA 3LUOA 1JVWA 1ZBCA 5HT1A 2MPHA 2ZR6A 4WIWA 4ZPWR 3CGNA 4ODRA 1FAPA 2MNTA 1W1TA 2A3BA 2LKNA 2AWGA 3GPKA 1PINA 3RM4A 2KO7A 2PPOA 1FKLA 1TFVA 2M1IA 2P4VA 1GOIA 1Q1CA 2XP8A 1W9PA 2MLXA 1XRVA 5D75A 3JYJA 1ZL1A 4DRPA 1CTNA 1WB0A 4HBOA 4ODLA 2YBUA 2QF8A 3O5PA 5HUAA 2DSUA 1D7HA 3FAPA 3ARWA 3CGMA 4DIPA 4FAPA 2B5UB 3KAHA 4Z2KA 3WQWA 5HWBA 5J6EA 2XP9A 4ODOA 4Z2HA 2DPEA 3BXWA 2ZQSA 4NZCA 1W26A 4MNJA 4ZS6A 2OLHA 1W1VA 5GPGA 3TC5A 1Y0OA 2ETNA 3B8SA 3QOKA 1E9LA 5HW7A 3O5OA 3RMEA 4N19A 2ITKA 2PN0A 3CHEA 2Q5AA 2RSEA 1P5QA 1U79A 1JCHB 3WH0A 3MDYB 4ODMA 3UQIA 4TW7A 5HTGA 4QT3A 5DITA 1KFWA 3KAFA 2F21A 1FKJA 2LJ4A 1HKIA 3FY1A 2DG3A 4Q7NA 4P8XA 3WL1A 3GU0A 4MGVA 4MTVA 3O5RA 4Q22A 1FJDA 2O9OA 1FKFA 1QPFA 3B9AA 1F8AB 2DSWA 4TW8A 2G8ZA 5DF0A 5HW6A 5DIVA 1OGBA 2PV2A 1A7XA 3KABA 4LAYA 2MLZA 3WQVA 4P8VA 4DT4A 3CZ8A 1W1YA 1E6PA 4WKHA 4JYSA 3ODKA 4HARA 4WJXA 1Q6HA 2XP4A 3ALFA 1NMWA 2FAPA 1E6NA 3RGCA 3ARSA 2ZQUA 3KAIA 3RM9A 1EYMA 4TYOA 4DZ2A 5DIUA 1T11A 3NTPA 2AOSA 1W1PA 1E15A 3O5LA 4DRMA 3PR9A 3KZ7A 4P8WA 2WLZA 3ARRA 3WKZA 4DWSD 4DH0A 4ITZA 1ZBVA 2XPAA 1J4HA 1JNEA 3OOBA 2XP3A 4KR0B 4GIVA 1NWTA 1K9TA 2XPBA 1D2KA 1NH6A 2DT1A 3B7XA 3TDBA 1EHNA 2WLYA 1FFRA 3IHZA 2KR7A 1Q6UA 3KACA 2ZR4A 4FN2A 1EQ3A 1TCOC 4DRKA 4U85A 2DG9A 1EDQA 1ROTA 2ZR5A 1D6OA 3O5GA 2IUZA 4W5UA 3BMBA 4LAVA 4JFIA 3EY6A 3G6MA 4ODKA 1HKKA 2ZQTA 2Y78A 2LPVA 4PTMA 3AS0A 2RUCA 3ARUA 1LL6A 1D7IA 4DWSA 4J4NA 4URIA 4GGQA 4ZPVR 4S3JA 3CHCA 1E44A 4JFMA 3W4RA 4DRQA 4ODQA 1BL4A 2A3CA 3O5QA 3TCZA 5B8IC 2MF9A 2XP7A 1C9HA 3ARQA 1HKMA 2FKEA 4ODNA 2M2AA 4IPXA 2YBTA 1SR0A 2XP5A 4IT6A 1SYTA 4JFJA 4KQZA 1X6LA 2DSVA 1H0IA 1NSGA 2L2SA 1WNOA 3AROA 2DSZA 3PRBA 3IKDA 4DRHA 4IT4A 4JFKA 4NSBA 3RM8A 3O5IA 4TNSA 1M5YA 1FKSA 1F40A 1HJXA 4R5EA 2PBCA 4QT2A 2XP6A 2KI3A 1E6RA 2D9FA 3GTYX 4MNKA 2VCDA 3AS3A 4IQ2A 3KCEA 3ARVA 1FD9A 2PV3A 2PV1A 1JNTA 3AS2A 3WD2A 3UI5A 2F2DA 1NWRA 2A3AA 3PA7A 1LL7A 4TW6A 4LGXA 1JNDA 1ZBWA 1LL4A 2K8IA 1ZK6A 1J4RA 1LG2A 3ARYA 1KT0A 1X6NA 2EULA 1WAWA 5DEZA 5BXJA 3CH9A 5GPRA 4L3NA 2F4EA 5JH8A 1KT1A 3AS1A 3UI6A 4BF8A 3KADA 3JXVA 3PRAA 3VAWA 1W9UA 1B6CA 3ARTA 4JFLA 4DRJA 4DWSC 2WM0A 1ZBKA 1ZCNA 3NI6A 4Z2IA 3WIJA 3UQBA 3WD4A 3PRDA 2VN1A 4MSPA 1FKKA 1FKIA 1J4IA 3KAGA 2G41A 4HBEA 1NWUA 1W9VA 4ML4A 3IKGA 4O2TA 3FXYA 3IK8A 3CHDA 4G2PA 4G50A 4Z2LA 2DT3A 3WD0A 1ITXA 2RUDA 3WL0A 1H0GA 2DT2A 3WD1A 2JZVA 3B9EA 1FKRA 4TX0A 1L1PA 1VF8A 4ODPA 3G6LA 5HKGA 1R9HA 1HJWA 5GQBA 2KGJA 1BKFA 1N1AA 2PI6A 4Z2GA 5HBFA 1QPLA 4DRNA 4S3KA 1YATA 4MNLA 3O5JA 4NNRA 1EIBA 3WD3A 3O5DA 4U86A 3ARZA 4XAKA 4MNMA 3JYMA 3ALGA 4U84A 4DROA 2KFWA 3O5MA 1LQ0A 1LG1A 3I6CA 2N87A 4LAWA 4MPKA 2WK2A 1FKHA 1E6ZA 4DWSB 3O5KA 4UDMA 3O5EA 1IX5A 1HJVA 4Z2JA 1NMVA 2MLYA 1PBKA 4WKAA 4ZPTR 5HWCA 4DRIA 3UI4A 3CHFA 2M08A 2PPNA 2RURA 2O92A 1O6IA 1XHGA 1GPFA 1UR8A
chains in the Genus database with same CATH topology
2KE0A 3RFWA 1LJYA 1ROUA 1Q6IA 3H9RB 2UZ5A 2OFNA 1HKJA 1QZ2A 4L72B 3ARXA 4QZVB 4C02B 1HXVA 2PPPA 4W9QA 4DZ3A 1JNSA 1ZB5A 2DG4A 2ZQVA 4AY1A 4LAXA 1OWQA 3O5FA 1OGGA 1D7JA 2LGOA 2RQSA 3NRKA 3OA5A 1YW5A 3UF8A 3UQAA 3B9DA 1FKTA 2A3EA 4WK9A 4W9PA 5DO2A 4W9OA 1GUVA 1FKBA 1FFQA 1FKGA 1ZU8A 2DT0A 5HW8A 1J6YA 2ESCA 4MAVA 1UR9A 1FKDA 2B31A 4P8UA 1NWSA 4IQCA 2RUQA 2IF4A 3ARPA 4R0XA 5I98A 1RD6A 4WKFA 3AQUA 2FDMA 4QIBA 4J4OA 3LUOA 1JVWA 1ZBCA 5HT1A 2MPHA 2ZR6A 4WIWA 4ZPWR 3CGNA 4ODRA 1FAPA 2MNTA 1W1TA 2A3BA 2LKNA 2AWGA 3GPKA 1PINA 3RM4A 2KO7A 2PPOA 1FKLA 1TFVA 2M1IA 1GOIA 1Q1CA 2XP8A 1W9PA 2MLXA 1XRVA 5D75A 3JYJA 1ZL1A 4DRPA 1CTNA 1WB0A 4HBOA 4ODLA 2YBUA 2QF8A 3O5PA 5HUAA 2DSUA 1D7HA 3FAPA 3ARWA 3CGMA 4DIPA 4FAPA 3KAHA 4Z2KA 3WQWA 5HWBA 5J6EA 2XP9A 4ODOA 4Z2HA 2DPEA 3BXWA 2ZQSA 4NZCA 1W26A 4MNJA 4ZS6A 2OLHA 1W1VA 5GPGA 3TC5A 1Y0OA 3B8SA 3QOKA 1E9LA 5HW7A 3O5OA 3RMEA 4N19A 2ITKA 3CHEA 2Q5AA 2RSEA 1P5QA 1U79A 3WH0A 3MDYB 4ODMA 3UQIA 4TW7A 5HTGA 4QT3A 5DITA 1KFWA 3KAFA 2F21A 1FKJA 2LJ4A 1HKIA 3FY1A 2DG3A 4Q7NA 4P8XA 3WL1A 4MGVA 4MTVA 3O5RA 4Q22A 1FJDA 2O9OA 1FKFA 1QPFA 3B9AA 1F8AB 2DSWA 4TW8A 2G8ZA 5DF0A 5HW6A 5DIVA 1OGBA 2PV2A 1A7XA 3KABA 4LAYA 2MLZA 3WQVA 4P8VA 4DT4A 3CZ8A 1W1YA 1E6PA 4WKHA 4JYSA 3ODKA 4HARA 4WJXA 1Q6HA 2XP4A 3ALFA 1NMWA 2FAPA 1E6NA 3RGCA 3ARSA 2ZQUA 3KAIA 3RM9A 1EYMA 4TYOA 4DZ2A 5DIUA 1T11A 3NTPA 2AOSA 1W1PA 1E15A 3O5LA 4DRMA 3PR9A 3KZ7A 4P8WA 2WLZA 3ARRA 3WKZA 4DWSD 4DH0A 4ITZA 1ZBVA 2XPAA 1J4HA 1JNEA 3OOBA 2XP3A 4KR0B 4GIVA 1NWTA 1K9TA 2XPBA 1D2KA 1NH6A 2DT1A 3B7XA 3TDBA 1EHNA 2WLYA 1FFRA 3IHZA 2KR7A 1Q6UA 3KACA 2ZR4A 4FN2A 1EQ3A 1TCOC 4DRKA 4U85A 2DG9A 1EDQA 1ROTA 2ZR5A 1D6OA 3O5GA 2IUZA 4W5UA 4LAVA 4JFIA 3EY6A 3G6MA 4ODKA 1HKKA 2ZQTA 2Y78A 2LPVA 4PTMA 3AS0A 2RUCA 3ARUA 1LL6A 1D7IA 4DWSA 4J4NA 4URIA 4GGQA 4ZPVR 4S3JA 3CHCA 4JFMA 3W4RA 4DRQA 4ODQA 1BL4A 2A3CA 3O5QA 3TCZA 5B8IC 2MF9A 2XP7A 1C9HA 3ARQA 1HKMA 2FKEA 4ODNA 2M2AA 4IPXA 2YBTA 1SR0A 2XP5A 4IT6A 1SYTA 4JFJA 4KQZA 1X6LA 2DSVA 1H0IA 1NSGA 2L2SA 1WNOA 3AROA 2DSZA 3PRBA 3IKDA 4DRHA 4IT4A 4JFKA 4NSBA 3RM8A 3O5IA 4TNSA 1M5YA 1FKSA 1F40A 1HJXA 4R5EA 2PBCA 4QT2A 2XP6A 2KI3A 1E6RA 2D9FA 4MNKA 2VCDA 3AS3A 4IQ2A 3KCEA 3ARVA 1FD9A 2PV3A 2PV1A 1JNTA 3AS2A 3WD2A 3UI5A 2F2DA 1NWRA 2A3AA 3PA7A 1LL7A 4TW6A 4LGXA 1JNDA 1ZBWA 1LL4A 2K8IA 1ZK6A 1J4RA 1LG2A 1KT0A 1X6NA 3ARYA 1WAWA 5DEZA 5BXJA 3CH9A 5GPRA 4L3NA 2F4EA 5JH8A 1KT1A 3AS1A 3UI6A 4BF8A 3KADA 3JXVA 3PRAA 3VAWA 1W9UA 1B6CA 3ARTA 4JFLA 4DRJA 4DWSC 2WM0A 1ZBKA 1ZCNA 3NI6A 4Z2IA 3WIJA 3UQBA 3WD4A 3PRDA 2VN1A 4MSPA 1FKKA 1FKIA 1J4IA 3KAGA 2G41A 4HBEA 1NWUA 1W9VA 4ML4A 3IKGA 4O2TA 3FXYA 3IK8A 3CHDA 4G2PA 4G50A 4Z2LA 2DT3A 3WD0A 1ITXA 2RUDA 3WL0A 1H0GA 2DT2A 3WD1A 2JZVA 3B9EA 1FKRA 4TX0A 1L1PA 1VF8A 4ODPA 3G6LA 5HKGA 1R9HA 1HJWA 5GQBA 2KGJA 1BKFA 1N1AA 2PI6A 4Z2GA 5HBFA 1QPLA 4DRNA 4S3KA 1YATA 4MNLA 3O5JA 4NNRA 1EIBA 3WD3A 3O5DA 4U86A 3ARZA 4XAKA 4MNMA 3JYMA 3ALGA 4U84A 4DROA 2KFWA 3O5MA 1LQ0A 1LG1A 3I6CA 2N87A 4LAWA 4MPKA 2WK2A 1FKHA 1E6ZA 4DWSB 3O5KA 3O5EA 1IX5A 1HJVA 4Z2JA 1NMVA 2MLYA 1PBKA 4WKAA 4ZPTR 5HWCA 4DRIA 3UI4A 3CHFA 2M08A 2PPNA 2RURA 2O92A 1O6IA 1XHGA 1GPFA 1UR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5P A;  5HUA A;  1KT1 A;  3IHZ A;  2KR7 A;  1Q6U A;  2KE0 A;  1D7H A;  2ZR4 A;  3KAC A;  3KAD A;  4FN2 A;  3RFW A;  3UI6 A;  1TCO C;  3JXV A;  4BF8 A;  1ROU A;  1Q6I A;  3FAP A;  2UZ5 A;  3H9R B;  3VAW A;  2OFN A;  4U85 A;  4DRK A;  2DG9 A;  1B6C A;  1QZ2 A;  1ROT A;  2ZR5 A;  1D6O A;  3O5G A;  3CGM A;  4DIP A;  4FAP A;  3KAH A;  5HWB A;  4JFL A;  5J6E A;  2XP9 A;  4DRJ A;  4LAV A;  4JFI A;  3EY6 A;  4ODO A;  4C02 B;  1ZCN A;  1HXV A;  4ODK A;  2ZQT A;  2PPP A;  2Y78 A;  3NI6 A;  2ZQS A;  4W9Q A;  2LPV A;  4DZ3 A;  1JNS A;  2RUC A;  3UQB A;  1D7I A;  1W26 A;  3PRD A;  2VN1 A;  4J4N A;  2DG4 A;  2ZQV A;  4MSP A;  4GGQ A;  1FKK A;  3TC5 A;  5GPG A;  4LAX A;  1Y0O A;  1FKI A;  1J4I A;  3KAG A;  5HW7 A;  3O5O A;  3O5F A;  4JFM A;  4N19 A;  1D7J A;  2ITK A;  4DRQ A;  4ODQ A;  2LGO A;  1BL4 A;  2RQS A;  3NRK A;  2Q5A A;  2RSE A;  1P5Q A;  1U79 A;  1YW5 A;  3O5Q A;  3UF8 A;  3UQA A;  1FKT A;  3TCZ A;  5B8I C;  3IKG A;  3WH0 A;  4O2T A;  2MF9 A;  2XP7 A;  1C9H A;  3IK8 A;  3MDY B;  4ODM A;  3UQI A;  4G2P A;  4G50 A;  4TW7 A;  5HTG A;  2FKE A;  4QT3 A;  5DIT A;  4ODN A;  2F21 A;  2M2A A;  3KAF A;  1FKJ A;  2LJ4 A;  4IPX A;  4W9P A;  2RUD A;  2DG3 A;  2XP5 A;  4W9O A;  4JFJ A;  4MGV A;  1FKB A;  3O5R A;  2JZV A;  1FJD A;  1FKR A;  1FKG A;  1FKF A;  5HW8 A;  4TX0 A;  1J6Y A;  1QPF A;  2L2S A;  1NSG A;  5I98 A;  1F8A B;  1FKD A;  3PRB A;  3IKD A;  4TW8 A;  4DRH A;  5HW6 A;  4IQC A;  4JFK A;  1L1P A;  3O5I A;  2RUQ A;  2IF4 A;  4TNS A;  5DIV A;  1M5Y A;  2PV2 A;  1A7X A;  1FKS A;  3KAB A;  4LAY A;  1R9H A;  4ODP A;  4R0X A;  2MLZ A;  5HKG A;  1F40 A;  4DT4 A;  2KGJ A;  1BKF A;  1N1A A;  2PBC A;  4QIB A;  4QT2 A;  4J4O A;  3LUO A;  4JYS A;  3ODK A;  2XP6 A;  1QPL A;  4DRN A;  1JVW A;  1EQ3 A;  5HT1 A;  1YAT A;  1Q6H A;  3O5J A;  2XP4 A;  4NNR A;  2MPH A;  2KI3 A;  1NMW A;  2FAP A;  2ZR6 A;  3CGN A;  2D9F A;  3O5D A;  4U86 A;  2VCD A;  4ODR A;  3JYM A;  4IQ2 A;  1FAP A;  3KCE A;  3RGC A;  4U84 A;  2MNT A;  1FD9 A;  4DRO A;  2PV3 A;  2ZQU A;  2PV1 A;  2KFW A;  1JNT A;  3KAI A;  1EYM A;  3O5M A;  4TYO A;  2LKN A;  4DZ2 A;  3UI5 A;  2F2D A;  5DIU A;  2AWG A;  3GPK A;  1PIN A;  1T11 A;  3I6C A;  3NTP A;  3PA7 A;  2N87 A;  4LAW A;  1FKH A;  2KO7 A;  1FKL A;  2PPO A;  4TW6 A;  2M1I A;  3O5L A;  4DRM A;  3KZ7 A;  1Q1C A;  3O5K A;  4DH0 A;  2K8I A;  1ZK6 A;  4ITZ A;  2XP8 A;  3O5E A;  1J4R A;  1KT0 A;  2MLX A;  2XPA A;  1NMV A;  1J4H A;  3OOB A;  2MLY A;  5D75 A;  1PBK A;  2XP3 A;  3JYJ A;  5HWC A;  4GIV A;  4DRI A;  3UI4 A;  5BXJ A;  4DRP A;  2M08 A;  2PPN A;  2RUR A;  2XPB A;  4ODL A;  3B7X A;  2F4E A;  3TDB A; 
#chains in the Genus database with same CATH topology
 2KE0 A;  3RFW A;  2F23 A;  1LJY A;  1ROU A;  1Q6I A;  3H9R B;  2UZ5 A;  2OFN A;  1HKJ A;  1QZ2 A;  4L72 B;  3ARX A;  4QZV B;  4C02 B;  1HXV A;  2PPP A;  4W9Q A;  4DZ3 A;  1JNS A;  1ZB5 A;  3EIP A;  2DG4 A;  2ZQV A;  4AY1 A;  4LAX A;  1OWQ A;  3O5F A;  1OGG A;  1D7J A;  2LGO A;  2RQS A;  3NRK A;  3OA5 A;  1YW5 A;  3UF8 A;  3UQA A;  3B9D A;  1FKT A;  2A3E A;  4WK9 A;  4W9P A;  5DO2 A;  4W9O A;  1GUV A;  1FKB A;  1FFQ A;  1FKG A;  1ZU8 A;  2DT0 A;  5HW8 A;  1GRJ A;  1J6Y A;  2ESC A;  4MAV A;  1UR9 A;  1FKD A;  2B31 A;  4P8U A;  1NWS A;  4IQC A;  2RUQ A;  2IF4 A;  3ARP A;  4R0X A;  5I98 A;  1RD6 A;  4WKF A;  3AQU A;  2FDM A;  4QIB A;  4J4O A;  3LUO A;  1JVW A;  1ZBC A;  5HT1 A;  2MPH A;  2ZR6 A;  4WIW A;  4ZPW R;  3CGN A;  4ODR A;  1FAP A;  2MNT A;  1W1T A;  2A3B A;  2LKN A;  2AWG A;  3GPK A;  1PIN A;  3RM4 A;  2KO7 A;  2PPO A;  1FKL A;  1TFV A;  2M1I A;  2P4V A;  1GOI A;  1Q1C A;  2XP8 A;  1W9P A;  2MLX A;  1XRV A;  5D75 A;  3JYJ A;  1ZL1 A;  4DRP A;  1CTN A;  1WB0 A;  4HBO A;  4ODL A;  2YBU A;  2QF8 A;  3O5P A;  5HUA A;  2DSU A;  1D7H A;  3FAP A;  3ARW A;  3CGM A;  4DIP A;  4FAP A;  2B5U B;  3KAH A;  4Z2K A;  3WQW A;  5HWB A;  5J6E A;  2XP9 A;  4ODO A;  4Z2H A;  2DPE A;  3BXW A;  2ZQS A;  4NZC A;  1W26 A;  4MNJ A;  4ZS6 A;  2OLH A;  1W1V A;  5GPG A;  3TC5 A;  1Y0O A;  2ETN A;  3B8S A;  3QOK A;  1E9L A;  5HW7 A;  3O5O A;  3RME A;  4N19 A;  2ITK A;  2PN0 A;  3CHE A;  2Q5A A;  2RSE A;  1P5Q A;  1U79 A;  1JCH B;  3WH0 A;  3MDY B;  4ODM A;  3UQI A;  4TW7 A;  5HTG A;  4QT3 A;  5DIT A;  1KFW A;  3KAF A;  2F21 A;  1FKJ A;  2LJ4 A;  1HKI A;  3FY1 A;  2DG3 A;  4Q7N A;  4P8X A;  3WL1 A;  3GU0 A;  4MGV A;  4MTV A;  3O5R A;  4Q22 A;  1FJD A;  2O9O A;  1FKF A;  1QPF A;  3B9A A;  1F8A B;  2DSW A;  4TW8 A;  2G8Z A;  5DF0 A;  5HW6 A;  5DIV A;  1OGB A;  2PV2 A;  1A7X A;  3KAB A;  4LAY A;  2MLZ A;  3WQV A;  4P8V A;  4DT4 A;  3CZ8 A;  1W1Y A;  1E6P A;  4WKH A;  4JYS A;  3ODK A;  4HAR A;  4WJX A;  1Q6H A;  2XP4 A;  3ALF A;  1NMW A;  2FAP A;  1E6N A;  3RGC A;  3ARS A;  2ZQU A;  3KAI A;  3RM9 A;  1EYM A;  4TYO A;  4DZ2 A;  5DIU A;  1T11 A;  3NTP A;  2AOS A;  1W1P A;  1E15 A;  3O5L A;  4DRM A;  3PR9 A;  3KZ7 A;  4P8W A;  2WLZ A;  3ARR A;  3WKZ A;  4DWS D;  4DH0 A;  4ITZ A;  1ZBV A;  2XPA A;  1J4H A;  1JNE A;  3OOB A;  2XP3 A;  4KR0 B;  4GIV A;  1NWT A;  1K9T A;  2XPB A;  1D2K A;  1NH6 A;  2DT1 A;  3B7X A;  3TDB A;  1EHN A;  2WLY A;  1FFR A;  3IHZ A;  2KR7 A;  1Q6U A;  3KAC A;  2ZR4 A;  4FN2 A;  1EQ3 A;  1TCO C;  4DRK A;  4U85 A;  2DG9 A;  1EDQ A;  1ROT A;  2ZR5 A;  1D6O A;  3O5G A;  2IUZ A;  4W5U A;  3BMB A;  4LAV A;  4JFI A;  3EY6 A;  3G6M A;  4ODK A;  1HKK A;  2ZQT A;  2Y78 A;  2LPV A;  4PTM A;  3AS0 A;  2RUC A;  3ARU A;  1LL6 A;  1D7I A;  4DWS A;  4J4N A;  4URI A;  4GGQ A;  4ZPV R;  4S3J A;  3CHC A;  1E44 A;  4JFM A;  3W4R A;  4DRQ A;  4ODQ A;  1BL4 A;  2A3C A;  3O5Q A;  3TCZ A;  5B8I C;  2MF9 A;  2XP7 A;  1C9H A;  3ARQ A;  1HKM A;  2FKE A;  4ODN A;  2M2A A;  4IPX A;  2YBT A;  1SR0 A;  2XP5 A;  4IT6 A;  1SYT A;  4JFJ A;  4KQZ A;  1X6L A;  2DSV A;  1H0I A;  1NSG A;  2L2S A;  1WNO A;  3ARO A;  2DSZ A;  3PRB A;  3IKD A;  4DRH A;  4IT4 A;  4JFK A;  4NSB A;  3RM8 A;  3O5I A;  4TNS A;  1M5Y A;  1FKS A;  1F40 A;  1HJX A;  4R5E A;  2PBC A;  4QT2 A;  2XP6 A;  2KI3 A;  1E6R A;  2D9F A;  3GTY X;  4MNK A;  2VCD A;  3AS3 A;  4IQ2 A;  3KCE A;  3ARV A;  1FD9 A;  2PV3 A;  2PV1 A;  1JNT A;  3AS2 A;  3WD2 A;  3UI5 A;  2F2D A;  1NWR A;  2A3A A;  3PA7 A;  1LL7 A;  4TW6 A;  4LGX A;  1JND A;  1ZBW A;  1LL4 A;  2K8I A;  1ZK6 A;  1J4R A;  1LG2 A;  3ARY A;  1KT0 A;  1X6N A;  2EUL A;  1WAW A;  5DEZ A;  5BXJ A;  3CH9 A;  5GPR A;  4L3N A;  2F4E A;  5JH8 A;  1KT1 A;  3AS1 A;  3UI6 A;  4BF8 A;  3KAD A;  3JXV A;  3PRA A;  3VAW A;  1W9U A;  1B6C A;  3ART A;  4JFL A;  4DRJ A;  4DWS C;  2WM0 A;  1ZBK A;  1ZCN A;  3NI6 A;  4Z2I A;  3WIJ A;  3UQB A;  3WD4 A;  3PRD A;  2VN1 A;  4MSP A;  1FKK A;  1FKI A;  1J4I A;  3KAG A;  2G41 A;  4HBE A;  1NWU A;  1W9V A;  4ML4 A;  3IKG A;  4O2T A;  3FXY A;  3IK8 A;  3CHD A;  4G2P A;  4G50 A;  4Z2L A;  2DT3 A;  3WD0 A;  1ITX A;  2RUD A;  3WL0 A;  1H0G A;  2DT2 A;  3WD1 A;  2JZV A;  3B9E A;  1FKR A;  4TX0 A;  1L1P A;  1VF8 A;  4ODP A;  3G6L A;  5HKG A;  1R9H A;  1HJW A;  5GQB A;  2KGJ A;  1BKF A;  1N1A A;  2PI6 A;  4Z2G A;  5HBF A;  1QPL A;  4DRN A;  4S3K A;  1YAT A;  4MNL A;  3O5J A;  4NNR A;  1EIB A;  3WD3 A;  3O5D A;  4U86 A;  3ARZ A;  4XAK A;  4MNM A;  3JYM A;  3ALG A;  4U84 A;  4DRO A;  2KFW A;  3O5M A;  1LQ0 A;  1LG1 A;  3I6C A;  2N87 A;  4LAW A;  4MPK A;  2WK2 A;  1FKH A;  1E6Z A;  4DWS B;  3O5K A;  4UDM A;  3O5E A;  1IX5 A;  1HJV A;  4Z2J A;  1NMV A;  2MLY A;  1PBK A;  4WKA A;  4ZPT R;  5HWC A;  4DRI A;  3UI4 A;  3CHF A;  2M08 A;  2PPN A;  2RUR A;  2O92 A;  1O6I A;  1XHG A;  1GPF A;  1UR8 A; 
#chains in the Genus database with same CATH homology
 2KE0 A;  3RFW A;  1LJY A;  1ROU A;  1Q6I A;  3H9R B;  2UZ5 A;  2OFN A;  1HKJ A;  1QZ2 A;  4L72 B;  3ARX A;  4QZV B;  4C02 B;  1HXV A;  2PPP A;  4W9Q A;  4DZ3 A;  1JNS A;  1ZB5 A;  2DG4 A;  2ZQV A;  4AY1 A;  4LAX A;  1OWQ A;  3O5F A;  1OGG A;  1D7J A;  2LGO A;  2RQS A;  3NRK A;  3OA5 A;  1YW5 A;  3UF8 A;  3UQA A;  3B9D A;  1FKT A;  2A3E A;  4WK9 A;  4W9P A;  5DO2 A;  4W9O A;  1GUV A;  1FKB A;  1FFQ A;  1FKG A;  1ZU8 A;  2DT0 A;  5HW8 A;  1J6Y A;  2ESC A;  4MAV A;  1UR9 A;  1FKD A;  2B31 A;  4P8U A;  1NWS A;  4IQC A;  2RUQ A;  2IF4 A;  3ARP A;  4R0X A;  5I98 A;  1RD6 A;  4WKF A;  3AQU A;  2FDM A;  4QIB A;  4J4O A;  3LUO A;  1JVW A;  1ZBC A;  5HT1 A;  2MPH A;  2ZR6 A;  4WIW A;  4ZPW R;  3CGN A;  4ODR A;  1FAP A;  2MNT A;  1W1T A;  2A3B A;  2LKN A;  2AWG A;  3GPK A;  1PIN A;  3RM4 A;  2KO7 A;  2PPO A;  1FKL A;  1TFV A;  2M1I A;  1GOI A;  1Q1C A;  2XP8 A;  1W9P A;  2MLX A;  1XRV A;  5D75 A;  3JYJ A;  1ZL1 A;  4DRP A;  1CTN A;  1WB0 A;  4HBO A;  4ODL A;  2YBU A;  2QF8 A;  3O5P A;  5HUA A;  2DSU A;  1D7H A;  3FAP A;  3ARW A;  3CGM A;  4DIP A;  4FAP A;  3KAH A;  4Z2K A;  3WQW A;  5HWB A;  5J6E A;  2XP9 A;  4ODO A;  4Z2H A;  2DPE A;  3BXW A;  2ZQS A;  4NZC A;  1W26 A;  4MNJ A;  4ZS6 A;  2OLH A;  1W1V A;  5GPG A;  3TC5 A;  1Y0O A;  3B8S A;  3QOK A;  1E9L A;  5HW7 A;  3O5O A;  3RME A;  4N19 A;  2ITK A;  3CHE A;  2Q5A A;  2RSE A;  1P5Q A;  1U79 A;  3WH0 A;  3MDY B;  4ODM A;  3UQI A;  4TW7 A;  5HTG A;  4QT3 A;  5DIT A;  1KFW A;  3KAF A;  2F21 A;  1FKJ A;  2LJ4 A;  1HKI A;  3FY1 A;  2DG3 A;  4Q7N A;  4P8X A;  3WL1 A;  4MGV A;  4MTV A;  3O5R A;  4Q22 A;  1FJD A;  2O9O A;  1FKF A;  1QPF A;  3B9A A;  1F8A B;  2DSW A;  4TW8 A;  2G8Z A;  5DF0 A;  5HW6 A;  5DIV A;  1OGB A;  2PV2 A;  1A7X A;  3KAB A;  4LAY A;  2MLZ A;  3WQV A;  4P8V A;  4DT4 A;  3CZ8 A;  1W1Y A;  1E6P A;  4WKH A;  4JYS A;  3ODK A;  4HAR A;  4WJX A;  1Q6H A;  2XP4 A;  3ALF A;  1NMW A;  2FAP A;  1E6N A;  3RGC A;  3ARS A;  2ZQU A;  3KAI A;  3RM9 A;  1EYM A;  4TYO A;  4DZ2 A;  5DIU A;  1T11 A;  3NTP A;  2AOS A;  1W1P A;  1E15 A;  3O5L A;  4DRM A;  3PR9 A;  3KZ7 A;  4P8W A;  2WLZ A;  3ARR A;  3WKZ A;  4DWS D;  4DH0 A;  4ITZ A;  1ZBV A;  2XPA A;  1J4H A;  1JNE A;  3OOB A;  2XP3 A;  4KR0 B;  4GIV A;  1NWT A;  1K9T A;  2XPB A;  1D2K A;  1NH6 A;  2DT1 A;  3B7X A;  3TDB A;  1EHN A;  2WLY A;  1FFR A;  3IHZ A;  2KR7 A;  1Q6U A;  3KAC A;  2ZR4 A;  4FN2 A;  1EQ3 A;  1TCO C;  4DRK A;  4U85 A;  2DG9 A;  1EDQ A;  1ROT A;  2ZR5 A;  1D6O A;  3O5G A;  2IUZ A;  4W5U A;  4LAV A;  4JFI A;  3EY6 A;  3G6M A;  4ODK A;  1HKK A;  2ZQT A;  2Y78 A;  2LPV A;  4PTM A;  3AS0 A;  2RUC A;  3ARU A;  1LL6 A;  1D7I A;  4DWS A;  4J4N A;  4URI A;  4GGQ A;  4ZPV R;  4S3J A;  3CHC A;  4JFM A;  3W4R A;  4DRQ A;  4ODQ A;  1BL4 A;  2A3C A;  3O5Q A;  3TCZ A;  5B8I C;  2MF9 A;  2XP7 A;  1C9H A;  3ARQ A;  1HKM A;  2FKE A;  4ODN A;  2M2A A;  4IPX A;  2YBT A;  1SR0 A;  2XP5 A;  4IT6 A;  1SYT A;  4JFJ A;  4KQZ A;  1X6L A;  2DSV A;  1H0I A;  1NSG A;  2L2S A;  1WNO A;  3ARO A;  2DSZ A;  3PRB A;  3IKD A;  4DRH A;  4IT4 A;  4JFK A;  4NSB A;  3RM8 A;  3O5I A;  4TNS A;  1M5Y A;  1FKS A;  1F40 A;  1HJX A;  4R5E A;  2PBC A;  4QT2 A;  2XP6 A;  2KI3 A;  1E6R A;  2D9F A;  4MNK A;  2VCD A;  3AS3 A;  4IQ2 A;  3KCE A;  3ARV A;  1FD9 A;  2PV3 A;  2PV1 A;  1JNT A;  3AS2 A;  3WD2 A;  3UI5 A;  2F2D A;  1NWR A;  2A3A A;  3PA7 A;  1LL7 A;  4TW6 A;  4LGX A;  1JND A;  1ZBW A;  1LL4 A;  2K8I A;  1ZK6 A;  1J4R A;  1LG2 A;  1KT0 A;  1X6N A;  3ARY A;  1WAW A;  5DEZ A;  5BXJ A;  3CH9 A;  5GPR A;  4L3N A;  2F4E A;  5JH8 A;  1KT1 A;  3AS1 A;  3UI6 A;  4BF8 A;  3KAD A;  3JXV A;  3PRA A;  3VAW A;  1W9U A;  1B6C A;  3ART A;  4JFL A;  4DRJ A;  4DWS C;  2WM0 A;  1ZBK A;  1ZCN A;  3NI6 A;  4Z2I A;  3WIJ A;  3UQB A;  3WD4 A;  3PRD A;  2VN1 A;  4MSP A;  1FKK A;  1FKI A;  1J4I A;  3KAG A;  2G41 A;  4HBE A;  1NWU A;  1W9V A;  4ML4 A;  3IKG A;  4O2T A;  3FXY A;  3IK8 A;  3CHD A;  4G2P A;  4G50 A;  4Z2L A;  2DT3 A;  3WD0 A;  1ITX A;  2RUD A;  3WL0 A;  1H0G A;  2DT2 A;  3WD1 A;  2JZV A;  3B9E A;  1FKR A;  4TX0 A;  1L1P A;  1VF8 A;  4ODP A;  3G6L A;  5HKG A;  1R9H A;  1HJW A;  5GQB A;  2KGJ A;  1BKF A;  1N1A A;  2PI6 A;  4Z2G A;  5HBF A;  1QPL A;  4DRN A;  4S3K A;  1YAT A;  4MNL A;  3O5J A;  4NNR A;  1EIB A;  3WD3 A;  3O5D A;  4U86 A;  3ARZ A;  4XAK A;  4MNM A;  3JYM A;  3ALG A;  4U84 A;  4DRO A;  2KFW A;  3O5M A;  1LQ0 A;  1LG1 A;  3I6C A;  2N87 A;  4LAW A;  4MPK A;  2WK2 A;  1FKH A;  1E6Z A;  4DWS B;  3O5K A;  3O5E A;  1IX5 A;  1HJV A;  4Z2J A;  1NMV A;  2MLY A;  1PBK A;  4WKA A;  4ZPT R;  5HWC A;  4DRI A;  3UI4 A;  3CHF A;  2M08 A;  2PPN A;  2RUR A;  2O92 A;  1O6I A;  1XHG A;  1GPF A;  1UR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...