3RGCA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
251
structure length
248
Chain Sequence
NAIAVVVDKEPITTYDIDQTMKALKIDRNKALGVLINEKMEISQMKQLGIVVNDLELDDAINKMLAQNKTTLNAFKANLKSSYEQFRTNFKKDLEKRKLYEKIASMAKTDFSDDGAKKFFEQNKDKFTFYTQINANIYLSNNPQTLENIKNTKKTILKPQNASLNTSNADPRLLGLLSQIPVGSFSPVLNGKNGYELYEVKSKDGTQTPEYEQVKNEVLNAYVSEQRQNFIQDYFDKLRSKINIEYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Chaperone
molecule keywords Possible periplasmic protein
total genus 81
structure length 248
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09312 SurA_N SurA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4030.30 Mainly Alpha Orthogonal Bundle Triger factor/SurA peptide-binding fold Triger factor/SurA peptide-binding fold 3rgcA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rgcA02
1Q1CA 3EY6A 3TDBA 3CGNA 1FAPA 2MLYA 4U85A 1J4RA 1D7JA 3UQAA 2M2AA 3FAPA 3KACA 2RUQA 1NMVA 2M1IA 3O5LA 3ODKA 3PRDA 4JFKA 4MSPA 1FKTA 4ODKA 4DRJA 4DZ2A 2PPNA 3JYJA 3O5DA 1J4HA 3O5RA 4W9OA 3VAWA 3KAHA 5HUAA 4ODOA 1FKFA 1YW5A 4TW6A 3TCZA 4QT3A 4DRIA 2ZQVA 1F8AB 2Y78A 1NMWA 1U79A 1T11A 3KZ7A 3WH0A 3PA7A 4TYOA 1FKRA 4DRQA 3O5OA 3JYMA 2XP9A 3PRBA 4R0XA 1FKSA 2M08A 1HXVA 4ODQA 4TNSA 5GPGA 4O2TA 1FKGA 4MGVA 4DRKA 3O5KA 1FJDA 4W9PA 1D7IA 1ROUA 2AWGA 2RUCA 2JZVA 4ODLA 5HWCA 1J4IA 4JFLA 4DIPA 2ZR4A 1FD9A 2FKEA 1EYMA 3IKGA 1BL4A 1JVWA 2XP4A 1FKJA 4GIVA 4IQ2A 3O5EA 1TCOC 2MLZA 3NI6A 3O5JA 4DRHA 1KT0A 1FKDA 4JYSA 2KGJA 4G2PA 4DT4A 2IF4A 2VN1A 2MLXA 3KCEA 1W26A 4ODRA 2UZ5A 3UI5A 4U84A 2PV3A 2OFNA 2PPOA 4J4OA 5HW8A 1F40A 3KAIA 4DRMA 3O5PA 2RSEA 4JFJA 2DG4A 2LKNA 2MF9A 3LUOA 2KE0A 4LAVA 2D9FA 3H9RB 1Q6IA 1D7HA 4TW8A 3UF8A 1ZK6A 5B8IC 4ODMA 2KO7A 1KT1A 2LJ4A 2RURA 2ZR5A 2F21A 4G50A 5HKGA 2DG9A 3NTPA 1Q6UA 2ZQTA 4LAXA 2ITKA 5DITA 1C9HA 1FKLA 4FN2A 4IQCA 3O5MA 3IHZA 3MDYB 2XPBA 3O5GA 5J6EA 1ROTA 1M5YA 1Y0OA 3GPKA 2PV2A 3KABA 1QPLA 4DH0A 2LPVA 2DG3A 3KADA 4W9QA 1D6OA 1L1PA 2VCDA 4QIBA 1FKKA 2ZQUA 3UQBA 4DROA 2XP6A 3TC5A 2KI3A 5HW6A 4DZ3A 5HT1A 2PPPA 2RUDA 2K8IA 2PV1A 3I6CA 5HW7A 3UQIA 1NSGA 2KR7A 4FAPA 4JFIA 4LAYA 5HWBA 1JNSA 1P5QA 1PBKA 4NNRA 1FKIA 1FKHA 2L2SA 2XP3A 5BXJA 4C02B 3RGCA 2MPHA 4TW7A 1QZ2A 1Q6HA 1R9HA 4J4NA 4ODPA 3IK8A 3KAFA 1FKBA 2MNTA 3O5FA 2PBCA 5I98A 5D75A 3B7XA 1BKFA 3O5QA 2FAPA 4IPXA 1J6YA 2KFWA 2ZQSA 3IKDA 2LGOA 2XP8A 4LAWA 3RFWA 4QT2A 4ITZA 3JXVA 3CGMA 4N19A 2F2DA 4DRPA 3OOBA 4TX0A 1EQ3A 4U86A 2XP7A 3UI6A 1N1AA 5DIUA 4DRNA 1PINA 1ZCNA 2XPAA 4ODNA 3UI4A 1JNTA 1A7XA 2F4EA 3O5IA 1YATA 1QPFA 2Q5AA 2RQSA 4GGQA 3NRKA 3KAGA 1B6CA 4JFMA 5DIVA 2XP5A 5HTGA 2ZR6A 4BF8A 2N87A
chains in the Genus database with same CATH superfamily
3TDBA 1SR0A 1X6NA 1J4RA 1D7JA 1NWUA 4R5EA 3WD2A 1JCHB 2M1IA 1IX5A 4ODKA 2PPNA 3JYJA 1J4HA 3O5RA 4ODOA 2A3EA 4DRIA 3GTYX 2ZQVA 1F8AB 2DSZA 4IT4A 3CHDA 3JYMA 3ARXA 3PRBA 1HXVA 4TNSA 3WQWA 4DRKA 1FJDA 4ODLA 1EDQA 4DIPA 2FDMA 3WKZA 4GIVA 4IQ2A 2F23A 4Q7NA 4DRHA 1LG1A 2KGJA 4DT4A 2IF4A 3KCEA 3UI5A 5DF0A 2PV3A 4KR0B 5HW8A 4MTVA 3WL0A 3KAIA 4DRMA 1NWSA 2MF9A 1WNOA 1TFVA 1NWTA 1LG2A 2KO7A 2RURA 2ZR5A 4S3JA 2F21A 3NTPA 2ZQTA 4LAXA 2ITKA 4ML4A 3MDYB 3O5GA 1HJWA 1ROTA 3ARVA 3CH9A 1QPLA 4DH0A 2LPVA 3ARTA 2DG3A 1L1PA 1WB0A 2VCDA 3AS3A 4AY1A 1HKKA 1ZBWA 3TC5A 1RD6A 2KI3A 1HJVA 4DZ3A 3ARRA 3ARYA 2DPEA 2K8IA 3AROA 3UQIA 2KR7A 4NNRA 1FKIA 2XP3A 4XAKA 2QF8A 4TW7A 4ODPA 4ZPTR 1GUVA 1OGBA 1W1VA 2A3BA 3OA5A 2LGOA 4QT2A 1W9VA 2B31A 4DRPA 3OOBA 4TX0A 3QOKA 5GPRA 2XPAA 1FFRA 5DO2A 1ZBCA 1A7XA 3RM8A 2F4EA 1HJXA 1YATA 4L72B 3KAGA 5HBFA 5DIVA 2XP5A 2ZR6A 2N87A 1Q1CA 3EY6A 4MAVA 3CGNA 2MLYA 4U85A 1ITXA 3KACA 2WLYA 2RUQA 4DRJA 4DZ2A 3O5DA 1ZB5A 3VAWA 4UDMA 1YW5A 3ARSA 2DT3A 2Y78A 1NMWA 1UR9A 3WH0A 1HKMA 1FKRA 2DT2A 2DSVA 2XP9A 3CHCA 1OGGA 1LL6A 4MNKA 2M08A 4HBEA 4ODQA 4WJXA 1LJYA 2G41A 1UR8A 4WKAA 2AWGA 2RUCA 5HWCA 1J4IA 1NWRA 2AOSA 1H0GA 1JVWA 2XP4A 3O5EA 1TCOC 2MLZA 3O5JA 4MNMA 4G2PA 1W1PA 2VN1A 3RM9A 4WIWA 3B9DA 2OFNA 3WD3A 4P8VA 4WK9A 2IUZA 2WK2A 3LUOA 2KE0A 2D9FA 4QZVB 3ALFA 1Q6IA 3CHFA 3ALGA 4DWSA 3CHEA 5HKGA 2DG9A 2B5UB 1CTNA 4IQCA 3O5MA 1Y0OA 4HARA 1W9PA 1OWQA 4URIA 5HT1A 2RUDA 3I6CA 5HWBA 1JNSA 3G6LA 1W9UA 2WLZA 1X6LA 4J4NA 3IK8A 3WL1A 3O5FA 2PBCA 1E6RA 5D75A 2FAPA 2ZQSA 3AQUA 3JXVA 4N19A 2F2DA 1LQ0A 3UI6A 4DRNA 3B9AA 1W1YA 1QPFA 2Q5AA 2RQSA 1KFWA 1B6CA 1O6IA 2ETNA 3PRAA 3UQAA 2M2AA 3FY1A 3FAPA 1K9TA 4Z2JA 4P8XA 1NMVA 3O5LA 3ODKA 3PRDA 2WM0A 4W9OA 3ARPA 5HUAA 3KAHA 3TCZA 3B9EA 4QT3A 1U79A 1T11A 3FXYA 3PA7A 4DRQA 1W1TA 3O5OA 1VF8A 2DSWA 1FKSA 1E6ZA 1FKGA 4MGVA 3O5KA 1ROUA 2DSUA 2JZVA 4JFLA 1FD9A 4W5UA 3RMEA 2P4VA 3IKGA 1BL4A 3WQVA 2O92A 3NI6A 4S3KA 1KT0A 4JYSA 1W26A 1XRVA 4Z2LA 1H0IA 4DWSD 2RSEA 1HKIA 2YBUA 3H9RB 1D7HA 5DEZA 3UF8A 3W4RA 4ODMA 4MPKA 3GU0A 2LJ4A 1Q6UA 1E6NA 1GPFA 3ARWA 1ZU8A 5J6EA 1M5YA 4KQZA 3KABA 4P8WA 1D6OA 1E44A 3AS0A 2ZQUA 2A3AA 3WD0A 2XP6A 1JNEA 1D2KA 1XHGA 2PPPA 3ARUA 2PV1A 5HW7A 1NSGA 4FAPA 1PBKA 4LGXA 2L2SA 4HBOA 3RGCA 1Q6HA 1QZ2A 1ZL1A 1R9HA 1FFQA 4DWSB 5I98A 3O5QA 4IPXA 1J6YA 4NSBA 4LAWA 3RFWA 3CGMA 4U86A 2XP7A 1WAWA 5DIUA 1PINA 1ZCNA 3UI4A 2YBTA 4P8UA 3NRKA 3RM4A 1LL7A 3BXWA 4NZCA 4WKFA 5HTGA 4TW6A 4BF8A 4ZPWR 1FAPA 1HKJA 1NH6A 4WKHA 5JH8A 4Z2KA 4JFKA 4MSPA 1FKTA 4MNLA 1FKFA 2OLHA 1LL4A 2G8ZA 3KZ7A 4IT6A 4TYOA 2A3CA 4R0XA 1ZBKA 1EIBA 1ZBVA 5GPGA 4O2TA 4ZS6A 4W9PA 1D7IA 3EIPA 2ZR4A 2PN0A 2FKEA 1EYMA 1FKJA 1E9LA 2DT0A 1FKDA 1JNDA 2MLXA 4ODRA 2UZ5A 4U84A 2PPOA 4J4OA 3WIJA 1F40A 3O5PA 4JFJA 2DG4A 2LKNA 3G6MA 4LAVA 4TW8A 1ZK6A 5B8IC 1GOIA 1KT1A 4G50A 5DITA 1C9HA 1FKLA 4FN2A 3IHZA 2XPBA 1SYTA 3GPKA 2PV2A 3KADA 4W9QA 1E6PA 4QIBA 1FKKA 3UQBA 4DROA 5HW6A 5GQBA 4Q22A 2PI6A 4JFIA 4LAYA 4DWSC 1P5QA 3B8SA 5BXJA 1FKHA 4C02B 2MPHA 1E15A 3WD1A 3PR9A 3ARZA 3KAFA 1FKBA 2MNTA 3AS1A 3B7XA 1BKFA 2EULA 2ESCA 2KFWA 3IKDA 2XP8A 3WD4A 4ITZA 3ARQA 1EQ3A 4MNJA 3AS2A 1EHNA 1GRJA 2O9OA 1N1AA 3BMBA 2DT1A 4ODNA 3CZ8A 1JNTA 3O5IA 4ZPVR 4Z2IA 4PTMA 4GGQA 4Z2HA 4L3NA 4JFMA 4Z2GA
chains in the Genus database with same CATH topology
3TDBA 1SR0A 1X6NA 1J4RA 1D7JA 1NWUA 4R5EA 3WD2A 2M1IA 1IX5A 4ODKA 2PPNA 3JYJA 1J4HA 3O5RA 4ODOA 2A3EA 4DRIA 2ZQVA 1F8AB 2DSZA 4IT4A 3CHDA 3JYMA 3ARXA 3PRBA 1HXVA 4TNSA 3WQWA 4DRKA 1FJDA 4ODLA 1EDQA 4DIPA 2FDMA 3WKZA 4GIVA 4IQ2A 4Q7NA 4DRHA 1LG1A 2KGJA 4DT4A 2IF4A 3KCEA 3UI5A 5DF0A 2PV3A 4KR0B 5HW8A 4MTVA 3WL0A 3KAIA 4DRMA 1NWSA 2MF9A 1WNOA 1TFVA 1NWTA 1LG2A 2KO7A 2RURA 2ZR5A 4S3JA 2F21A 3NTPA 2ZQTA 4LAXA 2ITKA 4ML4A 3MDYB 3O5GA 1HJWA 1ROTA 3ARVA 3CH9A 1QPLA 4DH0A 2LPVA 3ARTA 2DG3A 1L1PA 1WB0A 2VCDA 3AS3A 4AY1A 1HKKA 1ZBWA 3TC5A 1RD6A 2KI3A 1HJVA 4DZ3A 3ARRA 3ARYA 2DPEA 2K8IA 3AROA 3UQIA 2KR7A 4NNRA 1FKIA 2XP3A 4XAKA 2QF8A 4TW7A 4ODPA 4ZPTR 1GUVA 1OGBA 1W1VA 2A3BA 3OA5A 2LGOA 4QT2A 1W9VA 2B31A 4DRPA 3OOBA 4TX0A 3QOKA 5GPRA 2XPAA 1FFRA 5DO2A 1ZBCA 1A7XA 3RM8A 2F4EA 1HJXA 1YATA 4L72B 3KAGA 5HBFA 5DIVA 2XP5A 2ZR6A 2N87A 1Q1CA 3EY6A 4MAVA 3CGNA 2MLYA 4U85A 1ITXA 3KACA 2WLYA 2RUQA 4DRJA 4DZ2A 3O5DA 1ZB5A 3VAWA 1YW5A 3ARSA 2DT3A 2Y78A 1NMWA 1UR9A 3WH0A 1HKMA 1FKRA 2DT2A 2DSVA 2XP9A 3CHCA 1OGGA 1LL6A 4MNKA 2M08A 4HBEA 4ODQA 4WJXA 1LJYA 2G41A 1UR8A 4WKAA 2AWGA 2RUCA 5HWCA 1J4IA 1NWRA 2AOSA 1H0GA 1JVWA 2XP4A 3O5EA 1TCOC 2MLZA 3O5JA 4MNMA 4G2PA 1W1PA 2VN1A 3RM9A 4WIWA 3B9DA 2OFNA 3WD3A 4P8VA 4WK9A 2IUZA 2WK2A 3LUOA 2KE0A 2D9FA 4QZVB 3ALFA 1Q6IA 3CHFA 3ALGA 4DWSA 3CHEA 5HKGA 2DG9A 1CTNA 4IQCA 3O5MA 1Y0OA 4HARA 1W9PA 1OWQA 4URIA 5HT1A 2RUDA 3I6CA 5HWBA 1JNSA 3G6LA 1W9UA 2WLZA 1X6LA 4J4NA 3IK8A 3WL1A 3O5FA 2PBCA 1E6RA 5D75A 2FAPA 2ZQSA 3AQUA 3JXVA 4N19A 2F2DA 1LQ0A 3UI6A 4DRNA 3B9AA 1W1YA 1QPFA 2Q5AA 2RQSA 1KFWA 1B6CA 1O6IA 3PRAA 3UQAA 2M2AA 3FY1A 3FAPA 1K9TA 4Z2JA 4P8XA 1NMVA 3O5LA 3ODKA 3PRDA 2WM0A 4W9OA 3ARPA 5HUAA 3KAHA 3TCZA 3B9EA 4QT3A 1U79A 1T11A 3FXYA 3PA7A 4DRQA 1W1TA 3O5OA 1VF8A 2DSWA 1FKSA 1E6ZA 1FKGA 4MGVA 3O5KA 1ROUA 2DSUA 2JZVA 4JFLA 1FD9A 4W5UA 3RMEA 3IKGA 1BL4A 3WQVA 2O92A 3NI6A 4S3KA 1KT0A 4JYSA 1W26A 1XRVA 4Z2LA 1H0IA 4DWSD 2RSEA 1HKIA 2YBUA 3H9RB 1D7HA 5DEZA 3UF8A 3W4RA 4ODMA 4MPKA 2LJ4A 1Q6UA 1E6NA 1GPFA 3ARWA 1ZU8A 5J6EA 1M5YA 4KQZA 3KABA 4P8WA 1D6OA 3AS0A 2ZQUA 2A3AA 3WD0A 2XP6A 1JNEA 1D2KA 1XHGA 2PPPA 3ARUA 2PV1A 5HW7A 1NSGA 4FAPA 1PBKA 4LGXA 2L2SA 4HBOA 3RGCA 1Q6HA 1QZ2A 1ZL1A 1R9HA 1FFQA 4DWSB 5I98A 3O5QA 4IPXA 1J6YA 4NSBA 4LAWA 3RFWA 3CGMA 4U86A 2XP7A 1WAWA 5DIUA 1PINA 1ZCNA 3UI4A 2YBTA 4P8UA 3NRKA 3RM4A 1LL7A 3BXWA 4NZCA 4WKFA 5HTGA 4TW6A 4BF8A 4ZPWR 1FAPA 1HKJA 1NH6A 4WKHA 5JH8A 4Z2KA 4JFKA 4MSPA 1FKTA 4MNLA 1FKFA 2OLHA 1LL4A 2G8ZA 3KZ7A 4IT6A 4TYOA 2A3CA 4R0XA 1ZBKA 1EIBA 1ZBVA 5GPGA 4O2TA 4ZS6A 4W9PA 1D7IA 2ZR4A 2FKEA 1EYMA 1FKJA 1E9LA 2DT0A 1FKDA 1JNDA 2MLXA 4ODRA 2UZ5A 4U84A 2PPOA 4J4OA 3WIJA 1F40A 3O5PA 4JFJA 2DG4A 2LKNA 3G6MA 4LAVA 4TW8A 1ZK6A 5B8IC 1GOIA 1KT1A 4G50A 5DITA 1C9HA 1FKLA 4FN2A 3IHZA 2XPBA 1SYTA 3GPKA 2PV2A 3KADA 4W9QA 1E6PA 4QIBA 1FKKA 3UQBA 4DROA 5HW6A 5GQBA 4Q22A 2PI6A 4JFIA 4LAYA 4DWSC 1P5QA 3B8SA 5BXJA 1FKHA 4C02B 2MPHA 1E15A 3WD1A 3PR9A 3ARZA 3KAFA 1FKBA 2MNTA 3AS1A 3B7XA 1BKFA 2KFWA 2ESCA 3IKDA 2XP8A 3WD4A 4ITZA 3ARQA 1EQ3A 4MNJA 3AS2A 1EHNA 2O9OA 1N1AA 2DT1A 4ODNA 3CZ8A 1JNTA 3O5IA 4ZPVR 4Z2IA 4PTMA 4GGQA 4Z2HA 4L3NA 4JFMA 4Z2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1C A;  3EY6 A;  3TDB A;  3CGN A;  1FAP A;  2MLY A;  4U85 A;  1J4R A;  1D7J A;  3UQA A;  2M2A A;  3FAP A;  3KAC A;  2RUQ A;  1NMV A;  2M1I A;  3O5L A;  3ODK A;  3PRD A;  4JFK A;  4MSP A;  1FKT A;  4ODK A;  4DRJ A;  4DZ2 A;  2PPN A;  3JYJ A;  3O5D A;  1J4H A;  3O5R A;  4W9O A;  3VAW A;  3KAH A;  5HUA A;  4ODO A;  1FKF A;  1YW5 A;  4TW6 A;  3TCZ A;  4QT3 A;  4DRI A;  2ZQV A;  1F8A B;  2Y78 A;  1NMW A;  1U79 A;  1T11 A;  3KZ7 A;  3WH0 A;  3PA7 A;  4TYO A;  1FKR A;  4DRQ A;  3O5O A;  3JYM A;  2XP9 A;  3PRB A;  4R0X A;  1FKS A;  2M08 A;  1HXV A;  4ODQ A;  4TNS A;  5GPG A;  4O2T A;  1FKG A;  4MGV A;  4DRK A;  3O5K A;  1FJD A;  4W9P A;  1D7I A;  1ROU A;  2AWG A;  2RUC A;  2JZV A;  4ODL A;  5HWC A;  1J4I A;  4JFL A;  4DIP A;  2ZR4 A;  1FD9 A;  2FKE A;  1EYM A;  3IKG A;  1BL4 A;  1JVW A;  2XP4 A;  1FKJ A;  4GIV A;  4IQ2 A;  3O5E A;  1TCO C;  2MLZ A;  3NI6 A;  3O5J A;  4DRH A;  1KT0 A;  1FKD A;  4JYS A;  2KGJ A;  4G2P A;  4DT4 A;  2IF4 A;  2VN1 A;  2MLX A;  3KCE A;  1W26 A;  4ODR A;  2UZ5 A;  3UI5 A;  4U84 A;  2PV3 A;  2OFN A;  2PPO A;  4J4O A;  5HW8 A;  1F40 A;  3KAI A;  4DRM A;  3O5P A;  2RSE A;  4JFJ A;  2DG4 A;  2LKN A;  2MF9 A;  3LUO A;  2KE0 A;  4LAV A;  2D9F A;  3H9R B;  1Q6I A;  1D7H A;  4TW8 A;  3UF8 A;  1ZK6 A;  5B8I C;  4ODM A;  2KO7 A;  1KT1 A;  2LJ4 A;  2RUR A;  2ZR5 A;  2F21 A;  4G50 A;  5HKG A;  2DG9 A;  3NTP A;  1Q6U A;  2ZQT A;  4LAX A;  2ITK A;  5DIT A;  1C9H A;  1FKL A;  4FN2 A;  4IQC A;  3O5M A;  3IHZ A;  3MDY B;  2XPB A;  3O5G A;  5J6E A;  1ROT A;  1M5Y A;  1Y0O A;  3GPK A;  2PV2 A;  3KAB A;  1QPL A;  4DH0 A;  2LPV A;  2DG3 A;  3KAD A;  4W9Q A;  1D6O A;  1L1P A;  2VCD A;  4QIB A;  1FKK A;  2ZQU A;  3UQB A;  4DRO A;  2XP6 A;  3TC5 A;  2KI3 A;  5HW6 A;  4DZ3 A;  5HT1 A;  2PPP A;  2RUD A;  2K8I A;  2PV1 A;  3I6C A;  5HW7 A;  3UQI A;  1NSG A;  2KR7 A;  4FAP A;  4JFI A;  4LAY A;  5HWB A;  1JNS A;  1P5Q A;  1PBK A;  4NNR A;  1FKI A;  1FKH A;  2L2S A;  2XP3 A;  5BXJ A;  4C02 B;  3RGC A;  2MPH A;  4TW7 A;  1QZ2 A;  1Q6H A;  1R9H A;  4J4N A;  4ODP A;  3IK8 A;  3KAF A;  1FKB A;  2MNT A;  3O5F A;  2PBC A;  5I98 A;  5D75 A;  3B7X A;  1BKF A;  3O5Q A;  2FAP A;  4IPX A;  1J6Y A;  2KFW A;  2ZQS A;  3IKD A;  2LGO A;  2XP8 A;  4LAW A;  3RFW A;  4QT2 A;  4ITZ A;  3JXV A;  3CGM A;  4N19 A;  2F2D A;  4DRP A;  3OOB A;  4TX0 A;  1EQ3 A;  4U86 A;  2XP7 A;  3UI6 A;  1N1A A;  5DIU A;  4DRN A;  1PIN A;  1ZCN A;  2XPA A;  4ODN A;  3UI4 A;  1JNT A;  1A7X A;  2F4E A;  3O5I A;  1YAT A;  1QPF A;  2Q5A A;  2RQS A;  4GGQ A;  3NRK A;  3KAG A;  1B6C A;  4JFM A;  5DIV A;  2XP5 A;  5HTG A;  2ZR6 A;  4BF8 A;  2N87 A; 
#chains in the Genus database with same CATH topology
 3TDB A;  1SR0 A;  1X6N A;  1J4R A;  1D7J A;  1NWU A;  4R5E A;  3WD2 A;  1JCH B;  2M1I A;  1IX5 A;  4ODK A;  2PPN A;  3JYJ A;  1J4H A;  3O5R A;  4ODO A;  2A3E A;  4DRI A;  3GTY X;  2ZQV A;  1F8A B;  2DSZ A;  4IT4 A;  3CHD A;  3JYM A;  3ARX A;  3PRB A;  1HXV A;  4TNS A;  3WQW A;  4DRK A;  1FJD A;  4ODL A;  1EDQ A;  4DIP A;  2FDM A;  3WKZ A;  4GIV A;  4IQ2 A;  2F23 A;  4Q7N A;  4DRH A;  1LG1 A;  2KGJ A;  4DT4 A;  2IF4 A;  3KCE A;  3UI5 A;  5DF0 A;  2PV3 A;  4KR0 B;  5HW8 A;  4MTV A;  3WL0 A;  3KAI A;  4DRM A;  1NWS A;  2MF9 A;  1WNO A;  1TFV A;  1NWT A;  1LG2 A;  2KO7 A;  2RUR A;  2ZR5 A;  4S3J A;  2F21 A;  3NTP A;  2ZQT A;  4LAX A;  2ITK A;  4ML4 A;  3MDY B;  3O5G A;  1HJW A;  1ROT A;  3ARV A;  3CH9 A;  1QPL A;  4DH0 A;  2LPV A;  3ART A;  2DG3 A;  1L1P A;  1WB0 A;  2VCD A;  3AS3 A;  4AY1 A;  1HKK A;  1ZBW A;  3TC5 A;  1RD6 A;  2KI3 A;  1HJV A;  4DZ3 A;  3ARR A;  3ARY A;  2DPE A;  2K8I A;  3ARO A;  3UQI A;  2KR7 A;  4NNR A;  1FKI A;  2XP3 A;  4XAK A;  2QF8 A;  4TW7 A;  4ODP A;  4ZPT R;  1GUV A;  1OGB A;  1W1V A;  2A3B A;  3OA5 A;  2LGO A;  4QT2 A;  1W9V A;  2B31 A;  4DRP A;  3OOB A;  4TX0 A;  3QOK A;  5GPR A;  2XPA A;  1FFR A;  5DO2 A;  1ZBC A;  1A7X A;  3RM8 A;  2F4E A;  1HJX A;  1YAT A;  4L72 B;  3KAG A;  5HBF A;  5DIV A;  2XP5 A;  2ZR6 A;  2N87 A;  1Q1C A;  3EY6 A;  4MAV A;  3CGN A;  2MLY A;  4U85 A;  1ITX A;  3KAC A;  2WLY A;  2RUQ A;  4DRJ A;  4DZ2 A;  3O5D A;  1ZB5 A;  3VAW A;  4UDM A;  1YW5 A;  3ARS A;  2DT3 A;  2Y78 A;  1NMW A;  1UR9 A;  3WH0 A;  1HKM A;  1FKR A;  2DT2 A;  2DSV A;  2XP9 A;  3CHC A;  1OGG A;  1LL6 A;  4MNK A;  2M08 A;  4HBE A;  4ODQ A;  4WJX A;  1LJY A;  2G41 A;  1UR8 A;  4WKA A;  2AWG A;  2RUC A;  5HWC A;  1J4I A;  1NWR A;  2AOS A;  1H0G A;  1JVW A;  2XP4 A;  3O5E A;  1TCO C;  2MLZ A;  3O5J A;  4MNM A;  4G2P A;  1W1P A;  2VN1 A;  3RM9 A;  4WIW A;  3B9D A;  2OFN A;  3WD3 A;  4P8V A;  4WK9 A;  2IUZ A;  2WK2 A;  3LUO A;  2KE0 A;  2D9F A;  4QZV B;  3ALF A;  1Q6I A;  3CHF A;  3ALG A;  4DWS A;  3CHE A;  5HKG A;  2DG9 A;  2B5U B;  1CTN A;  4IQC A;  3O5M A;  1Y0O A;  4HAR A;  1W9P A;  1OWQ A;  4URI A;  5HT1 A;  2RUD A;  3I6C A;  5HWB A;  1JNS A;  3G6L A;  1W9U A;  2WLZ A;  1X6L A;  4J4N A;  3IK8 A;  3WL1 A;  3O5F A;  2PBC A;  1E6R A;  5D75 A;  2FAP A;  2ZQS A;  3AQU A;  3JXV A;  4N19 A;  2F2D A;  1LQ0 A;  3UI6 A;  4DRN A;  3B9A A;  1W1Y A;  1QPF A;  2Q5A A;  2RQS A;  1KFW A;  1B6C A;  1O6I A;  2ETN A;  3PRA A;  3UQA A;  2M2A A;  3FY1 A;  3FAP A;  1K9T A;  4Z2J A;  4P8X A;  1NMV A;  3O5L A;  3ODK A;  3PRD A;  2WM0 A;  4W9O A;  3ARP A;  5HUA A;  3KAH A;  3TCZ A;  3B9E A;  4QT3 A;  1U79 A;  1T11 A;  3FXY A;  3PA7 A;  4DRQ A;  1W1T A;  3O5O A;  1VF8 A;  2DSW A;  1FKS A;  1E6Z A;  1FKG A;  4MGV A;  3O5K A;  1ROU A;  2DSU A;  2JZV A;  4JFL A;  1FD9 A;  4W5U A;  3RME A;  2P4V A;  3IKG A;  1BL4 A;  3WQV A;  2O92 A;  3NI6 A;  4S3K A;  1KT0 A;  4JYS A;  1W26 A;  1XRV A;  4Z2L A;  1H0I A;  4DWS D;  2RSE A;  1HKI A;  2YBU A;  3H9R B;  1D7H A;  5DEZ A;  3UF8 A;  3W4R A;  4ODM A;  4MPK A;  3GU0 A;  2LJ4 A;  1Q6U A;  1E6N A;  1GPF A;  3ARW A;  1ZU8 A;  5J6E A;  1M5Y A;  4KQZ A;  3KAB A;  4P8W A;  1D6O A;  1E44 A;  3AS0 A;  2ZQU A;  2A3A A;  3WD0 A;  2XP6 A;  1JNE A;  1D2K A;  1XHG A;  2PPP A;  3ARU A;  2PV1 A;  5HW7 A;  1NSG A;  4FAP A;  1PBK A;  4LGX A;  2L2S A;  4HBO A;  3RGC A;  1Q6H A;  1QZ2 A;  1ZL1 A;  1R9H A;  1FFQ A;  4DWS B;  5I98 A;  3O5Q A;  4IPX A;  1J6Y A;  4NSB A;  4LAW A;  3RFW A;  3CGM A;  4U86 A;  2XP7 A;  1WAW A;  5DIU A;  1PIN A;  1ZCN A;  3UI4 A;  2YBT A;  4P8U A;  3NRK A;  3RM4 A;  1LL7 A;  3BXW A;  4NZC A;  4WKF A;  5HTG A;  4TW6 A;  4BF8 A;  4ZPW R;  1FAP A;  1HKJ A;  1NH6 A;  4WKH A;  5JH8 A;  4Z2K A;  4JFK A;  4MSP A;  1FKT A;  4MNL A;  1FKF A;  2OLH A;  1LL4 A;  2G8Z A;  3KZ7 A;  4IT6 A;  4TYO A;  2A3C A;  4R0X A;  1ZBK A;  1EIB A;  1ZBV A;  5GPG A;  4O2T A;  4ZS6 A;  4W9P A;  1D7I A;  3EIP A;  2ZR4 A;  2PN0 A;  2FKE A;  1EYM A;  1FKJ A;  1E9L A;  2DT0 A;  1FKD A;  1JND A;  2MLX A;  4ODR A;  2UZ5 A;  4U84 A;  2PPO A;  4J4O A;  3WIJ A;  1F40 A;  3O5P A;  4JFJ A;  2DG4 A;  2LKN A;  3G6M A;  4LAV A;  4TW8 A;  1ZK6 A;  5B8I C;  1GOI A;  1KT1 A;  4G50 A;  5DIT A;  1C9H A;  1FKL A;  4FN2 A;  3IHZ A;  2XPB A;  1SYT A;  3GPK A;  2PV2 A;  3KAD A;  4W9Q A;  1E6P A;  4QIB A;  1FKK A;  3UQB A;  4DRO A;  5HW6 A;  5GQB A;  4Q22 A;  2PI6 A;  4JFI A;  4LAY A;  4DWS C;  1P5Q A;  3B8S A;  5BXJ A;  1FKH A;  4C02 B;  2MPH A;  1E15 A;  3WD1 A;  3PR9 A;  3ARZ A;  3KAF A;  1FKB A;  2MNT A;  3AS1 A;  3B7X A;  1BKF A;  2EUL A;  2ESC A;  2KFW A;  3IKD A;  2XP8 A;  3WD4 A;  4ITZ A;  3ARQ A;  1EQ3 A;  4MNJ A;  3AS2 A;  1EHN A;  1GRJ A;  2O9O A;  1N1A A;  3BMB A;  2DT1 A;  4ODN A;  3CZ8 A;  1JNT A;  3O5I A;  4ZPV R;  4Z2I A;  4PTM A;  4GGQ A;  4Z2H A;  4L3N A;  4JFM A;  4Z2G A; 
#chains in the Genus database with same CATH homology
 3TDB A;  1SR0 A;  1X6N A;  1J4R A;  1D7J A;  1NWU A;  4R5E A;  3WD2 A;  2M1I A;  1IX5 A;  4ODK A;  2PPN A;  3JYJ A;  1J4H A;  3O5R A;  4ODO A;  2A3E A;  4DRI A;  2ZQV A;  1F8A B;  2DSZ A;  4IT4 A;  3CHD A;  3JYM A;  3ARX A;  3PRB A;  1HXV A;  4TNS A;  3WQW A;  4DRK A;  1FJD A;  4ODL A;  1EDQ A;  4DIP A;  2FDM A;  3WKZ A;  4GIV A;  4IQ2 A;  4Q7N A;  4DRH A;  1LG1 A;  2KGJ A;  4DT4 A;  2IF4 A;  3KCE A;  3UI5 A;  5DF0 A;  2PV3 A;  4KR0 B;  5HW8 A;  4MTV A;  3WL0 A;  3KAI A;  4DRM A;  1NWS A;  2MF9 A;  1WNO A;  1TFV A;  1NWT A;  1LG2 A;  2KO7 A;  2RUR A;  2ZR5 A;  4S3J A;  2F21 A;  3NTP A;  2ZQT A;  4LAX A;  2ITK A;  4ML4 A;  3MDY B;  3O5G A;  1HJW A;  1ROT A;  3ARV A;  3CH9 A;  1QPL A;  4DH0 A;  2LPV A;  3ART A;  2DG3 A;  1L1P A;  1WB0 A;  2VCD A;  3AS3 A;  4AY1 A;  1HKK A;  1ZBW A;  3TC5 A;  1RD6 A;  2KI3 A;  1HJV A;  4DZ3 A;  3ARR A;  3ARY A;  2DPE A;  2K8I A;  3ARO A;  3UQI A;  2KR7 A;  4NNR A;  1FKI A;  2XP3 A;  4XAK A;  2QF8 A;  4TW7 A;  4ODP A;  4ZPT R;  1GUV A;  1OGB A;  1W1V A;  2A3B A;  3OA5 A;  2LGO A;  4QT2 A;  1W9V A;  2B31 A;  4DRP A;  3OOB A;  4TX0 A;  3QOK A;  5GPR A;  2XPA A;  1FFR A;  5DO2 A;  1ZBC A;  1A7X A;  3RM8 A;  2F4E A;  1HJX A;  1YAT A;  4L72 B;  3KAG A;  5HBF A;  5DIV A;  2XP5 A;  2ZR6 A;  2N87 A;  1Q1C A;  3EY6 A;  4MAV A;  3CGN A;  2MLY A;  4U85 A;  1ITX A;  3KAC A;  2WLY A;  2RUQ A;  4DRJ A;  4DZ2 A;  3O5D A;  1ZB5 A;  3VAW A;  1YW5 A;  3ARS A;  2DT3 A;  2Y78 A;  1NMW A;  1UR9 A;  3WH0 A;  1HKM A;  1FKR A;  2DT2 A;  2DSV A;  2XP9 A;  3CHC A;  1OGG A;  1LL6 A;  4MNK A;  2M08 A;  4HBE A;  4ODQ A;  4WJX A;  1LJY A;  2G41 A;  1UR8 A;  4WKA A;  2AWG A;  2RUC A;  5HWC A;  1J4I A;  1NWR A;  2AOS A;  1H0G A;  1JVW A;  2XP4 A;  3O5E A;  1TCO C;  2MLZ A;  3O5J A;  4MNM A;  4G2P A;  1W1P A;  2VN1 A;  3RM9 A;  4WIW A;  3B9D A;  2OFN A;  3WD3 A;  4P8V A;  4WK9 A;  2IUZ A;  2WK2 A;  3LUO A;  2KE0 A;  2D9F A;  4QZV B;  3ALF A;  1Q6I A;  3CHF A;  3ALG A;  4DWS A;  3CHE A;  5HKG A;  2DG9 A;  1CTN A;  4IQC A;  3O5M A;  1Y0O A;  4HAR A;  1W9P A;  1OWQ A;  4URI A;  5HT1 A;  2RUD A;  3I6C A;  5HWB A;  1JNS A;  3G6L A;  1W9U A;  2WLZ A;  1X6L A;  4J4N A;  3IK8 A;  3WL1 A;  3O5F A;  2PBC A;  1E6R A;  5D75 A;  2FAP A;  2ZQS A;  3AQU A;  3JXV A;  4N19 A;  2F2D A;  1LQ0 A;  3UI6 A;  4DRN A;  3B9A A;  1W1Y A;  1QPF A;  2Q5A A;  2RQS A;  1KFW A;  1B6C A;  1O6I A;  3PRA A;  3UQA A;  2M2A A;  3FY1 A;  3FAP A;  1K9T A;  4Z2J A;  4P8X A;  1NMV A;  3O5L A;  3ODK A;  3PRD A;  2WM0 A;  4W9O A;  3ARP A;  5HUA A;  3KAH A;  3TCZ A;  3B9E A;  4QT3 A;  1U79 A;  1T11 A;  3FXY A;  3PA7 A;  4DRQ A;  1W1T A;  3O5O A;  1VF8 A;  2DSW A;  1FKS A;  1E6Z A;  1FKG A;  4MGV A;  3O5K A;  1ROU A;  2DSU A;  2JZV A;  4JFL A;  1FD9 A;  4W5U A;  3RME A;  3IKG A;  1BL4 A;  3WQV A;  2O92 A;  3NI6 A;  4S3K A;  1KT0 A;  4JYS A;  1W26 A;  1XRV A;  4Z2L A;  1H0I A;  4DWS D;  2RSE A;  1HKI A;  2YBU A;  3H9R B;  1D7H A;  5DEZ A;  3UF8 A;  3W4R A;  4ODM A;  4MPK A;  2LJ4 A;  1Q6U A;  1E6N A;  1GPF A;  3ARW A;  1ZU8 A;  5J6E A;  1M5Y A;  4KQZ A;  3KAB A;  4P8W A;  1D6O A;  3AS0 A;  2ZQU A;  2A3A A;  3WD0 A;  2XP6 A;  1JNE A;  1D2K A;  1XHG A;  2PPP A;  3ARU A;  2PV1 A;  5HW7 A;  1NSG A;  4FAP A;  1PBK A;  4LGX A;  2L2S A;  4HBO A;  3RGC A;  1Q6H A;  1QZ2 A;  1ZL1 A;  1R9H A;  1FFQ A;  4DWS B;  5I98 A;  3O5Q A;  4IPX A;  1J6Y A;  4NSB A;  4LAW A;  3RFW A;  3CGM A;  4U86 A;  2XP7 A;  1WAW A;  5DIU A;  1PIN A;  1ZCN A;  3UI4 A;  2YBT A;  4P8U A;  3NRK A;  3RM4 A;  1LL7 A;  3BXW A;  4NZC A;  4WKF A;  5HTG A;  4TW6 A;  4BF8 A;  4ZPW R;  1FAP A;  1HKJ A;  1NH6 A;  4WKH A;  5JH8 A;  4Z2K A;  4JFK A;  4MSP A;  1FKT A;  4MNL A;  1FKF A;  2OLH A;  1LL4 A;  2G8Z A;  3KZ7 A;  4IT6 A;  4TYO A;  2A3C A;  4R0X A;  1ZBK A;  1EIB A;  1ZBV A;  5GPG A;  4O2T A;  4ZS6 A;  4W9P A;  1D7I A;  2ZR4 A;  2FKE A;  1EYM A;  1FKJ A;  1E9L A;  2DT0 A;  1FKD A;  1JND A;  2MLX A;  4ODR A;  2UZ5 A;  4U84 A;  2PPO A;  4J4O A;  3WIJ A;  1F40 A;  3O5P A;  4JFJ A;  2DG4 A;  2LKN A;  3G6M A;  4LAV A;  4TW8 A;  1ZK6 A;  5B8I C;  1GOI A;  1KT1 A;  4G50 A;  5DIT A;  1C9H A;  1FKL A;  4FN2 A;  3IHZ A;  2XPB A;  1SYT A;  3GPK A;  2PV2 A;  3KAD A;  4W9Q A;  1E6P A;  4QIB A;  1FKK A;  3UQB A;  4DRO A;  5HW6 A;  5GQB A;  4Q22 A;  2PI6 A;  4JFI A;  4LAY A;  4DWS C;  1P5Q A;  3B8S A;  5BXJ A;  1FKH A;  4C02 B;  2MPH A;  1E15 A;  3WD1 A;  3PR9 A;  3ARZ A;  3KAF A;  1FKB A;  2MNT A;  3AS1 A;  3B7X A;  1BKF A;  2KFW A;  2ESC A;  3IKD A;  2XP8 A;  3WD4 A;  4ITZ A;  3ARQ A;  1EQ3 A;  4MNJ A;  3AS2 A;  1EHN A;  2O9O A;  1N1A A;  2DT1 A;  4ODN A;  3CZ8 A;  1JNT A;  3O5I A;  4ZPV R;  4Z2I A;  4PTM A;  4GGQ A;  4Z2H A;  4L3N A;  4JFM A;  4Z2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...