3CGMA

Crystal structure of thermophilic slyd
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
157
structure length
157
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 35
structure length 157
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgmA00
2K8IA 2PV1A 4QT3A 2RQSA 2ZQSA 4JFIA 4DZ2A 2MNTA 2MPHA 1JNSA 2MLYA 3UI5A 1NMWA 1FKDA 1W26A 4DRIA 1JVWA 4ODQA 4TW8A 2KI3A 3O5PA 4DRJA 1FD9A 1FKIA 2OFNA 2KE0A 4DIPA 5HWBA 1F40A 1J4HA 1NMVA 1ZCNA 3UI6A 4O2TA 4U84A 4TW7A 1Q6HA 4GGQA 1D7JA 1NSGA 1Q6IA 1HXVA 1D7HA 1J4IA 1M5YA 3B7XA 1FKLA 2M08A 2PPNA 3GPKA 4ODPA 3MDYB 2XPAA 3PRBA 3KACA 4TW6A 5DITA 3O5OA 3KCEA 3CGMA 1BKFA 4DRHA 2M1IA 3O5FA 2FAPA 3VAWA 3O5QA 3UQBA 1FKFA 3KAHA 4ODMA 3O5JA 4U86A 4IQCA 1FKKA 1F8AB 1FKBA 3IK8A 1FKTA 4N19A 3FAPA 5DIVA 1BL4A 2VN1A 2ZR4A 1QPLA 2RUDA 2ZQVA 3IHZA 4W9PA 5D75A 3O5EA 3ODKA 5HWCA 4ITZA 3KAIA 1J6YA 3NTPA 2KFWA 4TYOA 1FAPA 1J4RA 3KAFA 1PINA 1PBKA 1FKRA 3O5GA 1Q6UA 2KR7A 3IKDA 2AWGA 3UF8A 1TCOC 1KT1A 2UZ5A 3UQIA 2LKNA 1ROUA 4DH0A 4MGVA 3KADA 5B8IC 1KT0A 1ZK6A 2DG4A 4DT4A 4LAWA 1EQ3A 3KAGA 4GIVA 4IPXA 4U85A 2MLXA 5HW6A 1Y0OA 2VCDA 2XP7A 1QPFA 3PRDA 2DG9A 4JYSA 1P5QA 2IF4A 4DZ3A 4MSPA 1D6OA 2XP9A 2PBCA 5HTGA 1B6CA 2FKEA 2PPPA 3JYJA 1YATA 4JFKA 4DRMA 2MF9A 3PA7A 4JFLA 2XP4A 2XP8A 4QT2A 3TCZA 2PPOA 4DRQA 4IQ2A 4R0XA 4DROA 5HUAA 2LGOA 4G2PA 1C9HA 2KO7A 2F21A 2N87A 3LUOA 4FN2A 4DRKA 4DRNA 1FKSA 4ODRA 4BF8A 3I6CA 4J4OA 4ODOA 1T11A 3O5KA 2RUQA 2ZQTA 3O5RA 2KGJA 4C02B 1FJDA 4LAVA 2XP5A 5BXJA 2RURA 3EY6A 1FKGA 3OOBA 4ODKA 1JNTA 5GPGA 3RGCA 3KZ7A 1ROTA 2XP3A 4NNRA 3JYMA 1R9HA 3O5DA 3WH0A 4G50A 4LAYA 5HW8A 5DIUA 4J4NA 1D7IA 5I98A 2L2SA 2ITKA 3O5LA 2DG3A 1EYMA 4DRPA 5HKGA 3TC5A 2RSEA 4W9QA 3RFWA 2Q5AA 3IKGA 4QIBA 4TX0A 1A7XA 1L1PA 2F2DA 2XP6A 2XPBA 1FKHA 3NI6A 3NRKA 2ZR6A 2MLZA 2JZVA 2RUCA 2D9FA 4JFJA 1U79A 2PV2A 2Y78A 5J6EA 4ODNA 2M2AA 3CGNA 4JFMA 2ZQUA 5HW7A 3JXVA 4LAXA 5HT1A 1YW5A 3UQAA 1FKJA 1N1AA 2LPVA 3H9RB 3O5IA 4W9OA 2PV3A 2ZR5A 3O5MA 1QZ2A 3KABA 3TDBA 3UI4A 1Q1CA 4FAPA 4TNSA 2LJ4A 4ODLA 2F4EA
chains in the Genus database with same CATH superfamily
3WD2A 2K8IA 1JNSA 4DZ2A 2MLYA 3UI5A 1JVWA 4HBOA 1GPFA 4ODQA 4TW8A 2KI3A 3O5PA 2ETNA 4W5UA 2OFNA 2KE0A 5HWBA 4TW7A 3CZ8A 2EULA 1Q6IA 1M5YA 1SR0A 2XPAA 3WD0A 3CGMA 5DEZA 4DRHA 4ML4A 3O5FA 2OLHA 3VAWA 1E6NA 4ODMA 3WD4A 4KQZA 1FKKA 4DWSC 1KFWA 1FKTA 1LL6A 2VN1A 2ZQVA 1QPLA 5D75A 3WD3A 1W9VA 1XHGA 5JH8A 1UR9A 2AOSA 2DT1A 5HBFA 1FAPA 1LQ0A 1VF8A 2AWGA 1KT1A 1OGGA 4MGVA 1KT0A 1EQ3A 4LGXA 4DWSB 4DWSD 4JYSA 1ZBKA 1D6OA 2PBCA 4JFKA 2XP8A 5HUAA 2PPOA 4DRQA 1C9HA 2F21A 4FN2A 4DRKA 4DRNA 2P4VA 3O5KA 4MNLA 2KGJA 4C02B 1FJDA 4LAVA 2RURA 3CHDA 3OOBA 4PTMA 1E6PA 4ZPTR 3RGCA 3KZ7A 2DSWA 2XP3A 3JYMA 1R9HA 2F23A 3O5DA 5HW8A 3BMBA 1D7IA 2B5UB 3RM4A 1JNEA 4HARA 2ITKA 4WK9A 4W9QA 3RFWA 3IKGA 2DT0A 3ARYA 1W1VA 1A7XA 2XPBA 2XP6A 4JFJA 1JCHB 1LJYA 2DT3A 4ZPVR 2ZQUA 3JXVA 3UQAA 2PV3A 4FAPA 1HKKA 2DSVA 4WKHA 1OGBA 2F4EA 3G6MA 2PV1A 4QT3A 2RQSA 4KR0B 2MPHA 2O9OA 4L3NA 3WKZA 4WIWA 1JNDA 1FD9A 4Z2IA 1J4HA 1NMVA 1ZCNA 2DPEA 1GRJA 1NSGA 1HXVA 3B7XA 4P8WA 4ODPA 3MDYB 5DITA 3O5OA 1BKFA 3OA5A 2M1IA 1W1TA 2DT2A 3ARPA 2FAPA 2YBTA 4U86A 4IQCA 1IX5A 4Z2JA 2ESCA 4N19A 2G8ZA 3FAPA 3AS3A 5DIVA 1BL4A 1F40A 4NZCA 1TFVA 2A3EA 5HWCA 3ODKA 4ITZA 3KAIA 3ARXA 1J4RA 4URIA 1PINA 1PBKA 3WQWA 3O5GA 1Q6UA 3IKDA 2LKNA 5B8IC 1ZK6A 4DT4A 4LAWA 1E6ZA 4WJXA 2MLXA 3B9EA 3ARVA 3FXYA 5HW6A 2VCDA 2YBUA 3PRAA 3PRDA 1P5QA 1NWRA 2PPPA 3JYJA 1YATA 2WK2A 3PA7A 1X6LA 4JFLA 1E44A 1ZBCA 4IT6A 4DROA 3ARRA 3I6CA 4ODOA 1LG1A 4WKFA 2A3AA 3ARSA 5BXJA 3B9AA 4ODKA 1JNTA 4NSBA 5GPGA 3PR9A 2PI6A 2B31A 1ROTA 4NNRA 4LAYA 1K9TA 4S3KA 1NWTA 4UDMA 3O5LA 3TC5A 2PN0A 2Q5AA 4IT4A 2WLZA 1W9UA 1EIBA 3ALGA 3B8SA 4P8XA 3NRKA 2JZVA 3AS0A 3CHEA 3CH9A 2WLYA 3RM8A 4P8UA 1FKJA 4W9OA 4HBEA 3O5MA 1H0GA 3G6LA 3WL0A 4ODLA 1H0IA 2ZQSA 4JFIA 2MNTA 4MNMA 3AS2A 4DRJA 1FKIA 1NWUA 4DIPA 1GOIA 4R5EA 3ARTA 4O2TA 1D7HA 1J4IA 2PPNA 3GPKA 4TW6A 3PRBA 3KACA 3O5QA 3UQBA 3KAHA 3AS1A 3O5JA 1W1YA 1FKBA 1NWSA 3GU0A 5J6EA 2ZR4A 2RUDA 4W9PA 4Z2KA 3ARQA 3NTPA 4S3JA 1FKRA 2IUZA 1OWQA 2KR7A 2O92A 3UF8A 4DH0A 1ROUA 3CHCA 1HKIA 2DG4A 3KAGA 1E6RA 2QF8A 4GIVA 4IPXA 1Y0OA 1EHNA 1QPFA 2DG9A 5DF0A 2IF4A 4DZ3A 2XP9A 1HJVA 3BXWA 2FKEA 4MAVA 2MF9A 2XP4A 4QT2A 3TCZA 4G2PA 2N87A 3B9DA 1FKSA 4J4OA 4ZPWR 1T11A 2RUQA 2ZQTA 3O5RA 1D2KA 3WQVA 4AY1A 3WIJA 2G41A 3W4RA 2A3CA 3WH0A 4G50A 1E15A 5I98A 2L2SA 1WNOA 1EYMA 5HKGA 2RSEA 2DSUA 4QIBA 1UR8A 5DO2A 2A3BA 4TX0A 4WKAA 3RMEA 2F2DA 1FKHA 2ZR6A 1SYTA 2RUCA 2D9FA 2PV2A 1HKMA 2Y78A 4L72B 2M2AA 3CGNA 1FFRA 4LAXA 1N1AA 3H9RB 2LPVA 1W9PA 3AROA 2ZR5A 3TDBA 1QZ2A 3KABA 4Q7NA 4TNSA 2WM0A 2LJ4A 4P8VA 5GPRA 5GQBA 1NMWA 1FKDA 1W26A 3WL1A 4DRIA 4Q22A 1NH6A 1E9LA 4QZVB 3AQUA 2FDMA 4Z2LA 3UI6A 4U84A 1FFQA 1HKJA 1Q6HA 4GGQA 1D7JA 3ARZA 1LL7A 4MNJA 1FKLA 2M08A 3WD1A 1HJWA 1LL4A 1ZU8A 3KCEA 4MNKA 1FKFA 1ITXA 4MTVA 1WAWA 1F8AB 3IK8A 1GUVA 3CHFA 3IHZA 1W1PA 3O5EA 1J6YA 1EDQA 2KFWA 4TYOA 3KAFA 4Z2HA 1ZB5A 3UQIA 1TCOC 2UZ5A 4Z2GA 3KADA 1ZL1A 4U85A 2XP7A 4MSPA 5HTGA 1B6CA 3FY1A 4DRMA 1ZBVA 1CTNA 4IQ2A 4R0XA 2LGOA 2KO7A 1WB0A 3LUOA 4ODRA 4BF8A 2XP5A 1XRVA 3ALFA 3EY6A 1FKGA 1O6IA 1ZBWA 3QOKA 4J4NA 5DIUA 1LG2A 2DG3A 4DRPA 3RM9A 3ARWA 1RD6A 1L1PA 3NI6A 2DSZA 2MLZA 3EIPA 1U79A 1X6NA 4DWSA 4XAKA 3ARUA 4ODNA 5HW7A 4JFMA 5HT1A 1YW5A 4MPKA 3O5IA 3UI4A 1Q1CA 1HJXA 3GTYX 4ZS6A
chains in the Genus database with same CATH topology
3WD2A 2K8IA 1JNSA 4DZ2A 2MLYA 3UI5A 1JVWA 4HBOA 1GPFA 4ODQA 4TW8A 2KI3A 3O5PA 4W5UA 2OFNA 2KE0A 5HWBA 4TW7A 3CZ8A 1Q6IA 1M5YA 1SR0A 2XPAA 3WD0A 3CGMA 5DEZA 4DRHA 4ML4A 3O5FA 2OLHA 3VAWA 1E6NA 4ODMA 3WD4A 4KQZA 1FKKA 4DWSC 1KFWA 1FKTA 1LL6A 2VN1A 2ZQVA 1QPLA 5D75A 3WD3A 1W9VA 1XHGA 5JH8A 1UR9A 2AOSA 2DT1A 5HBFA 1FAPA 1LQ0A 1VF8A 2AWGA 1KT1A 1OGGA 4MGVA 1KT0A 1EQ3A 4LGXA 4DWSB 4DWSD 4JYSA 1ZBKA 1D6OA 2PBCA 4JFKA 2XP8A 5HUAA 2PPOA 4DRQA 1C9HA 2F21A 4FN2A 4DRKA 4DRNA 3O5KA 4MNLA 2KGJA 4C02B 1FJDA 4LAVA 2RURA 3CHDA 3OOBA 4PTMA 1E6PA 4ZPTR 3RGCA 3KZ7A 2DSWA 2XP3A 3JYMA 1R9HA 3O5DA 5HW8A 3RM4A 1D7IA 1JNEA 4HARA 2ITKA 4WK9A 4W9QA 3RFWA 3IKGA 2DT0A 3ARYA 1W1VA 1A7XA 2XPBA 2XP6A 4JFJA 1LJYA 2DT3A 4ZPVR 2ZQUA 3JXVA 3UQAA 2PV3A 4FAPA 1HKKA 2DSVA 4WKHA 1OGBA 2F4EA 3G6MA 2PV1A 4QT3A 2RQSA 4KR0B 2MPHA 2O9OA 4L3NA 3WKZA 4WIWA 1JNDA 1FD9A 4Z2IA 1J4HA 1NMVA 1ZCNA 2DPEA 1NSGA 1HXVA 3B7XA 4P8WA 4ODPA 3MDYB 5DITA 3O5OA 1BKFA 3OA5A 2M1IA 1W1TA 2DT2A 3ARPA 2FAPA 2YBTA 4U86A 4IQCA 1IX5A 4Z2JA 2ESCA 4N19A 2G8ZA 3FAPA 3AS3A 5DIVA 1BL4A 1F40A 4NZCA 1TFVA 2A3EA 5HWCA 3ODKA 4ITZA 3KAIA 3ARXA 1J4RA 4URIA 1PINA 1PBKA 3WQWA 3O5GA 1Q6UA 3IKDA 2LKNA 5B8IC 1ZK6A 4DT4A 4LAWA 1E6ZA 4WJXA 2MLXA 3B9EA 3ARVA 3FXYA 5HW6A 2VCDA 2YBUA 3PRAA 3PRDA 1P5QA 1NWRA 2PPPA 3JYJA 1YATA 2WK2A 3PA7A 1X6LA 4JFLA 1ZBCA 4IT6A 4DROA 3ARRA 3I6CA 4ODOA 1LG1A 4WKFA 2A3AA 3ARSA 5BXJA 3B9AA 4ODKA 1JNTA 4NSBA 5GPGA 3PR9A 2PI6A 2B31A 1ROTA 4NNRA 4LAYA 1K9TA 4S3KA 1NWTA 3O5LA 3TC5A 2Q5AA 4IT4A 2WLZA 1W9UA 1EIBA 3ALGA 3B8SA 4P8XA 3NRKA 2JZVA 3AS0A 3CHEA 3CH9A 2WLYA 3RM8A 4P8UA 1FKJA 4W9OA 4HBEA 3O5MA 1H0GA 3G6LA 3WL0A 4ODLA 1H0IA 2ZQSA 4JFIA 2MNTA 4MNMA 3AS2A 4DRJA 1FKIA 1NWUA 4DIPA 1GOIA 4R5EA 3ARTA 4O2TA 1D7HA 1J4IA 2PPNA 3GPKA 4TW6A 3PRBA 3KACA 3O5QA 3UQBA 3KAHA 3AS1A 3O5JA 1W1YA 1FKBA 1NWSA 5J6EA 2ZR4A 2RUDA 4W9PA 4Z2KA 3ARQA 3NTPA 4S3JA 1FKRA 2IUZA 1OWQA 2KR7A 2O92A 3UF8A 4DH0A 1ROUA 3CHCA 1HKIA 2DG4A 3KAGA 1E6RA 2QF8A 4GIVA 4IPXA 1Y0OA 1EHNA 1QPFA 2DG9A 5DF0A 2IF4A 4DZ3A 2XP9A 1HJVA 3BXWA 2FKEA 4MAVA 2MF9A 2XP4A 4QT2A 3TCZA 4G2PA 2N87A 3B9DA 1FKSA 4J4OA 4ZPWR 1T11A 2RUQA 2ZQTA 3O5RA 1D2KA 3WQVA 4AY1A 3WIJA 2G41A 3W4RA 2A3CA 3WH0A 4G50A 1E15A 5I98A 2L2SA 1WNOA 1EYMA 5HKGA 2RSEA 2DSUA 4QIBA 1UR8A 5DO2A 2A3BA 4TX0A 4WKAA 3RMEA 2F2DA 1FKHA 2ZR6A 1SYTA 2RUCA 2D9FA 2PV2A 1HKMA 2Y78A 4L72B 2M2AA 3CGNA 1FFRA 4LAXA 1N1AA 3H9RB 2LPVA 1W9PA 3AROA 2ZR5A 3TDBA 1QZ2A 3KABA 4Q7NA 4TNSA 2WM0A 2LJ4A 4P8VA 5GPRA 5GQBA 1NMWA 1FKDA 1W26A 3WL1A 4DRIA 4Q22A 1NH6A 1E9LA 4QZVB 3AQUA 2FDMA 4Z2LA 3UI6A 4U84A 1FFQA 1HKJA 1Q6HA 4GGQA 1D7JA 3ARZA 1LL7A 4MNJA 1FKLA 2M08A 3WD1A 1HJWA 1LL4A 1ZU8A 3KCEA 4MNKA 1FKFA 1ITXA 4MTVA 1WAWA 1F8AB 3IK8A 1GUVA 3CHFA 3IHZA 1W1PA 3O5EA 1J6YA 1EDQA 2KFWA 4TYOA 3KAFA 4Z2HA 1ZB5A 3UQIA 1TCOC 2UZ5A 4Z2GA 3KADA 1ZL1A 4U85A 2XP7A 4MSPA 5HTGA 1B6CA 3FY1A 4DRMA 1ZBVA 1CTNA 4IQ2A 4R0XA 2LGOA 2KO7A 1WB0A 3LUOA 4ODRA 4BF8A 2XP5A 1XRVA 3ALFA 3EY6A 1FKGA 1O6IA 1ZBWA 3QOKA 4J4NA 5DIUA 1LG2A 2DG3A 4DRPA 3RM9A 3ARWA 1RD6A 1L1PA 3NI6A 2DSZA 2MLZA 1U79A 1X6NA 4DWSA 4XAKA 3ARUA 4ODNA 5HW7A 4JFMA 5HT1A 1YW5A 4MPKA 3O5IA 3UI4A 1Q1CA 1HJXA 4ZS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8I A;  2PV1 A;  4QT3 A;  2RQS A;  2ZQS A;  4JFI A;  4DZ2 A;  2MNT A;  2MPH A;  1JNS A;  2MLY A;  3UI5 A;  1NMW A;  1FKD A;  1W26 A;  4DRI A;  1JVW A;  4ODQ A;  4TW8 A;  2KI3 A;  3O5P A;  4DRJ A;  1FD9 A;  1FKI A;  2OFN A;  2KE0 A;  4DIP A;  5HWB A;  1F40 A;  1J4H A;  1NMV A;  1ZCN A;  3UI6 A;  4O2T A;  4U84 A;  4TW7 A;  1Q6H A;  4GGQ A;  1D7J A;  1NSG A;  1Q6I A;  1HXV A;  1D7H A;  1J4I A;  1M5Y A;  3B7X A;  1FKL A;  2M08 A;  2PPN A;  3GPK A;  4ODP A;  3MDY B;  2XPA A;  3PRB A;  3KAC A;  4TW6 A;  5DIT A;  3O5O A;  3KCE A;  3CGM A;  1BKF A;  4DRH A;  2M1I A;  3O5F A;  2FAP A;  3VAW A;  3O5Q A;  3UQB A;  1FKF A;  3KAH A;  4ODM A;  3O5J A;  4U86 A;  4IQC A;  1FKK A;  1F8A B;  1FKB A;  3IK8 A;  1FKT A;  4N19 A;  3FAP A;  5DIV A;  1BL4 A;  2VN1 A;  2ZR4 A;  1QPL A;  2RUD A;  2ZQV A;  3IHZ A;  4W9P A;  5D75 A;  3O5E A;  3ODK A;  5HWC A;  4ITZ A;  3KAI A;  1J6Y A;  3NTP A;  2KFW A;  4TYO A;  1FAP A;  1J4R A;  3KAF A;  1PIN A;  1PBK A;  1FKR A;  3O5G A;  1Q6U A;  2KR7 A;  3IKD A;  2AWG A;  3UF8 A;  1TCO C;  1KT1 A;  2UZ5 A;  3UQI A;  2LKN A;  1ROU A;  4DH0 A;  4MGV A;  3KAD A;  5B8I C;  1KT0 A;  1ZK6 A;  2DG4 A;  4DT4 A;  4LAW A;  1EQ3 A;  3KAG A;  4GIV A;  4IPX A;  4U85 A;  2MLX A;  5HW6 A;  1Y0O A;  2VCD A;  2XP7 A;  1QPF A;  3PRD A;  2DG9 A;  4JYS A;  1P5Q A;  2IF4 A;  4DZ3 A;  4MSP A;  1D6O A;  2XP9 A;  2PBC A;  5HTG A;  1B6C A;  2FKE A;  2PPP A;  3JYJ A;  1YAT A;  4JFK A;  4DRM A;  2MF9 A;  3PA7 A;  4JFL A;  2XP4 A;  2XP8 A;  4QT2 A;  3TCZ A;  2PPO A;  4DRQ A;  4IQ2 A;  4R0X A;  4DRO A;  5HUA A;  2LGO A;  4G2P A;  1C9H A;  2KO7 A;  2F21 A;  2N87 A;  3LUO A;  4FN2 A;  4DRK A;  4DRN A;  1FKS A;  4ODR A;  4BF8 A;  3I6C A;  4J4O A;  4ODO A;  1T11 A;  3O5K A;  2RUQ A;  2ZQT A;  3O5R A;  2KGJ A;  4C02 B;  1FJD A;  4LAV A;  2XP5 A;  5BXJ A;  2RUR A;  3EY6 A;  1FKG A;  3OOB A;  4ODK A;  1JNT A;  5GPG A;  3RGC A;  3KZ7 A;  1ROT A;  2XP3 A;  4NNR A;  3JYM A;  1R9H A;  3O5D A;  3WH0 A;  4G50 A;  4LAY A;  5HW8 A;  5DIU A;  4J4N A;  1D7I A;  5I98 A;  2L2S A;  2ITK A;  3O5L A;  2DG3 A;  1EYM A;  4DRP A;  5HKG A;  3TC5 A;  2RSE A;  4W9Q A;  3RFW A;  2Q5A A;  3IKG A;  4QIB A;  4TX0 A;  1A7X A;  1L1P A;  2F2D A;  2XP6 A;  2XPB A;  1FKH A;  3NI6 A;  3NRK A;  2ZR6 A;  2MLZ A;  2JZV A;  2RUC A;  2D9F A;  4JFJ A;  1U79 A;  2PV2 A;  2Y78 A;  5J6E A;  4ODN A;  2M2A A;  3CGN A;  4JFM A;  2ZQU A;  5HW7 A;  3JXV A;  4LAX A;  5HT1 A;  1YW5 A;  3UQA A;  1FKJ A;  1N1A A;  2LPV A;  3H9R B;  3O5I A;  4W9O A;  2PV3 A;  2ZR5 A;  3O5M A;  1QZ2 A;  3KAB A;  3TDB A;  3UI4 A;  1Q1C A;  4FAP A;  4TNS A;  2LJ4 A;  4ODL A;  2F4E A; 
#chains in the Genus database with same CATH topology
 3WD2 A;  2K8I A;  1JNS A;  4DZ2 A;  2MLY A;  3UI5 A;  1JVW A;  4HBO A;  1GPF A;  4ODQ A;  4TW8 A;  2KI3 A;  3O5P A;  2ETN A;  4W5U A;  2OFN A;  2KE0 A;  5HWB A;  4TW7 A;  3CZ8 A;  2EUL A;  1Q6I A;  1M5Y A;  1SR0 A;  2XPA A;  3WD0 A;  3CGM A;  5DEZ A;  4DRH A;  4ML4 A;  3O5F A;  2OLH A;  3VAW A;  1E6N A;  4ODM A;  3WD4 A;  4KQZ A;  1FKK A;  4DWS C;  1KFW A;  1FKT A;  1LL6 A;  2VN1 A;  2ZQV A;  1QPL A;  5D75 A;  3WD3 A;  1W9V A;  1XHG A;  5JH8 A;  1UR9 A;  2AOS A;  2DT1 A;  5HBF A;  1FAP A;  1LQ0 A;  1VF8 A;  2AWG A;  1KT1 A;  1OGG A;  4MGV A;  1KT0 A;  1EQ3 A;  4LGX A;  4DWS B;  4DWS D;  4JYS A;  1ZBK A;  1D6O A;  2PBC A;  4JFK A;  2XP8 A;  5HUA A;  2PPO A;  4DRQ A;  1C9H A;  2F21 A;  4FN2 A;  4DRK A;  4DRN A;  2P4V A;  3O5K A;  4MNL A;  2KGJ A;  4C02 B;  1FJD A;  4LAV A;  2RUR A;  3CHD A;  3OOB A;  4PTM A;  1E6P A;  4ZPT R;  3RGC A;  3KZ7 A;  2DSW A;  2XP3 A;  3JYM A;  1R9H A;  2F23 A;  3O5D A;  5HW8 A;  3BMB A;  1D7I A;  2B5U B;  3RM4 A;  1JNE A;  4HAR A;  2ITK A;  4WK9 A;  4W9Q A;  3RFW A;  3IKG A;  2DT0 A;  3ARY A;  1W1V A;  1A7X A;  2XPB A;  2XP6 A;  4JFJ A;  1JCH B;  1LJY A;  2DT3 A;  4ZPV R;  2ZQU A;  3JXV A;  3UQA A;  2PV3 A;  4FAP A;  1HKK A;  2DSV A;  4WKH A;  1OGB A;  2F4E A;  3G6M A;  2PV1 A;  4QT3 A;  2RQS A;  4KR0 B;  2MPH A;  2O9O A;  4L3N A;  3WKZ A;  4WIW A;  1JND A;  1FD9 A;  4Z2I A;  1J4H A;  1NMV A;  1ZCN A;  2DPE A;  1GRJ A;  1NSG A;  1HXV A;  3B7X A;  4P8W A;  4ODP A;  3MDY B;  5DIT A;  3O5O A;  1BKF A;  3OA5 A;  2M1I A;  1W1T A;  2DT2 A;  3ARP A;  2FAP A;  2YBT A;  4U86 A;  4IQC A;  1IX5 A;  4Z2J A;  2ESC A;  4N19 A;  2G8Z A;  3FAP A;  3AS3 A;  5DIV A;  1BL4 A;  1F40 A;  4NZC A;  1TFV A;  2A3E A;  5HWC A;  3ODK A;  4ITZ A;  3KAI A;  3ARX A;  1J4R A;  4URI A;  1PIN A;  1PBK A;  3WQW A;  3O5G A;  1Q6U A;  3IKD A;  2LKN A;  5B8I C;  1ZK6 A;  4DT4 A;  4LAW A;  1E6Z A;  4WJX A;  2MLX A;  3B9E A;  3ARV A;  3FXY A;  5HW6 A;  2VCD A;  2YBU A;  3PRA A;  3PRD A;  1P5Q A;  1NWR A;  2PPP A;  3JYJ A;  1YAT A;  2WK2 A;  3PA7 A;  1X6L A;  4JFL A;  1E44 A;  1ZBC A;  4IT6 A;  4DRO A;  3ARR A;  3I6C A;  4ODO A;  1LG1 A;  4WKF A;  2A3A A;  3ARS A;  5BXJ A;  3B9A A;  4ODK A;  1JNT A;  4NSB A;  5GPG A;  3PR9 A;  2PI6 A;  2B31 A;  1ROT A;  4NNR A;  4LAY A;  1K9T A;  4S3K A;  1NWT A;  4UDM A;  3O5L A;  3TC5 A;  2PN0 A;  2Q5A A;  4IT4 A;  2WLZ A;  1W9U A;  1EIB A;  3ALG A;  3B8S A;  4P8X A;  3NRK A;  2JZV A;  3AS0 A;  3CHE A;  3CH9 A;  2WLY A;  3RM8 A;  4P8U A;  1FKJ A;  4W9O A;  4HBE A;  3O5M A;  1H0G A;  3G6L A;  3WL0 A;  4ODL A;  1H0I A;  2ZQS A;  4JFI A;  2MNT A;  4MNM A;  3AS2 A;  4DRJ A;  1FKI A;  1NWU A;  4DIP A;  1GOI A;  4R5E A;  3ART A;  4O2T A;  1D7H A;  1J4I A;  2PPN A;  3GPK A;  4TW6 A;  3PRB A;  3KAC A;  3O5Q A;  3UQB A;  3KAH A;  3AS1 A;  3O5J A;  1W1Y A;  1FKB A;  1NWS A;  3GU0 A;  5J6E A;  2ZR4 A;  2RUD A;  4W9P A;  4Z2K A;  3ARQ A;  3NTP A;  4S3J A;  1FKR A;  2IUZ A;  1OWQ A;  2KR7 A;  2O92 A;  3UF8 A;  4DH0 A;  1ROU A;  3CHC A;  1HKI A;  2DG4 A;  3KAG A;  1E6R A;  2QF8 A;  4GIV A;  4IPX A;  1Y0O A;  1EHN A;  1QPF A;  2DG9 A;  5DF0 A;  2IF4 A;  4DZ3 A;  2XP9 A;  1HJV A;  3BXW A;  2FKE A;  4MAV A;  2MF9 A;  2XP4 A;  4QT2 A;  3TCZ A;  4G2P A;  2N87 A;  3B9D A;  1FKS A;  4J4O A;  4ZPW R;  1T11 A;  2RUQ A;  2ZQT A;  3O5R A;  1D2K A;  3WQV A;  4AY1 A;  3WIJ A;  2G41 A;  3W4R A;  2A3C A;  3WH0 A;  4G50 A;  1E15 A;  5I98 A;  2L2S A;  1WNO A;  1EYM A;  5HKG A;  2RSE A;  2DSU A;  4QIB A;  1UR8 A;  5DO2 A;  2A3B A;  4TX0 A;  4WKA A;  3RME A;  2F2D A;  1FKH A;  2ZR6 A;  1SYT A;  2RUC A;  2D9F A;  2PV2 A;  1HKM A;  2Y78 A;  4L72 B;  2M2A A;  3CGN A;  1FFR A;  4LAX A;  1N1A A;  3H9R B;  2LPV A;  1W9P A;  3ARO A;  2ZR5 A;  3TDB A;  1QZ2 A;  3KAB A;  4Q7N A;  4TNS A;  2WM0 A;  2LJ4 A;  4P8V A;  5GPR A;  5GQB A;  1NMW A;  1FKD A;  1W26 A;  3WL1 A;  4DRI A;  4Q22 A;  1NH6 A;  1E9L A;  4QZV B;  3AQU A;  2FDM A;  4Z2L A;  3UI6 A;  4U84 A;  1FFQ A;  1HKJ A;  1Q6H A;  4GGQ A;  1D7J A;  3ARZ A;  1LL7 A;  4MNJ A;  1FKL A;  2M08 A;  3WD1 A;  1HJW A;  1LL4 A;  1ZU8 A;  3KCE A;  4MNK A;  1FKF A;  1ITX A;  4MTV A;  1WAW A;  1F8A B;  3IK8 A;  1GUV A;  3CHF A;  3IHZ A;  1W1P A;  3O5E A;  1J6Y A;  1EDQ A;  2KFW A;  4TYO A;  3KAF A;  4Z2H A;  1ZB5 A;  3UQI A;  1TCO C;  2UZ5 A;  4Z2G A;  3KAD A;  1ZL1 A;  4U85 A;  2XP7 A;  4MSP A;  5HTG A;  1B6C A;  3FY1 A;  4DRM A;  1ZBV A;  1CTN A;  4IQ2 A;  4R0X A;  2LGO A;  2KO7 A;  1WB0 A;  3LUO A;  4ODR A;  4BF8 A;  2XP5 A;  1XRV A;  3ALF A;  3EY6 A;  1FKG A;  1O6I A;  1ZBW A;  3QOK A;  4J4N A;  5DIU A;  1LG2 A;  2DG3 A;  4DRP A;  3RM9 A;  3ARW A;  1RD6 A;  1L1P A;  3NI6 A;  2DSZ A;  2MLZ A;  3EIP A;  1U79 A;  1X6N A;  4DWS A;  4XAK A;  3ARU A;  4ODN A;  5HW7 A;  4JFM A;  5HT1 A;  1YW5 A;  4MPK A;  3O5I A;  3UI4 A;  1Q1C A;  1HJX A;  3GTY X;  4ZS6 A; 
#chains in the Genus database with same CATH homology
 3WD2 A;  2K8I A;  1JNS A;  4DZ2 A;  2MLY A;  3UI5 A;  1JVW A;  4HBO A;  1GPF A;  4ODQ A;  4TW8 A;  2KI3 A;  3O5P A;  4W5U A;  2OFN A;  2KE0 A;  5HWB A;  4TW7 A;  3CZ8 A;  1Q6I A;  1M5Y A;  1SR0 A;  2XPA A;  3WD0 A;  3CGM A;  5DEZ A;  4DRH A;  4ML4 A;  3O5F A;  2OLH A;  3VAW A;  1E6N A;  4ODM A;  3WD4 A;  4KQZ A;  1FKK A;  4DWS C;  1KFW A;  1FKT A;  1LL6 A;  2VN1 A;  2ZQV A;  1QPL A;  5D75 A;  3WD3 A;  1W9V A;  1XHG A;  5JH8 A;  1UR9 A;  2AOS A;  2DT1 A;  5HBF A;  1FAP A;  1LQ0 A;  1VF8 A;  2AWG A;  1KT1 A;  1OGG A;  4MGV A;  1KT0 A;  1EQ3 A;  4LGX A;  4DWS B;  4DWS D;  4JYS A;  1ZBK A;  1D6O A;  2PBC A;  4JFK A;  2XP8 A;  5HUA A;  2PPO A;  4DRQ A;  1C9H A;  2F21 A;  4FN2 A;  4DRK A;  4DRN A;  3O5K A;  4MNL A;  2KGJ A;  4C02 B;  1FJD A;  4LAV A;  2RUR A;  3CHD A;  3OOB A;  4PTM A;  1E6P A;  4ZPT R;  3RGC A;  3KZ7 A;  2DSW A;  2XP3 A;  3JYM A;  1R9H A;  3O5D A;  5HW8 A;  3RM4 A;  1D7I A;  1JNE A;  4HAR A;  2ITK A;  4WK9 A;  4W9Q A;  3RFW A;  3IKG A;  2DT0 A;  3ARY A;  1W1V A;  1A7X A;  2XPB A;  2XP6 A;  4JFJ A;  1LJY A;  2DT3 A;  4ZPV R;  2ZQU A;  3JXV A;  3UQA A;  2PV3 A;  4FAP A;  1HKK A;  2DSV A;  4WKH A;  1OGB A;  2F4E A;  3G6M A;  2PV1 A;  4QT3 A;  2RQS A;  4KR0 B;  2MPH A;  2O9O A;  4L3N A;  3WKZ A;  4WIW A;  1JND A;  1FD9 A;  4Z2I A;  1J4H A;  1NMV A;  1ZCN A;  2DPE A;  1NSG A;  1HXV A;  3B7X A;  4P8W A;  4ODP A;  3MDY B;  5DIT A;  3O5O A;  1BKF A;  3OA5 A;  2M1I A;  1W1T A;  2DT2 A;  3ARP A;  2FAP A;  2YBT A;  4U86 A;  4IQC A;  1IX5 A;  4Z2J A;  2ESC A;  4N19 A;  2G8Z A;  3FAP A;  3AS3 A;  5DIV A;  1BL4 A;  1F40 A;  4NZC A;  1TFV A;  2A3E A;  5HWC A;  3ODK A;  4ITZ A;  3KAI A;  3ARX A;  1J4R A;  4URI A;  1PIN A;  1PBK A;  3WQW A;  3O5G A;  1Q6U A;  3IKD A;  2LKN A;  5B8I C;  1ZK6 A;  4DT4 A;  4LAW A;  1E6Z A;  4WJX A;  2MLX A;  3B9E A;  3ARV A;  3FXY A;  5HW6 A;  2VCD A;  2YBU A;  3PRA A;  3PRD A;  1P5Q A;  1NWR A;  2PPP A;  3JYJ A;  1YAT A;  2WK2 A;  3PA7 A;  1X6L A;  4JFL A;  1ZBC A;  4IT6 A;  4DRO A;  3ARR A;  3I6C A;  4ODO A;  1LG1 A;  4WKF A;  2A3A A;  3ARS A;  5BXJ A;  3B9A A;  4ODK A;  1JNT A;  4NSB A;  5GPG A;  3PR9 A;  2PI6 A;  2B31 A;  1ROT A;  4NNR A;  4LAY A;  1K9T A;  4S3K A;  1NWT A;  3O5L A;  3TC5 A;  2Q5A A;  4IT4 A;  2WLZ A;  1W9U A;  1EIB A;  3ALG A;  3B8S A;  4P8X A;  3NRK A;  2JZV A;  3AS0 A;  3CHE A;  3CH9 A;  2WLY A;  3RM8 A;  4P8U A;  1FKJ A;  4W9O A;  4HBE A;  3O5M A;  1H0G A;  3G6L A;  3WL0 A;  4ODL A;  1H0I A;  2ZQS A;  4JFI A;  2MNT A;  4MNM A;  3AS2 A;  4DRJ A;  1FKI A;  1NWU A;  4DIP A;  1GOI A;  4R5E A;  3ART A;  4O2T A;  1D7H A;  1J4I A;  2PPN A;  3GPK A;  4TW6 A;  3PRB A;  3KAC A;  3O5Q A;  3UQB A;  3KAH A;  3AS1 A;  3O5J A;  1W1Y A;  1FKB A;  1NWS A;  5J6E A;  2ZR4 A;  2RUD A;  4W9P A;  4Z2K A;  3ARQ A;  3NTP A;  4S3J A;  1FKR A;  2IUZ A;  1OWQ A;  2KR7 A;  2O92 A;  3UF8 A;  4DH0 A;  1ROU A;  3CHC A;  1HKI A;  2DG4 A;  3KAG A;  1E6R A;  2QF8 A;  4GIV A;  4IPX A;  1Y0O A;  1EHN A;  1QPF A;  2DG9 A;  5DF0 A;  2IF4 A;  4DZ3 A;  2XP9 A;  1HJV A;  3BXW A;  2FKE A;  4MAV A;  2MF9 A;  2XP4 A;  4QT2 A;  3TCZ A;  4G2P A;  2N87 A;  3B9D A;  1FKS A;  4J4O A;  4ZPW R;  1T11 A;  2RUQ A;  2ZQT A;  3O5R A;  1D2K A;  3WQV A;  4AY1 A;  3WIJ A;  2G41 A;  3W4R A;  2A3C A;  3WH0 A;  4G50 A;  1E15 A;  5I98 A;  2L2S A;  1WNO A;  1EYM A;  5HKG A;  2RSE A;  2DSU A;  4QIB A;  1UR8 A;  5DO2 A;  2A3B A;  4TX0 A;  4WKA A;  3RME A;  2F2D A;  1FKH A;  2ZR6 A;  1SYT A;  2RUC A;  2D9F A;  2PV2 A;  1HKM A;  2Y78 A;  4L72 B;  2M2A A;  3CGN A;  1FFR A;  4LAX A;  1N1A A;  3H9R B;  2LPV A;  1W9P A;  3ARO A;  2ZR5 A;  3TDB A;  1QZ2 A;  3KAB A;  4Q7N A;  4TNS A;  2WM0 A;  2LJ4 A;  4P8V A;  5GPR A;  5GQB A;  1NMW A;  1FKD A;  1W26 A;  3WL1 A;  4DRI A;  4Q22 A;  1NH6 A;  1E9L A;  4QZV B;  3AQU A;  2FDM A;  4Z2L A;  3UI6 A;  4U84 A;  1FFQ A;  1HKJ A;  1Q6H A;  4GGQ A;  1D7J A;  3ARZ A;  1LL7 A;  4MNJ A;  1FKL A;  2M08 A;  3WD1 A;  1HJW A;  1LL4 A;  1ZU8 A;  3KCE A;  4MNK A;  1FKF A;  1ITX A;  4MTV A;  1WAW A;  1F8A B;  3IK8 A;  1GUV A;  3CHF A;  3IHZ A;  1W1P A;  3O5E A;  1J6Y A;  1EDQ A;  2KFW A;  4TYO A;  3KAF A;  4Z2H A;  1ZB5 A;  3UQI A;  1TCO C;  2UZ5 A;  4Z2G A;  3KAD A;  1ZL1 A;  4U85 A;  2XP7 A;  4MSP A;  5HTG A;  1B6C A;  3FY1 A;  4DRM A;  1ZBV A;  1CTN A;  4IQ2 A;  4R0X A;  2LGO A;  2KO7 A;  1WB0 A;  3LUO A;  4ODR A;  4BF8 A;  2XP5 A;  1XRV A;  3ALF A;  3EY6 A;  1FKG A;  1O6I A;  1ZBW A;  3QOK A;  4J4N A;  5DIU A;  1LG2 A;  2DG3 A;  4DRP A;  3RM9 A;  3ARW A;  1RD6 A;  1L1P A;  3NI6 A;  2DSZ A;  2MLZ A;  1U79 A;  1X6N A;  4DWS A;  4XAK A;  3ARU A;  4ODN A;  5HW7 A;  4JFM A;  5HT1 A;  1YW5 A;  4MPK A;  3O5I A;  3UI4 A;  1Q1C A;  1HJX A;  4ZS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...