3CGMA

Crystal structure of thermophilic slyd
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
157
structure length
157
Chain Sequence
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title Crystal Structure Determination and Functional Characterization of the Metallochaperone SlyD from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
total genus 35
structure length 157
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3cgmA00
5HWBA 4JYSA 4W9OA 4U86A 3WH0A 2RURA 1Y0OA 4N19A 4JFMA 4DH0A 4TW7A 1J6YA 1FKTA 2FKEA 3IKDA 3PRDA 4DRMA 4ITZA 3JYJA 4ODOA 5DIUA 3UQAA 1NMWA 2M2AA 2PPOA 2VN1A 3NRKA 3O5FA 1Q6IA 1HXVA 3O5RA 3UI5A 1QPFA 2ZR4A 3B7XA 2RSEA 1NMVA 1KT0A 3KAHA 3KCEA 1M5YA 1J4HA 3RFWA 2RQSA 2PPPA 3TDBA 1Q6UA 4G50A 4R0XA 2KR7A 5HT1A 4C02B 4W9PA 2M1IA 4IPXA 2OFNA 5BXJA 4DRPA 1QZ2A 4DIPA 1Q1CA 4DZ2A 1JNSA 1FKRA 4BF8A 1JNTA 4QT2A 1ZK6A 2PPNA 3KAFA 1FKFA 4JFLA 2XPAA 2MLYA 4JFKA 2F2DA 1D6OA 1FKSA 2UZ5A 3TC5A 2PBCA 2PV2A 1J4IA 5HWCA 2XP5A 3JYMA 3TCZA 2ZR6A 5HW6A 2KFWA 2AWGA 4DZ3A 4QT3A 4DRKA 2Y78A 4GIVA 2N87A 3O5OA 1ZCNA 2F4EA 2PV1A 2DG9A 1FKGA 2KO7A 4MSPA 2DG3A 1QPLA 2ZQVA 2XP3A 3O5DA 4ODQA 5D75A 2LPVA 4U85A 2XP8A 5HW7A 4DRQA 3IK8A 1A7XA 2FAPA 2MPHA 2XPBA 3NTPA 5HW8A 1L1PA 4W9QA 5DIVA 1FKLA 1TCOC 3KADA 1BL4A 1BKFA 1Q6HA 2MNTA 3IHZA 5HUAA 2RUQA 1YW5A 2KI3A 1ROTA 3KAGA 1D7JA 2KGJA 3GPKA 4FAPA 1C9HA 2XP6A 3KZ7A 3CGMA 3NI6A 1ROUA 1T11A 3JXVA 4FN2A 4J4OA 4MGVA 4ODKA 3VAWA 2RUCA 4NNRA 4IQCA 4TX0A 5I98A 1FKBA 1W26A 5B8IC 2VCDA 2ZQUA 3LUOA 2LKNA 3KAIA 4DRIA 1KT1A 1YATA 2XP7A 5DITA 1R9HA 3I6CA 4J4NA 2ZQSA 2LGOA 1FKDA 1D7HA 3O5QA 4TNSA 4DRNA 2XP4A 1EQ3A 1P5QA 3CGNA 1JVWA 3MDYB 4QIBA 2DG4A 3O5EA 4DRHA 3RGCA 5J6EA 4LAVA 4ODMA 3O5MA 3FAPA 1FKIA 2L2SA 1PINA 2PV3A 1F40A 2ITKA 1FKJA 2RUDA 2XP9A 4G2PA 1N1AA 3UF8A 2JZVA 4DROA 3ODKA 3OOBA 3O5PA 4O2TA 1FKHA 1D7IA 4DRJA 1FJDA 3O5LA 3O5GA 3O5IA 2M08A 1NSGA 4JFIA 4ODPA 4TYOA 5HKGA 2ZR5A 4TW6A 1EYMA 3PA7A 4ODNA 3IKGA 4LAWA 4ODLA 3UI6A 2Q5AA 3O5KA 3UI4A 2MLZA 4IQ2A 3O5JA 1U79A 1F8AB 1J4RA 4GGQA 2K8IA 3KACA 2KE0A 3H9RB 2F21A 2IF4A 2MF9A 2LJ4A 4JFJA 3KABA 4LAYA 4U84A 1PBKA 2MLXA 5GPGA 3EY6A 4TW8A 3UQBA 4LAXA 3UQIA 1FAPA 5HTGA 3PRBA 4DT4A 1B6CA 4ODRA 1FD9A 2ZQTA 2D9FA 1FKKA
chains in the Genus database with same CATH superfamily
5JH8A 4U86A 1E6ZA 4MTVA 1W9PA 2DT3A 1WNOA 1LL6A 4ITZA 4Z2IA 3WL1A 4Z2KA 1EIBA 1E6NA 2RSEA 3KAHA 3KCEA 1KFWA 3AROA 2QF8A 2WM0A 1JNEA 2M1IA 4DRPA 4P8VA 4DZ2A 4P8XA 4BF8A 1JNTA 2MLYA 2F2DA 2UZ5A 3AQUA 5HWCA 2XP5A 2KFWA 4GIVA 1OGGA 2F4EA 2DG9A 1FKGA 4MSPA 1QPLA 4Q7NA 4Q22A 4KR0B 4DRQA 2FAPA 3B9AA 4NZCA 3EIPA 4W9QA 2MNTA 2YBTA 1YW5A 1ROTA 1D7JA 1C9HA 4MGVA 1T11A 4J4OA 3WD2A 2RUCA 4NNRA 4IQCA 5I98A 2ZQUA 3LUOA 2LKNA 3QOKA 1ITXA 1YATA 3I6CA 1XRVA 3O5QA 1E6PA 1W1PA 4QIBA 3O5EA 5DEZA 1UR8A 2IUZA 1OGBA 2ITKA 1W1TA 2JZVA 3ARTA 3OOBA 3O5PA 1HJXA 3RMEA 1RD6A 2M08A 3BXWA 4TYOA 2ZR5A 4TW6A 1EYMA 3PA7A 3O5KA 4IQ2A 1VF8A 4L72B 1HKMA 4GGQA 2PN0A 1EDQA 4S3JA 4ZPWR 1E44A 1HJVA 3RM8A 3W4RA 1PBKA 5GPGA 4DWSC 4WJXA 1B6CA 1FD9A 4AY1A 5HWBA 4W9OA 1Y0OA 3CHDA 4JFMA 3PRDA 4DRMA 3JYJA 4ODOA 3UQAA 1XHGA 3ARSA 3UI5A 3WQWA 1KT0A 1GRJA 2RQSA 4G50A 2KR7A 5HT1A 4W9PA 2OFNA 1QZ2A 1JNSA 1FKRA 3KAFA 4JFKA 3B8SA 4ML4A 1LG2A 1J4IA 4WIWA 4PTMA 1HKJA 2AWGA 4DZ3A 4QT3A 2Y78A 2N87A 1OWQA 2PV1A 2DG3A 4ODQA 4WKHA 5GQBA 2XP8A 3ARUA 5HW7A 1A7XA 1LL4A 5DIVA 1TCOC 3KADA 1NWUA 3KAGA 4FAPA 4MPKA 2XP6A 3KZ7A 3JXVA 4FN2A 4MNMA 5DO2A 3CZ8A 5B8IC 4IT4A 2OLHA 2ETNA 4P8UA 4DWSD 1UR9A 2YBUA 2DSWA 4WKAA 1FKDA 1D7HA 4DRNA 1O6IA 2PI6A 1FKIA 1PINA 2WLYA 1TFVA 1FKJA 2AOSA 2F23A 1N1AA 3ARVA 4O2TA 1W1YA 3ALFA 3O5LA 4ZPTR 1NSGA 1ZBWA 4W5UA 4R5EA 3UI4A 2FDMA 1H0IA 1U79A 1F8AB 2K8IA 2KE0A 2F21A 4DWSB 2IF4A 2MF9A 4JFJA 4LAYA 1JNDA 4U84A 3ARWA 2MLXA 1NWTA 2O92A 1E15A 4TW8A 4LAXA 1FAPA 3AS2A 3PRAA 2ZQTA 1GPFA 1FKKA 3O5IA 2A3BA 3WH0A 2RURA 3ARQA 3WD4A 3FXYA 4N19A 4DH0A 1J6YA 1H0GA 1FKTA 2FKEA 3RM9A 3WD1A 1HKKA 1NMWA 1HXVA 3O5FA 4IT6A 1Q6IA 3O5RA 2ZR4A 3B7XA 1NMVA 1ZL1A 1M5YA 3RFWA 2PPPA 1Q6UA 4R0XA 4C02B 5HBFA 4IPXA 5BXJA 4Z2JA 1ZU8A 1Q1CA 1JCHB 3CHFA 1ZK6A 4HARA 4QT2A 1FKFA 2WLZA 2O9OA 2B31A 2DSZA 1FKSA 2PV2A 3JYMA 2ZR6A 5HW6A 1ZCNA 2KO7A 5D75A 3GU0A 2XP3A 4U85A 3IK8A 2XPBA 2MPHA 5DF0A 1L1PA 4MNKA 3WIJA 1BL4A 2RUQA 3WQVA 1SYTA 4ODKA 1ZBVA 2G41A 4TX0A 1W26A 1GUVA 3CHEA 2VCDA 3KAIA 4DRIA 1FFRA 1KT1A 2XP7A 4J4NA 2XP4A 1EQ3A 1P5QA 4DRHA 1WAWA 3MDYB 2DG4A 3RGCA 3AS3A 1WB0A 4S3KA 2L2SA 2P4VA 2RUDA 1LL7A 2XP9A 3UF8A 4DROA 3CH9A 3ODKA 1FKHA 4DRJA 1FJDA 2WK2A 1E6RA 3O5GA 4Z2LA 5HKGA 3ARYA 3IKGA 4LAWA 4ODLA 2DSVA 1J4RA 3BMBA 1LJYA 3KABA 3EY6A 3GTYX 3UQBA 2B5UB 1HJWA 3PRBA 1W1VA 4Z2HA 4ODRA 2G8ZA 4JYSA 1FFQA 1ZB5A 4DWSA 4ZS6A 5GPRA 3G6MA 1ZBCA 4TW7A 3IKDA 5DIUA 2M2AA 2PPOA 2VN1A 3NRKA 1QPFA 4HBOA 1GOIA 4UDMA 4WK9A 1J4HA 3B9DA 3TDBA 3B9EA 1CTNA 1IX5A 1X6LA 3RM4A 4DIPA 2PPNA 4JFLA 3OA5A 2XPAA 2DT2A 2DT1A 1D6OA 3PR9A 4LGXA 3TC5A 2PBCA 4P8WA 1X6NA 1NWSA 3TCZA 4DRKA 4MNLA 1LQ0A 3O5OA 4QZVB 1HKIA 1NWRA 2ZQVA 3O5DA 1NH6A 3G6LA 2LPVA 3AS1A 5HW8A 3NTPA 1FKLA 1BKFA 3WL0A 1Q6HA 3IHZA 4KQZA 5HUAA 2KI3A 3ALGA 2KGJA 3GPKA 2DT0A 3CGMA 3NI6A 1ROUA 3VAWA 1E9LA 1FKBA 4MNJA 1K9TA 2EULA 4URIA 3FY1A 3WD0A 5DITA 1R9HA 2ZQSA 4XAKA 2LGOA 4TNSA 5J6EA 3CGNA 1JVWA 4LAVA 4ODMA 3O5MA 3AS0A 3ARXA 3FAPA 1F40A 2PV3A 4ZPVR 4G2PA 4WKFA 2ESCA 3ARZA 2A3AA 1W9UA 4L3NA 3ARPA 1D7IA 4Z2GA 3WD3A 2DSUA 4JFIA 4NSBA 4ODPA 2A3CA 1W9VA 3ARRA 3CHCA 4ODNA 2A3EA 2DPEA 2Q5AA 3UI6A 1LG1A 2MLZA 4HBEA 3O5JA 3KACA 4MAVA 3H9RB 1D2KA 2LJ4A 1ZBKA 1EHNA 3WKZA 5HTGA 3UQIA 4DT4A 2D9FA 1SR0A
chains in the Genus database with same CATH topology
5JH8A 4U86A 1E6ZA 4MTVA 1W9PA 2DT3A 1WNOA 1LL6A 4ITZA 4Z2IA 3WL1A 4Z2KA 1EIBA 1E6NA 2RSEA 3KAHA 3KCEA 1KFWA 3AROA 2QF8A 2WM0A 1JNEA 2M1IA 4DRPA 4P8VA 4DZ2A 4P8XA 4BF8A 1JNTA 2MLYA 2F2DA 2UZ5A 3AQUA 5HWCA 2XP5A 2KFWA 4GIVA 1OGGA 2F4EA 2DG9A 1FKGA 4MSPA 1QPLA 4Q7NA 4Q22A 4KR0B 4DRQA 2FAPA 3B9AA 4NZCA 4W9QA 2MNTA 2YBTA 1YW5A 1ROTA 1D7JA 1C9HA 4MGVA 1T11A 4J4OA 3WD2A 2RUCA 4NNRA 4IQCA 5I98A 2ZQUA 3LUOA 2LKNA 3QOKA 1ITXA 1YATA 3I6CA 1XRVA 3O5QA 1E6PA 1W1PA 4QIBA 3O5EA 5DEZA 1UR8A 2IUZA 1OGBA 2ITKA 1W1TA 2JZVA 3ARTA 3OOBA 3O5PA 1HJXA 3RMEA 1RD6A 2M08A 3BXWA 4TYOA 2ZR5A 4TW6A 1EYMA 3PA7A 3O5KA 4IQ2A 1VF8A 4L72B 1HKMA 4GGQA 1EDQA 4S3JA 4ZPWR 1HJVA 3RM8A 3W4RA 1PBKA 5GPGA 4DWSC 4WJXA 1B6CA 1FD9A 4AY1A 5HWBA 4W9OA 1Y0OA 3CHDA 4JFMA 3PRDA 4DRMA 3JYJA 4ODOA 3UQAA 1XHGA 3ARSA 3UI5A 3WQWA 1KT0A 2RQSA 4G50A 2KR7A 5HT1A 4W9PA 2OFNA 1QZ2A 1JNSA 1FKRA 3KAFA 4JFKA 3B8SA 4ML4A 1LG2A 1J4IA 4WIWA 4PTMA 1HKJA 2AWGA 4DZ3A 4QT3A 2Y78A 2N87A 1OWQA 2PV1A 2DG3A 4ODQA 4WKHA 5GQBA 2XP8A 3ARUA 5HW7A 1A7XA 1LL4A 5DIVA 1TCOC 3KADA 1NWUA 3KAGA 4FAPA 4MPKA 2XP6A 3KZ7A 3JXVA 4FN2A 4MNMA 5DO2A 3CZ8A 5B8IC 4IT4A 2OLHA 4P8UA 4DWSD 1UR9A 2YBUA 2DSWA 4WKAA 1FKDA 1D7HA 4DRNA 1O6IA 2PI6A 1FKIA 1PINA 2WLYA 1TFVA 1FKJA 2AOSA 1N1AA 3ARVA 4O2TA 1W1YA 3ALFA 3O5LA 4ZPTR 1NSGA 1ZBWA 4W5UA 4R5EA 3UI4A 2FDMA 1H0IA 1U79A 1F8AB 2K8IA 2KE0A 2F21A 4DWSB 2IF4A 2MF9A 4JFJA 4LAYA 1JNDA 4U84A 3ARWA 2MLXA 1NWTA 2O92A 1E15A 4TW8A 4LAXA 1FAPA 3AS2A 3PRAA 2ZQTA 1GPFA 1FKKA 3O5IA 2A3BA 3WH0A 2RURA 3ARQA 3WD4A 3FXYA 4N19A 4DH0A 1J6YA 1H0GA 1FKTA 2FKEA 3RM9A 3WD1A 1HKKA 1NMWA 1HXVA 3O5FA 4IT6A 1Q6IA 3O5RA 2ZR4A 3B7XA 1NMVA 1ZL1A 1M5YA 3RFWA 2PPPA 1Q6UA 4R0XA 4C02B 5HBFA 4IPXA 5BXJA 4Z2JA 1ZU8A 1Q1CA 3CHFA 1ZK6A 4HARA 4QT2A 1FKFA 2WLZA 2O9OA 2B31A 2DSZA 1FKSA 2PV2A 3JYMA 2ZR6A 5HW6A 1ZCNA 2KO7A 5D75A 2XP3A 4U85A 3IK8A 2XPBA 2MPHA 5DF0A 1L1PA 4MNKA 3WIJA 1BL4A 2RUQA 3WQVA 1SYTA 4ODKA 1ZBVA 2G41A 4TX0A 1W26A 1GUVA 3CHEA 2VCDA 3KAIA 4DRIA 1FFRA 1KT1A 2XP7A 4J4NA 2XP4A 1EQ3A 1P5QA 4DRHA 1WAWA 3MDYB 2DG4A 3RGCA 3AS3A 1WB0A 4S3KA 2L2SA 2RUDA 1LL7A 2XP9A 3UF8A 4DROA 3CH9A 3ODKA 1FKHA 4DRJA 1FJDA 2WK2A 1E6RA 3O5GA 4Z2LA 5HKGA 3ARYA 3IKGA 4LAWA 4ODLA 2DSVA 1J4RA 1LJYA 3KABA 3EY6A 3UQBA 1HJWA 3PRBA 1W1VA 4Z2HA 4ODRA 2G8ZA 4JYSA 1FFQA 1ZB5A 4DWSA 4ZS6A 5GPRA 3G6MA 1ZBCA 4TW7A 3IKDA 5DIUA 2M2AA 2PPOA 2VN1A 3NRKA 1QPFA 4HBOA 1GOIA 4WK9A 1J4HA 3B9DA 3TDBA 3B9EA 1CTNA 1IX5A 1X6LA 3RM4A 4DIPA 2PPNA 4JFLA 3OA5A 2XPAA 2DT2A 2DT1A 1D6OA 3PR9A 4LGXA 3TC5A 2PBCA 4P8WA 1X6NA 1NWSA 3TCZA 4DRKA 4MNLA 1LQ0A 3O5OA 4QZVB 1HKIA 1NWRA 2ZQVA 3O5DA 1NH6A 3G6LA 2LPVA 3AS1A 5HW8A 3NTPA 1FKLA 1BKFA 3WL0A 1Q6HA 3IHZA 4KQZA 5HUAA 2KI3A 3ALGA 2KGJA 3GPKA 2DT0A 3CGMA 3NI6A 1ROUA 3VAWA 1E9LA 1FKBA 4MNJA 1K9TA 4URIA 3FY1A 3WD0A 5DITA 1R9HA 2ZQSA 4XAKA 2LGOA 4TNSA 5J6EA 3CGNA 1JVWA 4LAVA 4ODMA 3O5MA 3AS0A 3ARXA 3FAPA 1F40A 2PV3A 4ZPVR 4G2PA 4WKFA 2ESCA 3ARZA 2A3AA 1W9UA 4L3NA 3ARPA 1D7IA 4Z2GA 3WD3A 2DSUA 4JFIA 4NSBA 4ODPA 2A3CA 1W9VA 3ARRA 3CHCA 4ODNA 2A3EA 2DPEA 2Q5AA 3UI6A 1LG1A 2MLZA 4HBEA 3O5JA 3KACA 4MAVA 3H9RB 1D2KA 2LJ4A 1ZBKA 1EHNA 3WKZA 5HTGA 3UQIA 4DT4A 2D9FA 1SR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWB A;  4JYS A;  4W9O A;  4U86 A;  3WH0 A;  2RUR A;  1Y0O A;  4N19 A;  4JFM A;  4DH0 A;  4TW7 A;  1J6Y A;  1FKT A;  2FKE A;  3IKD A;  3PRD A;  4DRM A;  4ITZ A;  3JYJ A;  4ODO A;  5DIU A;  3UQA A;  1NMW A;  2M2A A;  2PPO A;  2VN1 A;  3NRK A;  3O5F A;  1Q6I A;  1HXV A;  3O5R A;  3UI5 A;  1QPF A;  2ZR4 A;  3B7X A;  2RSE A;  1NMV A;  1KT0 A;  3KAH A;  3KCE A;  1M5Y A;  1J4H A;  3RFW A;  2RQS A;  2PPP A;  3TDB A;  1Q6U A;  4G50 A;  4R0X A;  2KR7 A;  5HT1 A;  4C02 B;  4W9P A;  2M1I A;  4IPX A;  2OFN A;  5BXJ A;  4DRP A;  1QZ2 A;  4DIP A;  1Q1C A;  4DZ2 A;  1JNS A;  1FKR A;  4BF8 A;  1JNT A;  4QT2 A;  1ZK6 A;  2PPN A;  3KAF A;  1FKF A;  4JFL A;  2XPA A;  2MLY A;  4JFK A;  2F2D A;  1D6O A;  1FKS A;  2UZ5 A;  3TC5 A;  2PBC A;  2PV2 A;  1J4I A;  5HWC A;  2XP5 A;  3JYM A;  3TCZ A;  2ZR6 A;  5HW6 A;  2KFW A;  2AWG A;  4DZ3 A;  4QT3 A;  4DRK A;  2Y78 A;  4GIV A;  2N87 A;  3O5O A;  1ZCN A;  2F4E A;  2PV1 A;  2DG9 A;  1FKG A;  2KO7 A;  4MSP A;  2DG3 A;  1QPL A;  2ZQV A;  2XP3 A;  3O5D A;  4ODQ A;  5D75 A;  2LPV A;  4U85 A;  2XP8 A;  5HW7 A;  4DRQ A;  3IK8 A;  1A7X A;  2FAP A;  2MPH A;  2XPB A;  3NTP A;  5HW8 A;  1L1P A;  4W9Q A;  5DIV A;  1FKL A;  1TCO C;  3KAD A;  1BL4 A;  1BKF A;  1Q6H A;  2MNT A;  3IHZ A;  5HUA A;  2RUQ A;  1YW5 A;  2KI3 A;  1ROT A;  3KAG A;  1D7J A;  2KGJ A;  3GPK A;  4FAP A;  1C9H A;  2XP6 A;  3KZ7 A;  3CGM A;  3NI6 A;  1ROU A;  1T11 A;  3JXV A;  4FN2 A;  4J4O A;  4MGV A;  4ODK A;  3VAW A;  2RUC A;  4NNR A;  4IQC A;  4TX0 A;  5I98 A;  1FKB A;  1W26 A;  5B8I C;  2VCD A;  2ZQU A;  3LUO A;  2LKN A;  3KAI A;  4DRI A;  1KT1 A;  1YAT A;  2XP7 A;  5DIT A;  1R9H A;  3I6C A;  4J4N A;  2ZQS A;  2LGO A;  1FKD A;  1D7H A;  3O5Q A;  4TNS A;  4DRN A;  2XP4 A;  1EQ3 A;  1P5Q A;  3CGN A;  1JVW A;  3MDY B;  4QIB A;  2DG4 A;  3O5E A;  4DRH A;  3RGC A;  5J6E A;  4LAV A;  4ODM A;  3O5M A;  3FAP A;  1FKI A;  2L2S A;  1PIN A;  2PV3 A;  1F40 A;  2ITK A;  1FKJ A;  2RUD A;  2XP9 A;  4G2P A;  1N1A A;  3UF8 A;  2JZV A;  4DRO A;  3ODK A;  3OOB A;  3O5P A;  4O2T A;  1FKH A;  1D7I A;  4DRJ A;  1FJD A;  3O5L A;  3O5G A;  3O5I A;  2M08 A;  1NSG A;  4JFI A;  4ODP A;  4TYO A;  5HKG A;  2ZR5 A;  4TW6 A;  1EYM A;  3PA7 A;  4ODN A;  3IKG A;  4LAW A;  4ODL A;  3UI6 A;  2Q5A A;  3O5K A;  3UI4 A;  2MLZ A;  4IQ2 A;  3O5J A;  1U79 A;  1F8A B;  1J4R A;  4GGQ A;  2K8I A;  3KAC A;  2KE0 A;  3H9R B;  2F21 A;  2IF4 A;  2MF9 A;  2LJ4 A;  4JFJ A;  3KAB A;  4LAY A;  4U84 A;  1PBK A;  2MLX A;  5GPG A;  3EY6 A;  4TW8 A;  3UQB A;  4LAX A;  3UQI A;  1FAP A;  5HTG A;  3PRB A;  4DT4 A;  1B6C A;  4ODR A;  1FD9 A;  2ZQT A;  2D9F A;  1FKK A; 
#chains in the Genus database with same CATH topology
 5JH8 A;  4U86 A;  1E6Z A;  4MTV A;  1W9P A;  2DT3 A;  1WNO A;  1LL6 A;  4ITZ A;  4Z2I A;  3WL1 A;  4Z2K A;  1EIB A;  1E6N A;  2RSE A;  3KAH A;  3KCE A;  1KFW A;  3ARO A;  2QF8 A;  2WM0 A;  1JNE A;  2M1I A;  4DRP A;  4P8V A;  4DZ2 A;  4P8X A;  4BF8 A;  1JNT A;  2MLY A;  2F2D A;  2UZ5 A;  3AQU A;  5HWC A;  2XP5 A;  2KFW A;  4GIV A;  1OGG A;  2F4E A;  2DG9 A;  1FKG A;  4MSP A;  1QPL A;  4Q7N A;  4Q22 A;  4KR0 B;  4DRQ A;  2FAP A;  3B9A A;  4NZC A;  3EIP A;  4W9Q A;  2MNT A;  2YBT A;  1YW5 A;  1ROT A;  1D7J A;  1C9H A;  4MGV A;  1T11 A;  4J4O A;  3WD2 A;  2RUC A;  4NNR A;  4IQC A;  5I98 A;  2ZQU A;  3LUO A;  2LKN A;  3QOK A;  1ITX A;  1YAT A;  3I6C A;  1XRV A;  3O5Q A;  1E6P A;  1W1P A;  4QIB A;  3O5E A;  5DEZ A;  1UR8 A;  2IUZ A;  1OGB A;  2ITK A;  1W1T A;  2JZV A;  3ART A;  3OOB A;  3O5P A;  1HJX A;  3RME A;  1RD6 A;  2M08 A;  3BXW A;  4TYO A;  2ZR5 A;  4TW6 A;  1EYM A;  3PA7 A;  3O5K A;  4IQ2 A;  1VF8 A;  4L72 B;  1HKM A;  4GGQ A;  2PN0 A;  1EDQ A;  4S3J A;  4ZPW R;  1E44 A;  1HJV A;  3RM8 A;  3W4R A;  1PBK A;  5GPG A;  4DWS C;  4WJX A;  1B6C A;  1FD9 A;  4AY1 A;  5HWB A;  4W9O A;  1Y0O A;  3CHD A;  4JFM A;  3PRD A;  4DRM A;  3JYJ A;  4ODO A;  3UQA A;  1XHG A;  3ARS A;  3UI5 A;  3WQW A;  1KT0 A;  1GRJ A;  2RQS A;  4G50 A;  2KR7 A;  5HT1 A;  4W9P A;  2OFN A;  1QZ2 A;  1JNS A;  1FKR A;  3KAF A;  4JFK A;  3B8S A;  4ML4 A;  1LG2 A;  1J4I A;  4WIW A;  4PTM A;  1HKJ A;  2AWG A;  4DZ3 A;  4QT3 A;  2Y78 A;  2N87 A;  1OWQ A;  2PV1 A;  2DG3 A;  4ODQ A;  4WKH A;  5GQB A;  2XP8 A;  3ARU A;  5HW7 A;  1A7X A;  1LL4 A;  5DIV A;  1TCO C;  3KAD A;  1NWU A;  3KAG A;  4FAP A;  4MPK A;  2XP6 A;  3KZ7 A;  3JXV A;  4FN2 A;  4MNM A;  5DO2 A;  3CZ8 A;  5B8I C;  4IT4 A;  2OLH A;  2ETN A;  4P8U A;  4DWS D;  1UR9 A;  2YBU A;  2DSW A;  4WKA A;  1FKD A;  1D7H A;  4DRN A;  1O6I A;  2PI6 A;  1FKI A;  1PIN A;  2WLY A;  1TFV A;  1FKJ A;  2AOS A;  2F23 A;  1N1A A;  3ARV A;  4O2T A;  1W1Y A;  3ALF A;  3O5L A;  4ZPT R;  1NSG A;  1ZBW A;  4W5U A;  4R5E A;  3UI4 A;  2FDM A;  1H0I A;  1U79 A;  1F8A B;  2K8I A;  2KE0 A;  2F21 A;  4DWS B;  2IF4 A;  2MF9 A;  4JFJ A;  4LAY A;  1JND A;  4U84 A;  3ARW A;  2MLX A;  1NWT A;  2O92 A;  1E15 A;  4TW8 A;  4LAX A;  1FAP A;  3AS2 A;  3PRA A;  2ZQT A;  1GPF A;  1FKK A;  3O5I A;  2A3B A;  3WH0 A;  2RUR A;  3ARQ A;  3WD4 A;  3FXY A;  4N19 A;  4DH0 A;  1J6Y A;  1H0G A;  1FKT A;  2FKE A;  3RM9 A;  3WD1 A;  1HKK A;  1NMW A;  1HXV A;  3O5F A;  4IT6 A;  1Q6I A;  3O5R A;  2ZR4 A;  3B7X A;  1NMV A;  1ZL1 A;  1M5Y A;  3RFW A;  2PPP A;  1Q6U A;  4R0X A;  4C02 B;  5HBF A;  4IPX A;  5BXJ A;  4Z2J A;  1ZU8 A;  1Q1C A;  1JCH B;  3CHF A;  1ZK6 A;  4HAR A;  4QT2 A;  1FKF A;  2WLZ A;  2O9O A;  2B31 A;  2DSZ A;  1FKS A;  2PV2 A;  3JYM A;  2ZR6 A;  5HW6 A;  1ZCN A;  2KO7 A;  5D75 A;  3GU0 A;  2XP3 A;  4U85 A;  3IK8 A;  2XPB A;  2MPH A;  5DF0 A;  1L1P A;  4MNK A;  3WIJ A;  1BL4 A;  2RUQ A;  3WQV A;  1SYT A;  4ODK A;  1ZBV A;  2G41 A;  4TX0 A;  1W26 A;  1GUV A;  3CHE A;  2VCD A;  3KAI A;  4DRI A;  1FFR A;  1KT1 A;  2XP7 A;  4J4N A;  2XP4 A;  1EQ3 A;  1P5Q A;  4DRH A;  1WAW A;  3MDY B;  2DG4 A;  3RGC A;  3AS3 A;  1WB0 A;  4S3K A;  2L2S A;  2P4V A;  2RUD A;  1LL7 A;  2XP9 A;  3UF8 A;  4DRO A;  3CH9 A;  3ODK A;  1FKH A;  4DRJ A;  1FJD A;  2WK2 A;  1E6R A;  3O5G A;  4Z2L A;  5HKG A;  3ARY A;  3IKG A;  4LAW A;  4ODL A;  2DSV A;  1J4R A;  3BMB A;  1LJY A;  3KAB A;  3EY6 A;  3GTY X;  3UQB A;  2B5U B;  1HJW A;  3PRB A;  1W1V A;  4Z2H A;  4ODR A;  2G8Z A;  4JYS A;  1FFQ A;  1ZB5 A;  4DWS A;  4ZS6 A;  5GPR A;  3G6M A;  1ZBC A;  4TW7 A;  3IKD A;  5DIU A;  2M2A A;  2PPO A;  2VN1 A;  3NRK A;  1QPF A;  4HBO A;  1GOI A;  4UDM A;  4WK9 A;  1J4H A;  3B9D A;  3TDB A;  3B9E A;  1CTN A;  1IX5 A;  1X6L A;  3RM4 A;  4DIP A;  2PPN A;  4JFL A;  3OA5 A;  2XPA A;  2DT2 A;  2DT1 A;  1D6O A;  3PR9 A;  4LGX A;  3TC5 A;  2PBC A;  4P8W A;  1X6N A;  1NWS A;  3TCZ A;  4DRK A;  4MNL A;  1LQ0 A;  3O5O A;  4QZV B;  1HKI A;  1NWR A;  2ZQV A;  3O5D A;  1NH6 A;  3G6L A;  2LPV A;  3AS1 A;  5HW8 A;  3NTP A;  1FKL A;  1BKF A;  3WL0 A;  1Q6H A;  3IHZ A;  4KQZ A;  5HUA A;  2KI3 A;  3ALG A;  2KGJ A;  3GPK A;  2DT0 A;  3CGM A;  3NI6 A;  1ROU A;  3VAW A;  1E9L A;  1FKB A;  4MNJ A;  1K9T A;  2EUL A;  4URI A;  3FY1 A;  3WD0 A;  5DIT A;  1R9H A;  2ZQS A;  4XAK A;  2LGO A;  4TNS A;  5J6E A;  3CGN A;  1JVW A;  4LAV A;  4ODM A;  3O5M A;  3AS0 A;  3ARX A;  3FAP A;  1F40 A;  2PV3 A;  4ZPV R;  4G2P A;  4WKF A;  2ESC A;  3ARZ A;  2A3A A;  1W9U A;  4L3N A;  3ARP A;  1D7I A;  4Z2G A;  3WD3 A;  2DSU A;  4JFI A;  4NSB A;  4ODP A;  2A3C A;  1W9V A;  3ARR A;  3CHC A;  4ODN A;  2A3E A;  2DPE A;  2Q5A A;  3UI6 A;  1LG1 A;  2MLZ A;  4HBE A;  3O5J A;  3KAC A;  4MAV A;  3H9R B;  1D2K A;  2LJ4 A;  1ZBK A;  1EHN A;  3WKZ A;  5HTG A;  3UQI A;  4DT4 A;  2D9F A;  1SR0 A; 
#chains in the Genus database with same CATH homology
 5JH8 A;  4U86 A;  1E6Z A;  4MTV A;  1W9P A;  2DT3 A;  1WNO A;  1LL6 A;  4ITZ A;  4Z2I A;  3WL1 A;  4Z2K A;  1EIB A;  1E6N A;  2RSE A;  3KAH A;  3KCE A;  1KFW A;  3ARO A;  2QF8 A;  2WM0 A;  1JNE A;  2M1I A;  4DRP A;  4P8V A;  4DZ2 A;  4P8X A;  4BF8 A;  1JNT A;  2MLY A;  2F2D A;  2UZ5 A;  3AQU A;  5HWC A;  2XP5 A;  2KFW A;  4GIV A;  1OGG A;  2F4E A;  2DG9 A;  1FKG A;  4MSP A;  1QPL A;  4Q7N A;  4Q22 A;  4KR0 B;  4DRQ A;  2FAP A;  3B9A A;  4NZC A;  4W9Q A;  2MNT A;  2YBT A;  1YW5 A;  1ROT A;  1D7J A;  1C9H A;  4MGV A;  1T11 A;  4J4O A;  3WD2 A;  2RUC A;  4NNR A;  4IQC A;  5I98 A;  2ZQU A;  3LUO A;  2LKN A;  3QOK A;  1ITX A;  1YAT A;  3I6C A;  1XRV A;  3O5Q A;  1E6P A;  1W1P A;  4QIB A;  3O5E A;  5DEZ A;  1UR8 A;  2IUZ A;  1OGB A;  2ITK A;  1W1T A;  2JZV A;  3ART A;  3OOB A;  3O5P A;  1HJX A;  3RME A;  1RD6 A;  2M08 A;  3BXW A;  4TYO A;  2ZR5 A;  4TW6 A;  1EYM A;  3PA7 A;  3O5K A;  4IQ2 A;  1VF8 A;  4L72 B;  1HKM A;  4GGQ A;  1EDQ A;  4S3J A;  4ZPW R;  1HJV A;  3RM8 A;  3W4R A;  1PBK A;  5GPG A;  4DWS C;  4WJX A;  1B6C A;  1FD9 A;  4AY1 A;  5HWB A;  4W9O A;  1Y0O A;  3CHD A;  4JFM A;  3PRD A;  4DRM A;  3JYJ A;  4ODO A;  3UQA A;  1XHG A;  3ARS A;  3UI5 A;  3WQW A;  1KT0 A;  2RQS A;  4G50 A;  2KR7 A;  5HT1 A;  4W9P A;  2OFN A;  1QZ2 A;  1JNS A;  1FKR A;  3KAF A;  4JFK A;  3B8S A;  4ML4 A;  1LG2 A;  1J4I A;  4WIW A;  4PTM A;  1HKJ A;  2AWG A;  4DZ3 A;  4QT3 A;  2Y78 A;  2N87 A;  1OWQ A;  2PV1 A;  2DG3 A;  4ODQ A;  4WKH A;  5GQB A;  2XP8 A;  3ARU A;  5HW7 A;  1A7X A;  1LL4 A;  5DIV A;  1TCO C;  3KAD A;  1NWU A;  3KAG A;  4FAP A;  4MPK A;  2XP6 A;  3KZ7 A;  3JXV A;  4FN2 A;  4MNM A;  5DO2 A;  3CZ8 A;  5B8I C;  4IT4 A;  2OLH A;  4P8U A;  4DWS D;  1UR9 A;  2YBU A;  2DSW A;  4WKA A;  1FKD A;  1D7H A;  4DRN A;  1O6I A;  2PI6 A;  1FKI A;  1PIN A;  2WLY A;  1TFV A;  1FKJ A;  2AOS A;  1N1A A;  3ARV A;  4O2T A;  1W1Y A;  3ALF A;  3O5L A;  4ZPT R;  1NSG A;  1ZBW A;  4W5U A;  4R5E A;  3UI4 A;  2FDM A;  1H0I A;  1U79 A;  1F8A B;  2K8I A;  2KE0 A;  2F21 A;  4DWS B;  2IF4 A;  2MF9 A;  4JFJ A;  4LAY A;  1JND A;  4U84 A;  3ARW A;  2MLX A;  1NWT A;  2O92 A;  1E15 A;  4TW8 A;  4LAX A;  1FAP A;  3AS2 A;  3PRA A;  2ZQT A;  1GPF A;  1FKK A;  3O5I A;  2A3B A;  3WH0 A;  2RUR A;  3ARQ A;  3WD4 A;  3FXY A;  4N19 A;  4DH0 A;  1J6Y A;  1H0G A;  1FKT A;  2FKE A;  3RM9 A;  3WD1 A;  1HKK A;  1NMW A;  1HXV A;  3O5F A;  4IT6 A;  1Q6I A;  3O5R A;  2ZR4 A;  3B7X A;  1NMV A;  1ZL1 A;  1M5Y A;  3RFW A;  2PPP A;  1Q6U A;  4R0X A;  4C02 B;  5HBF A;  4IPX A;  5BXJ A;  4Z2J A;  1ZU8 A;  1Q1C A;  3CHF A;  1ZK6 A;  4HAR A;  4QT2 A;  1FKF A;  2WLZ A;  2O9O A;  2B31 A;  2DSZ A;  1FKS A;  2PV2 A;  3JYM A;  2ZR6 A;  5HW6 A;  1ZCN A;  2KO7 A;  5D75 A;  2XP3 A;  4U85 A;  3IK8 A;  2XPB A;  2MPH A;  5DF0 A;  1L1P A;  4MNK A;  3WIJ A;  1BL4 A;  2RUQ A;  3WQV A;  1SYT A;  4ODK A;  1ZBV A;  2G41 A;  4TX0 A;  1W26 A;  1GUV A;  3CHE A;  2VCD A;  3KAI A;  4DRI A;  1FFR A;  1KT1 A;  2XP7 A;  4J4N A;  2XP4 A;  1EQ3 A;  1P5Q A;  4DRH A;  1WAW A;  3MDY B;  2DG4 A;  3RGC A;  3AS3 A;  1WB0 A;  4S3K A;  2L2S A;  2RUD A;  1LL7 A;  2XP9 A;  3UF8 A;  4DRO A;  3CH9 A;  3ODK A;  1FKH A;  4DRJ A;  1FJD A;  2WK2 A;  1E6R A;  3O5G A;  4Z2L A;  5HKG A;  3ARY A;  3IKG A;  4LAW A;  4ODL A;  2DSV A;  1J4R A;  1LJY A;  3KAB A;  3EY6 A;  3UQB A;  1HJW A;  3PRB A;  1W1V A;  4Z2H A;  4ODR A;  2G8Z A;  4JYS A;  1FFQ A;  1ZB5 A;  4DWS A;  4ZS6 A;  5GPR A;  3G6M A;  1ZBC A;  4TW7 A;  3IKD A;  5DIU A;  2M2A A;  2PPO A;  2VN1 A;  3NRK A;  1QPF A;  4HBO A;  1GOI A;  4WK9 A;  1J4H A;  3B9D A;  3TDB A;  3B9E A;  1CTN A;  1IX5 A;  1X6L A;  3RM4 A;  4DIP A;  2PPN A;  4JFL A;  3OA5 A;  2XPA A;  2DT2 A;  2DT1 A;  1D6O A;  3PR9 A;  4LGX A;  3TC5 A;  2PBC A;  4P8W A;  1X6N A;  1NWS A;  3TCZ A;  4DRK A;  4MNL A;  1LQ0 A;  3O5O A;  4QZV B;  1HKI A;  1NWR A;  2ZQV A;  3O5D A;  1NH6 A;  3G6L A;  2LPV A;  3AS1 A;  5HW8 A;  3NTP A;  1FKL A;  1BKF A;  3WL0 A;  1Q6H A;  3IHZ A;  4KQZ A;  5HUA A;  2KI3 A;  3ALG A;  2KGJ A;  3GPK A;  2DT0 A;  3CGM A;  3NI6 A;  1ROU A;  3VAW A;  1E9L A;  1FKB A;  4MNJ A;  1K9T A;  4URI A;  3FY1 A;  3WD0 A;  5DIT A;  1R9H A;  2ZQS A;  4XAK A;  2LGO A;  4TNS A;  5J6E A;  3CGN A;  1JVW A;  4LAV A;  4ODM A;  3O5M A;  3AS0 A;  3ARX A;  3FAP A;  1F40 A;  2PV3 A;  4ZPV R;  4G2P A;  4WKF A;  2ESC A;  3ARZ A;  2A3A A;  1W9U A;  4L3N A;  3ARP A;  1D7I A;  4Z2G A;  3WD3 A;  2DSU A;  4JFI A;  4NSB A;  4ODP A;  2A3C A;  1W9V A;  3ARR A;  3CHC A;  4ODN A;  2A3E A;  2DPE A;  2Q5A A;  3UI6 A;  1LG1 A;  2MLZ A;  4HBE A;  3O5J A;  3KAC A;  4MAV A;  3H9R B;  1D2K A;  2LJ4 A;  1ZBK A;  1EHN A;  3WKZ A;  5HTG A;  3UQI A;  4DT4 A;  2D9F A;  1SR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...