3RGCA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
251
structure length
248
Chain Sequence
NAIAVVVDKEPITTYDIDQTMKALKIDRNKALGVLINEKMEISQMKQLGIVVNDLELDDAINKMLAQNKTTLNAFKANLKSSYEQFRTNFKKDLEKRKLYEKIASMAKTDFSDDGAKKFFEQNKDKFTFYTQINANIYLSNNPQTLENIKNTKKTILKPQNASLNTSNADPRLLGLLSQIPVGSFSPVLNGKNGYELYEVKSKDGTQTPEYEQVKNEVLNAYVSEQRQNFIQDYFDKLRSKINIEYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Chaperone
molecule keywords Possible periplasmic protein
total genus 81
structure length 248
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09312 SurA_N SurA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4030.30 Mainly Alpha Orthogonal Bundle Triger factor/SurA peptide-binding fold Triger factor/SurA peptide-binding fold 3rgcA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rgcA02
4MSPA 3IKGA 1M5YA 3RGCA 4TW8A 4J4OA 5DIUA 2XP5A 5HKGA 1NSGA 4ODPA 3KZ7A 1ROUA 4JFJA 3IK8A 1F40A 1FD9A 1FKIA 4G50A 2M08A 1KT0A 2RUDA 3NI6A 3O5EA 3PA7A 4ITZA 4ODRA 2DG3A 3VAWA 1FKFA 2XP7A 3IHZA 1FJDA 1D7IA 4O2TA 1J4IA 4U86A 3UI5A 2KGJA 3ODKA 1HXVA 5HUAA 2DG4A 2XP4A 1NMWA 1ZK6A 3KACA 2RUCA 1Q6UA 1A7XA 4NNRA 5J6EA 2JZVA 3O5PA 1F8AB 1YW5A 3JYMA 3CGMA 2LJ4A 2AWGA 3O5OA 2DG9A 4IQCA 4ODKA 4DROA 1KT1A 4TX0A 3O5DA 1QZ2A 1D7HA 2MLXA 2VCDA 4R0XA 5HW6A 4BF8A 4ODNA 3KAIA 3TC5A 3IKDA 2LKNA 2M1IA 2PPOA 4GIVA 4JYSA 4U85A 2PV2A 1Q6IA 2Q5AA 2MNTA 1YATA 2ZR5A 3NTPA 1FKGA 2FKEA 2N87A 1FKDA 4U84A 4DRKA 5HW7A 1FKRA 1Q6HA 1ZCNA 2VN1A 1J4RA 3FAPA 1U79A 4W9OA 4ODMA 3CGNA 2LPVA 3UQIA 4DT4A 4MGVA 5GPGA 4W9PA 2RURA 1FKHA 4JFKA 2PV3A 2LGOA 4ODLA 3RFWA 4DRJA 3KABA 3TCZA 3TDBA 3UI4A 5B8IC 1BKFA 5HTGA 4ODOA 3PRBA 4IPXA 2K8IA 3H9RB 3JYJA 4FN2A 3O5LA 2XP9A 2KO7A 2RSEA 4GGQA 4JFLA 1BL4A 2ITKA 1L1PA 5HT1A 1QPFA 1EYMA 1W26A 2ZQTA 2XPBA 1QPLA 4QIBA 3O5KA 4LAWA 4DRIA 4QT2A 5DIVA 1JNTA 2FAPA 1EQ3A 4N19A 3O5FA 4DZ3A 5BXJA 2MF9A 1FKJA 2RQSA 4DH0A 5HW8A 1Y0OA 2XP8A 3OOBA 1N1AA 2XP6A 1TCOC 3UQBA 1JNSA 1D7JA 1FAPA 2ZQUA 3GPKA 1PBKA 1FKSA 2PPNA 3EY6A 1C9HA 2MPHA 3O5IA 4TYOA 4DRQA 4TNSA 5D75A 3O5JA 4IQ2A 2XPAA 2MLZA 4DRNA 1PINA 1B6CA 3O5QA 4QT3A 5I98A 4TW7A 3O5GA 2F21A 1FKBA 3WH0A 3NRKA 4FAPA 1R9HA 4TW6A 4ODQA 4DRHA 3KAHA 4DIPA 3KAGA 3UQAA 3KADA 2IF4A 3O5RA 2PBCA 3JXVA 4DZ2A 5HWCA 2PV1A 3KAFA 2M2AA 3O5MA 4JFIA 3KCEA 2Y78A 4W9QA 1ROTA 2KE0A 2ZQSA 1FKLA 2ZR6A 4LAVA 3I6CA 4G2PA 2UZ5A 4LAXA 2MLYA 1FKKA 2OFNA 1P5QA 4LAYA 3UI6A 4C02B 5HWBA 1JVWA 1J6YA 2L2SA 4DRPA 2XP3A 1FKTA 2ZQVA 1NMVA 1D6OA 3LUOA 2KI3A 5DITA 1Q1CA 4J4NA 3UF8A 3MDYB 4JFMA 2RUQA 2KR7A 4DRMA 1T11A 2D9FA 2PPPA 2F4EA 2ZR4A 1J4HA 2F2DA 3PRDA 2KFWA 3B7XA
chains in the Genus database with same CATH superfamily
3RGCA 3ARVA 4ML4A 3ARUA 1NSGA 3FXYA 4WK9A 3IHZA 1FJDA 4O2TA 4U86A 3UI5A 2DT0A 3ODKA 2DG4A 1ZB5A 2XP4A 1ZBVA 2RUCA 4WIWA 1Q6UA 1A7XA 4NNRA 2JZVA 1F8AB 1YW5A 2DPEA 4IQCA 2WK2A 2VCDA 3ARYA 1FFRA 5JH8A 4XAKA 2PV2A 1YATA 3NTPA 2FKEA 1Q6HA 1ZCNA 1X6LA 1JNDA 1W1YA 1RD6A 1EIBA 3CHEA 2RURA 1NWTA 4JFKA 2DSUA 3TCZA 3AROA 2IUZA 4ZPVR 4ODOA 3PRBA 4IPXA 2KO7A 4DWSD 5HT1A 1EYMA 4Z2GA 2ZQTA 2G41A 3RM4A 1QPLA 3O5KA 1TFVA 4DRIA 2FAPA 3B9AA 4ZPWR 5BXJA 2RQSA 1HKMA 3ARTA 1Y0OA 3CHFA 3OOBA 2XP6A 1JCHB 4Z2JA 1FKSA 2PPNA 3EY6A 3O5IA 4TNSA 2A3BA 3O5JA 4DRNA 1B6CA 3O5QA 2F21A 1FKBA 3GTYX 2DT2A 4FAPA 4DRHA 1HJVA 3KADA 4MNJA 1OGGA 1X6NA 3KAFA 4W9QA 1ROTA 2ZQSA 1FKLA 1ZL1A 3I6CA 4LAVA 2OFNA 2DT1A 4P8VA 1J6YA 2L2SA 3B9DA 2A3CA 2ZQVA 3ARZA 2PPPA 1NWSA 1NWUA 2M08A 1EDQA 2F2DA 4LAWA 3B7XA 1O6IA 5GPRA 5DF0A 5DIUA 1UR9A 3KZ7A 4WKAA 3VAWA 1KT0A 2RUDA 4ODRA 5HUAA 1FKFA 1JNEA 2WLZA 1J4IA 2KGJA 3RMEA 4ZPTR 3WQVA 4P8WA 1ZK6A 3KACA 2DT3A 4MAVA 5J6EA 4URIA 3O5OA 2DG9A 5HW6A 3TC5A 3KAIA 4GIVA 4JYSA 4Z2IA 1E9LA 4Z2HA 1SYTA 5HW7A 1FKGA 4WJXA 3ARXA 3EIPA 1XHGA 2VN1A 1IX5A 5GPGA 2PV3A 2LGOA 4DRJA 3TDBA 1E6RA 3H9RB 1E44A 4WKFA 1HJXA 3OA5A 1GRJA 3ARSA 4JFLA 2ITKA 4KR0B 1XRVA 2FDMA 2QF8A 4QT2A 1JNTA 1EQ3A 4N19A 2MF9A 1FKJA 5HW8A 3WKZA 1N1AA 1LL6A 1TCOC 4IT6A 3WD4A 3UQBA 1JNSA 1D7JA 2ZQUA 4HBOA 2O92A 4TYOA 4DWSC 1GOIA 1GUVA 5D75A 2XPAA 4HBEA 4MNMA 1PINA 4QT3A 5I98A 3O5GA 3AS2A 3CZ8A 4UDMA 1R9HA 4ODQA 3KAHA 4QZVB 3UQAA 2PI6A 2PBCA 5HWCA 3B8SA 3PR9A 3O5MA 4JFIA 3KCEA 2ZR6A 1CTNA 2MLYA 4Q7NA 3UI6A 4DRPA 3G6LA 2XP3A 1NMVA 1LG2A 2A3AA 2KI3A 3CHDA 4MNKA 5DITA 1ZU8A 4AY1A 1W1TA 2F4EA 1WAWA 4IT4A 3PRDA 4MSPA 3IKGA 4TW8A 2ETNA 3AQUA 5HKGA 1ROUA 1FD9A 1FKIA 4G50A 3PA7A 3BMBA 3NI6A 4ITZA 3ARPA 2DG3A 2XP7A 1D7IA 4KQZA 1HXVA 3WD0A 3BXWA 1W9PA 2WM0A 1E6PA 3JYMA 3CGMA 2LJ4A 4ODKA 1HJWA 1KT1A 3O5DA 1D7HA 4Z2LA 3IKDA 4U85A 4Q22A 2O9OA 1E6ZA 1FKDA 4R5EA 4U84A 1FKRA 4Z2KA 4NZCA 2DSWA 2ESCA 3ALGA 3FAPA 1U79A 4W9OA 4ODMA 3CGNA 2LPVA 2OLHA 3AS3A 3UQIA 4DT4A 4MGVA 4W9PA 1FKHA 5HBFA 1KFWA 4ODLA 3RFWA 3KABA 2B31A 1VF8A 3UI4A 4MPKA 5B8IC 5HTGA 3JYJA 1W1PA 1LL7A 1ZBKA 2YBUA 1BL4A 1L1PA 4S3KA 3WL0A 3WD3A 4QIBA 4DWSB 3GU0A 5DIVA 1FFQA 3O5FA 2XP8A 3W4RA 3G6MA 1FAPA 3GPKA 3RM9A 4PTMA 2MLZA 1H0GA 3ARQA 3WH0A 2PN0A 1W1VA 2EULA 2IF4A 4DRMA 2M2AA 4MTVA 2KE0A 4G2PA 3WD2A 3QOKA 4LAXA 4C02B 1ZBCA 3ARWA 3CH9A 3LUOA 1D6OA 4J4NA 4JFMA 2RUQA 2KR7A 1T11A 2D9FA 2ZR4A 1J4HA 2KFWA 4WKHA 1M5YA 2AOSA 1W9UA 1LG1A 4J4OA 5DO2A 2XP5A 4ODPA 1F40A 4LGXA 4JFJA 3IK8A 3O5EA 2P4VA 1LQ0A 3CHCA 2DSVA 3RM8A 3WD1A 3B9EA 1NH6A 1NMWA 4S3JA 1D2KA 3O5PA 3ARRA 1E6NA 2AWGA 2WLYA 4DROA 1OGBA 4TX0A 1QZ2A 4R0XA 1OWQA 2MLXA 4BF8A 1W9VA 4ODNA 1UR8A 2G8ZA 3WIJA 2LKNA 2M1IA 2PPOA 1Q6IA 2Q5AA 2MNTA 2ZR5A 2N87A 4DRKA 5DEZA 1J4RA 3WL1A 4L72B 1HKJA 4L3NA 4HARA 1SR0A 2B5UB 4ZS6A 1EHNA 3PRAA 1K9TA 2F23A 4MNLA 1NWRA 1BKFA 2K8IA 4FN2A 3O5LA 2XP9A 4GGQA 2RSEA 1LJYA 1WNOA 2A3EA 1QPFA 1W26A 2XPBA 1ZBWA 4NSBA 1HKKA 3FY1A 2YBTA 4DZ3A 4DH0A 4P8XA 2DSZA 1LL4A 1PBKA 1C9HA 2MPHA 4DRQA 1WB0A 4IQ2A 4TW7A 3NRKA 1HKIA 4DWSA 4TW6A 4DIPA 3AS0A 3KAGA 3O5RA 3JXVA 4DZ2A 2PV1A 1H0IA 4P8UA 2Y78A 5GQBA 3AS1A 3WQWA 2UZ5A 3ALFA 5HWBA 1FKKA 4LAYA 1P5QA 1ITXA 1JVWA 1E15A 1FKTA 1Q1CA 3UF8A 3MDYB 4W5UA 1GPFA
chains in the Genus database with same CATH topology
3RGCA 3ARVA 4ML4A 3ARUA 1NSGA 3FXYA 4WK9A 3IHZA 1FJDA 4O2TA 4U86A 3UI5A 2DT0A 3ODKA 2DG4A 1ZB5A 2XP4A 1ZBVA 2RUCA 4WIWA 1Q6UA 1A7XA 4NNRA 2JZVA 1F8AB 1YW5A 2DPEA 4IQCA 2WK2A 2VCDA 3ARYA 1FFRA 5JH8A 4XAKA 2PV2A 1YATA 3NTPA 2FKEA 1Q6HA 1ZCNA 1X6LA 1JNDA 1W1YA 1RD6A 1EIBA 3CHEA 2RURA 1NWTA 4JFKA 2DSUA 3TCZA 3AROA 2IUZA 4ZPVR 4ODOA 3PRBA 4IPXA 2KO7A 4DWSD 5HT1A 1EYMA 4Z2GA 2ZQTA 2G41A 3RM4A 1QPLA 3O5KA 1TFVA 4DRIA 2FAPA 3B9AA 4ZPWR 5BXJA 2RQSA 1HKMA 3ARTA 1Y0OA 3CHFA 3OOBA 2XP6A 4Z2JA 1FKSA 2PPNA 3EY6A 3O5IA 4TNSA 2A3BA 3O5JA 4DRNA 1B6CA 3O5QA 2F21A 1FKBA 2DT2A 4FAPA 4DRHA 1HJVA 3KADA 4MNJA 1OGGA 1X6NA 3KAFA 4W9QA 1ROTA 2ZQSA 1FKLA 1ZL1A 3I6CA 4LAVA 2OFNA 2DT1A 4P8VA 1J6YA 2L2SA 3B9DA 2A3CA 2ZQVA 3ARZA 2PPPA 1NWSA 1NWUA 2M08A 1EDQA 2F2DA 4LAWA 3B7XA 1O6IA 5GPRA 5DF0A 5DIUA 1UR9A 3KZ7A 4WKAA 3VAWA 1KT0A 2RUDA 4ODRA 5HUAA 1FKFA 1JNEA 2WLZA 1J4IA 2KGJA 3RMEA 4ZPTR 3WQVA 4P8WA 1ZK6A 3KACA 2DT3A 4MAVA 5J6EA 4URIA 3O5OA 2DG9A 5HW6A 3TC5A 3KAIA 4GIVA 4JYSA 4Z2IA 1E9LA 4Z2HA 1SYTA 5HW7A 1FKGA 4WJXA 3ARXA 1XHGA 2VN1A 1IX5A 5GPGA 2PV3A 2LGOA 4DRJA 3TDBA 1E6RA 3H9RB 4WKFA 1HJXA 3OA5A 3ARSA 4JFLA 2ITKA 4KR0B 1XRVA 2FDMA 2QF8A 4QT2A 1JNTA 1EQ3A 4N19A 2MF9A 1FKJA 5HW8A 3WKZA 1N1AA 1LL6A 1TCOC 4IT6A 3WD4A 3UQBA 1JNSA 1D7JA 2ZQUA 4HBOA 2O92A 4TYOA 4DWSC 1GOIA 1GUVA 5D75A 2XPAA 4HBEA 4MNMA 1PINA 4QT3A 5I98A 3O5GA 3AS2A 3CZ8A 1R9HA 4ODQA 3KAHA 4QZVB 3UQAA 2PI6A 2PBCA 5HWCA 3B8SA 3PR9A 4JFIA 3O5MA 3KCEA 2ZR6A 1CTNA 2MLYA 4Q7NA 3UI6A 4DRPA 3G6LA 2XP3A 1NMVA 1LG2A 2A3AA 2KI3A 3CHDA 4MNKA 5DITA 1ZU8A 4AY1A 1W1TA 2F4EA 1WAWA 4IT4A 3PRDA 4MSPA 3IKGA 4TW8A 5HKGA 3AQUA 1ROUA 1FD9A 1FKIA 4G50A 3PA7A 3NI6A 4ITZA 3ARPA 2DG3A 2XP7A 1D7IA 4KQZA 1HXVA 3WD0A 3BXWA 1W9PA 2WM0A 1E6PA 3JYMA 3CGMA 2LJ4A 4ODKA 1HJWA 1KT1A 3O5DA 1D7HA 4Z2LA 3IKDA 4U85A 4Q22A 2O9OA 1E6ZA 1FKDA 4R5EA 4U84A 1FKRA 4Z2KA 4NZCA 2DSWA 2ESCA 3ALGA 3FAPA 1U79A 4W9OA 4ODMA 3CGNA 2LPVA 2OLHA 3AS3A 3UQIA 4DT4A 4MGVA 4W9PA 1FKHA 5HBFA 1KFWA 4ODLA 3RFWA 3KABA 2B31A 1VF8A 3UI4A 4MPKA 5B8IC 5HTGA 3JYJA 1W1PA 1LL7A 1ZBKA 2YBUA 1BL4A 1L1PA 4S3KA 3WL0A 3WD3A 4QIBA 4DWSB 5DIVA 1FFQA 3O5FA 2XP8A 3W4RA 3G6MA 1FAPA 3GPKA 3RM9A 4PTMA 2MLZA 1H0GA 3ARQA 3WH0A 1W1VA 2IF4A 4DRMA 2M2AA 4MTVA 2KE0A 4G2PA 3WD2A 3QOKA 4LAXA 4C02B 1ZBCA 3ARWA 3CH9A 3LUOA 1D6OA 4J4NA 4JFMA 2RUQA 2KR7A 1T11A 2D9FA 2ZR4A 1J4HA 2KFWA 4WKHA 1M5YA 2AOSA 1W9UA 1LG1A 4J4OA 5DO2A 2XP5A 4ODPA 1F40A 4LGXA 4JFJA 3IK8A 3O5EA 1LQ0A 3CHCA 2DSVA 3RM8A 3WD1A 3B9EA 1NH6A 1NMWA 4S3JA 1D2KA 3O5PA 3ARRA 1E6NA 2AWGA 2WLYA 4DROA 1OGBA 4TX0A 1QZ2A 4R0XA 1OWQA 2MLXA 4BF8A 1W9VA 4ODNA 1UR8A 2G8ZA 3WIJA 2LKNA 2M1IA 2PPOA 1Q6IA 2Q5AA 2MNTA 2ZR5A 2N87A 4DRKA 5DEZA 1J4RA 3WL1A 4L72B 1HKJA 4L3NA 4HARA 1SR0A 4ZS6A 1EHNA 3PRAA 1K9TA 4MNLA 1NWRA 1BKFA 2K8IA 4FN2A 3O5LA 2XP9A 4GGQA 2RSEA 1LJYA 1WNOA 2A3EA 1QPFA 1W26A 2XPBA 1ZBWA 4NSBA 1HKKA 3FY1A 2YBTA 4DZ3A 4DH0A 4P8XA 2DSZA 1LL4A 1PBKA 1C9HA 2MPHA 4DRQA 1WB0A 4IQ2A 4TW7A 3NRKA 1HKIA 4DWSA 4TW6A 4DIPA 3AS0A 3KAGA 3O5RA 3JXVA 4DZ2A 2PV1A 1H0IA 4P8UA 2Y78A 5GQBA 3AS1A 3WQWA 2UZ5A 3ALFA 5HWBA 1FKKA 4LAYA 1P5QA 1ITXA 1JVWA 1E15A 1FKTA 1Q1CA 3UF8A 3MDYB 4W5UA 1GPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSP A;  3IKG A;  1M5Y A;  3RGC A;  4TW8 A;  4J4O A;  5DIU A;  2XP5 A;  5HKG A;  1NSG A;  4ODP A;  3KZ7 A;  1ROU A;  4JFJ A;  3IK8 A;  1F40 A;  1FD9 A;  1FKI A;  4G50 A;  2M08 A;  1KT0 A;  2RUD A;  3NI6 A;  3O5E A;  3PA7 A;  4ITZ A;  4ODR A;  2DG3 A;  3VAW A;  1FKF A;  2XP7 A;  3IHZ A;  1FJD A;  1D7I A;  4O2T A;  1J4I A;  4U86 A;  3UI5 A;  2KGJ A;  3ODK A;  1HXV A;  5HUA A;  2DG4 A;  2XP4 A;  1NMW A;  1ZK6 A;  3KAC A;  2RUC A;  1Q6U A;  1A7X A;  4NNR A;  5J6E A;  2JZV A;  3O5P A;  1F8A B;  1YW5 A;  3JYM A;  3CGM A;  2LJ4 A;  2AWG A;  3O5O A;  2DG9 A;  4IQC A;  4ODK A;  4DRO A;  1KT1 A;  4TX0 A;  3O5D A;  1QZ2 A;  1D7H A;  2MLX A;  2VCD A;  4R0X A;  5HW6 A;  4BF8 A;  4ODN A;  3KAI A;  3TC5 A;  3IKD A;  2LKN A;  2M1I A;  2PPO A;  4GIV A;  4JYS A;  4U85 A;  2PV2 A;  1Q6I A;  2Q5A A;  2MNT A;  1YAT A;  2ZR5 A;  3NTP A;  1FKG A;  2FKE A;  2N87 A;  1FKD A;  4U84 A;  4DRK A;  5HW7 A;  1FKR A;  1Q6H A;  1ZCN A;  2VN1 A;  1J4R A;  3FAP A;  1U79 A;  4W9O A;  4ODM A;  3CGN A;  2LPV A;  3UQI A;  4DT4 A;  4MGV A;  5GPG A;  4W9P A;  2RUR A;  1FKH A;  4JFK A;  2PV3 A;  2LGO A;  4ODL A;  3RFW A;  4DRJ A;  3KAB A;  3TCZ A;  3TDB A;  3UI4 A;  5B8I C;  1BKF A;  5HTG A;  4ODO A;  3PRB A;  4IPX A;  2K8I A;  3H9R B;  3JYJ A;  4FN2 A;  3O5L A;  2XP9 A;  2KO7 A;  2RSE A;  4GGQ A;  4JFL A;  1BL4 A;  2ITK A;  1L1P A;  5HT1 A;  1QPF A;  1EYM A;  1W26 A;  2ZQT A;  2XPB A;  1QPL A;  4QIB A;  3O5K A;  4LAW A;  4DRI A;  4QT2 A;  5DIV A;  1JNT A;  2FAP A;  1EQ3 A;  4N19 A;  3O5F A;  4DZ3 A;  5BXJ A;  2MF9 A;  1FKJ A;  2RQS A;  4DH0 A;  5HW8 A;  1Y0O A;  2XP8 A;  3OOB A;  1N1A A;  2XP6 A;  1TCO C;  3UQB A;  1JNS A;  1D7J A;  1FAP A;  2ZQU A;  3GPK A;  1PBK A;  1FKS A;  2PPN A;  3EY6 A;  1C9H A;  2MPH A;  3O5I A;  4TYO A;  4DRQ A;  4TNS A;  5D75 A;  3O5J A;  4IQ2 A;  2XPA A;  2MLZ A;  4DRN A;  1PIN A;  1B6C A;  3O5Q A;  4QT3 A;  5I98 A;  4TW7 A;  3O5G A;  2F21 A;  1FKB A;  3WH0 A;  3NRK A;  4FAP A;  1R9H A;  4TW6 A;  4ODQ A;  4DRH A;  3KAH A;  4DIP A;  3KAG A;  3UQA A;  3KAD A;  2IF4 A;  3O5R A;  2PBC A;  3JXV A;  4DZ2 A;  5HWC A;  2PV1 A;  3KAF A;  2M2A A;  3O5M A;  4JFI A;  3KCE A;  2Y78 A;  4W9Q A;  1ROT A;  2KE0 A;  2ZQS A;  1FKL A;  2ZR6 A;  4LAV A;  3I6C A;  4G2P A;  2UZ5 A;  4LAX A;  2MLY A;  1FKK A;  2OFN A;  1P5Q A;  4LAY A;  3UI6 A;  4C02 B;  5HWB A;  1JVW A;  1J6Y A;  2L2S A;  4DRP A;  2XP3 A;  1FKT A;  2ZQV A;  1NMV A;  1D6O A;  3LUO A;  2KI3 A;  5DIT A;  1Q1C A;  4J4N A;  3UF8 A;  3MDY B;  4JFM A;  2RUQ A;  2KR7 A;  4DRM A;  1T11 A;  2D9F A;  2PPP A;  2F4E A;  2ZR4 A;  1J4H A;  2F2D A;  3PRD A;  2KFW A;  3B7X A; 
#chains in the Genus database with same CATH topology
 3RGC A;  3ARV A;  4ML4 A;  3ARU A;  1NSG A;  3FXY A;  4WK9 A;  3IHZ A;  1FJD A;  4O2T A;  4U86 A;  3UI5 A;  2DT0 A;  3ODK A;  2DG4 A;  1ZB5 A;  2XP4 A;  1ZBV A;  2RUC A;  4WIW A;  1Q6U A;  1A7X A;  4NNR A;  2JZV A;  1F8A B;  1YW5 A;  2DPE A;  4IQC A;  2WK2 A;  2VCD A;  3ARY A;  1FFR A;  5JH8 A;  4XAK A;  2PV2 A;  1YAT A;  3NTP A;  2FKE A;  1Q6H A;  1ZCN A;  1X6L A;  1JND A;  1W1Y A;  1RD6 A;  1EIB A;  3CHE A;  2RUR A;  1NWT A;  4JFK A;  2DSU A;  3TCZ A;  3ARO A;  2IUZ A;  4ZPV R;  4ODO A;  3PRB A;  4IPX A;  2KO7 A;  4DWS D;  5HT1 A;  1EYM A;  4Z2G A;  2ZQT A;  2G41 A;  3RM4 A;  1QPL A;  3O5K A;  1TFV A;  4DRI A;  2FAP A;  3B9A A;  4ZPW R;  5BXJ A;  2RQS A;  1HKM A;  3ART A;  1Y0O A;  3CHF A;  3OOB A;  2XP6 A;  1JCH B;  4Z2J A;  1FKS A;  2PPN A;  3EY6 A;  3O5I A;  4TNS A;  2A3B A;  3O5J A;  4DRN A;  1B6C A;  3O5Q A;  2F21 A;  1FKB A;  3GTY X;  2DT2 A;  4FAP A;  4DRH A;  1HJV A;  3KAD A;  4MNJ A;  1OGG A;  1X6N A;  3KAF A;  4W9Q A;  1ROT A;  2ZQS A;  1FKL A;  1ZL1 A;  3I6C A;  4LAV A;  2OFN A;  2DT1 A;  4P8V A;  1J6Y A;  2L2S A;  3B9D A;  2A3C A;  2ZQV A;  3ARZ A;  2PPP A;  1NWS A;  1NWU A;  2M08 A;  1EDQ A;  2F2D A;  4LAW A;  3B7X A;  1O6I A;  5GPR A;  5DF0 A;  5DIU A;  1UR9 A;  3KZ7 A;  4WKA A;  3VAW A;  1KT0 A;  2RUD A;  4ODR A;  5HUA A;  1FKF A;  1JNE A;  2WLZ A;  1J4I A;  2KGJ A;  3RME A;  4ZPT R;  3WQV A;  4P8W A;  1ZK6 A;  3KAC A;  2DT3 A;  4MAV A;  5J6E A;  4URI A;  3O5O A;  2DG9 A;  5HW6 A;  3TC5 A;  3KAI A;  4GIV A;  4JYS A;  4Z2I A;  1E9L A;  4Z2H A;  1SYT A;  5HW7 A;  1FKG A;  4WJX A;  3ARX A;  3EIP A;  1XHG A;  2VN1 A;  1IX5 A;  5GPG A;  2PV3 A;  2LGO A;  4DRJ A;  3TDB A;  1E6R A;  3H9R B;  1E44 A;  4WKF A;  1HJX A;  3OA5 A;  1GRJ A;  3ARS A;  4JFL A;  2ITK A;  4KR0 B;  1XRV A;  2FDM A;  2QF8 A;  4QT2 A;  1JNT A;  1EQ3 A;  4N19 A;  2MF9 A;  1FKJ A;  5HW8 A;  3WKZ A;  1N1A A;  1LL6 A;  1TCO C;  4IT6 A;  3WD4 A;  3UQB A;  1JNS A;  1D7J A;  2ZQU A;  4HBO A;  2O92 A;  4TYO A;  4DWS C;  1GOI A;  1GUV A;  5D75 A;  2XPA A;  4HBE A;  4MNM A;  1PIN A;  4QT3 A;  5I98 A;  3O5G A;  3AS2 A;  3CZ8 A;  4UDM A;  1R9H A;  4ODQ A;  3KAH A;  4QZV B;  3UQA A;  2PI6 A;  2PBC A;  5HWC A;  3B8S A;  3PR9 A;  3O5M A;  4JFI A;  3KCE A;  2ZR6 A;  1CTN A;  2MLY A;  4Q7N A;  3UI6 A;  4DRP A;  3G6L A;  2XP3 A;  1NMV A;  1LG2 A;  2A3A A;  2KI3 A;  3CHD A;  4MNK A;  5DIT A;  1ZU8 A;  4AY1 A;  1W1T A;  2F4E A;  1WAW A;  4IT4 A;  3PRD A;  4MSP A;  3IKG A;  4TW8 A;  2ETN A;  3AQU A;  5HKG A;  1ROU A;  1FD9 A;  1FKI A;  4G50 A;  3PA7 A;  3BMB A;  3NI6 A;  4ITZ A;  3ARP A;  2DG3 A;  2XP7 A;  1D7I A;  4KQZ A;  1HXV A;  3WD0 A;  3BXW A;  1W9P A;  2WM0 A;  1E6P A;  3JYM A;  3CGM A;  2LJ4 A;  4ODK A;  1HJW A;  1KT1 A;  3O5D A;  1D7H A;  4Z2L A;  3IKD A;  4U85 A;  4Q22 A;  2O9O A;  1E6Z A;  1FKD A;  4R5E A;  4U84 A;  1FKR A;  4Z2K A;  4NZC A;  2DSW A;  2ESC A;  3ALG A;  3FAP A;  1U79 A;  4W9O A;  4ODM A;  3CGN A;  2LPV A;  2OLH A;  3AS3 A;  3UQI A;  4DT4 A;  4MGV A;  4W9P A;  1FKH A;  5HBF A;  1KFW A;  4ODL A;  3RFW A;  3KAB A;  2B31 A;  1VF8 A;  3UI4 A;  4MPK A;  5B8I C;  5HTG A;  3JYJ A;  1W1P A;  1LL7 A;  1ZBK A;  2YBU A;  1BL4 A;  1L1P A;  4S3K A;  3WL0 A;  3WD3 A;  4QIB A;  4DWS B;  3GU0 A;  5DIV A;  1FFQ A;  3O5F A;  2XP8 A;  3W4R A;  3G6M A;  1FAP A;  3GPK A;  3RM9 A;  4PTM A;  2MLZ A;  1H0G A;  3ARQ A;  3WH0 A;  2PN0 A;  1W1V A;  2EUL A;  2IF4 A;  4DRM A;  2M2A A;  4MTV A;  2KE0 A;  4G2P A;  3WD2 A;  3QOK A;  4LAX A;  4C02 B;  1ZBC A;  3ARW A;  3CH9 A;  3LUO A;  1D6O A;  4J4N A;  4JFM A;  2RUQ A;  2KR7 A;  1T11 A;  2D9F A;  2ZR4 A;  1J4H A;  2KFW A;  4WKH A;  1M5Y A;  2AOS A;  1W9U A;  1LG1 A;  4J4O A;  5DO2 A;  2XP5 A;  4ODP A;  1F40 A;  4LGX A;  4JFJ A;  3IK8 A;  3O5E A;  2P4V A;  1LQ0 A;  3CHC A;  2DSV A;  3RM8 A;  3WD1 A;  3B9E A;  1NH6 A;  1NMW A;  4S3J A;  1D2K A;  3O5P A;  3ARR A;  1E6N A;  2AWG A;  2WLY A;  4DRO A;  1OGB A;  4TX0 A;  1QZ2 A;  4R0X A;  1OWQ A;  2MLX A;  4BF8 A;  1W9V A;  4ODN A;  1UR8 A;  2G8Z A;  3WIJ A;  2LKN A;  2M1I A;  2PPO A;  1Q6I A;  2Q5A A;  2MNT A;  2ZR5 A;  2N87 A;  4DRK A;  5DEZ A;  1J4R A;  3WL1 A;  4L72 B;  1HKJ A;  4L3N A;  4HAR A;  1SR0 A;  2B5U B;  4ZS6 A;  1EHN A;  3PRA A;  1K9T A;  2F23 A;  4MNL A;  1NWR A;  1BKF A;  2K8I A;  4FN2 A;  3O5L A;  2XP9 A;  4GGQ A;  2RSE A;  1LJY A;  1WNO A;  2A3E A;  1QPF A;  1W26 A;  2XPB A;  1ZBW A;  4NSB A;  1HKK A;  3FY1 A;  2YBT A;  4DZ3 A;  4DH0 A;  4P8X A;  2DSZ A;  1LL4 A;  1PBK A;  1C9H A;  2MPH A;  4DRQ A;  1WB0 A;  4IQ2 A;  4TW7 A;  3NRK A;  1HKI A;  4DWS A;  4TW6 A;  4DIP A;  3AS0 A;  3KAG A;  3O5R A;  3JXV A;  4DZ2 A;  2PV1 A;  1H0I A;  4P8U A;  2Y78 A;  5GQB A;  3AS1 A;  3WQW A;  2UZ5 A;  3ALF A;  5HWB A;  1FKK A;  4LAY A;  1P5Q A;  1ITX A;  1JVW A;  1E15 A;  1FKT A;  1Q1C A;  3UF8 A;  3MDY B;  4W5U A;  1GPF A; 
#chains in the Genus database with same CATH homology
 3RGC A;  3ARV A;  4ML4 A;  3ARU A;  1NSG A;  3FXY A;  4WK9 A;  3IHZ A;  1FJD A;  4O2T A;  4U86 A;  3UI5 A;  2DT0 A;  3ODK A;  2DG4 A;  1ZB5 A;  2XP4 A;  1ZBV A;  2RUC A;  4WIW A;  1Q6U A;  1A7X A;  4NNR A;  2JZV A;  1F8A B;  1YW5 A;  2DPE A;  4IQC A;  2WK2 A;  2VCD A;  3ARY A;  1FFR A;  5JH8 A;  4XAK A;  2PV2 A;  1YAT A;  3NTP A;  2FKE A;  1Q6H A;  1ZCN A;  1X6L A;  1JND A;  1W1Y A;  1RD6 A;  1EIB A;  3CHE A;  2RUR A;  1NWT A;  4JFK A;  2DSU A;  3TCZ A;  3ARO A;  2IUZ A;  4ZPV R;  4ODO A;  3PRB A;  4IPX A;  2KO7 A;  4DWS D;  5HT1 A;  1EYM A;  4Z2G A;  2ZQT A;  2G41 A;  3RM4 A;  1QPL A;  3O5K A;  1TFV A;  4DRI A;  2FAP A;  3B9A A;  4ZPW R;  5BXJ A;  2RQS A;  1HKM A;  3ART A;  1Y0O A;  3CHF A;  3OOB A;  2XP6 A;  4Z2J A;  1FKS A;  2PPN A;  3EY6 A;  3O5I A;  4TNS A;  2A3B A;  3O5J A;  4DRN A;  1B6C A;  3O5Q A;  2F21 A;  1FKB A;  2DT2 A;  4FAP A;  4DRH A;  1HJV A;  3KAD A;  4MNJ A;  1OGG A;  1X6N A;  3KAF A;  4W9Q A;  1ROT A;  2ZQS A;  1FKL A;  1ZL1 A;  3I6C A;  4LAV A;  2OFN A;  2DT1 A;  4P8V A;  1J6Y A;  2L2S A;  3B9D A;  2A3C A;  2ZQV A;  3ARZ A;  2PPP A;  1NWS A;  1NWU A;  2M08 A;  1EDQ A;  2F2D A;  4LAW A;  3B7X A;  1O6I A;  5GPR A;  5DF0 A;  5DIU A;  1UR9 A;  3KZ7 A;  4WKA A;  3VAW A;  1KT0 A;  2RUD A;  4ODR A;  5HUA A;  1FKF A;  1JNE A;  2WLZ A;  1J4I A;  2KGJ A;  3RME A;  4ZPT R;  3WQV A;  4P8W A;  1ZK6 A;  3KAC A;  2DT3 A;  4MAV A;  5J6E A;  4URI A;  3O5O A;  2DG9 A;  5HW6 A;  3TC5 A;  3KAI A;  4GIV A;  4JYS A;  4Z2I A;  1E9L A;  4Z2H A;  1SYT A;  5HW7 A;  1FKG A;  4WJX A;  3ARX A;  1XHG A;  2VN1 A;  1IX5 A;  5GPG A;  2PV3 A;  2LGO A;  4DRJ A;  3TDB A;  1E6R A;  3H9R B;  4WKF A;  1HJX A;  3OA5 A;  3ARS A;  4JFL A;  2ITK A;  4KR0 B;  1XRV A;  2FDM A;  2QF8 A;  4QT2 A;  1JNT A;  1EQ3 A;  4N19 A;  2MF9 A;  1FKJ A;  5HW8 A;  3WKZ A;  1N1A A;  1LL6 A;  1TCO C;  4IT6 A;  3WD4 A;  3UQB A;  1JNS A;  1D7J A;  2ZQU A;  4HBO A;  2O92 A;  4TYO A;  4DWS C;  1GOI A;  1GUV A;  5D75 A;  2XPA A;  4HBE A;  4MNM A;  1PIN A;  4QT3 A;  5I98 A;  3O5G A;  3AS2 A;  3CZ8 A;  1R9H A;  4ODQ A;  3KAH A;  4QZV B;  3UQA A;  2PI6 A;  2PBC A;  5HWC A;  3B8S A;  3PR9 A;  4JFI A;  3O5M A;  3KCE A;  2ZR6 A;  1CTN A;  2MLY A;  4Q7N A;  3UI6 A;  4DRP A;  3G6L A;  2XP3 A;  1NMV A;  1LG2 A;  2A3A A;  2KI3 A;  3CHD A;  4MNK A;  5DIT A;  1ZU8 A;  4AY1 A;  1W1T A;  2F4E A;  1WAW A;  4IT4 A;  3PRD A;  4MSP A;  3IKG A;  4TW8 A;  5HKG A;  3AQU A;  1ROU A;  1FD9 A;  1FKI A;  4G50 A;  3PA7 A;  3NI6 A;  4ITZ A;  3ARP A;  2DG3 A;  2XP7 A;  1D7I A;  4KQZ A;  1HXV A;  3WD0 A;  3BXW A;  1W9P A;  2WM0 A;  1E6P A;  3JYM A;  3CGM A;  2LJ4 A;  4ODK A;  1HJW A;  1KT1 A;  3O5D A;  1D7H A;  4Z2L A;  3IKD A;  4U85 A;  4Q22 A;  2O9O A;  1E6Z A;  1FKD A;  4R5E A;  4U84 A;  1FKR A;  4Z2K A;  4NZC A;  2DSW A;  2ESC A;  3ALG A;  3FAP A;  1U79 A;  4W9O A;  4ODM A;  3CGN A;  2LPV A;  2OLH A;  3AS3 A;  3UQI A;  4DT4 A;  4MGV A;  4W9P A;  1FKH A;  5HBF A;  1KFW A;  4ODL A;  3RFW A;  3KAB A;  2B31 A;  1VF8 A;  3UI4 A;  4MPK A;  5B8I C;  5HTG A;  3JYJ A;  1W1P A;  1LL7 A;  1ZBK A;  2YBU A;  1BL4 A;  1L1P A;  4S3K A;  3WL0 A;  3WD3 A;  4QIB A;  4DWS B;  5DIV A;  1FFQ A;  3O5F A;  2XP8 A;  3W4R A;  3G6M A;  1FAP A;  3GPK A;  3RM9 A;  4PTM A;  2MLZ A;  1H0G A;  3ARQ A;  3WH0 A;  1W1V A;  2IF4 A;  4DRM A;  2M2A A;  4MTV A;  2KE0 A;  4G2P A;  3WD2 A;  3QOK A;  4LAX A;  4C02 B;  1ZBC A;  3ARW A;  3CH9 A;  3LUO A;  1D6O A;  4J4N A;  4JFM A;  2RUQ A;  2KR7 A;  1T11 A;  2D9F A;  2ZR4 A;  1J4H A;  2KFW A;  4WKH A;  1M5Y A;  2AOS A;  1W9U A;  1LG1 A;  4J4O A;  5DO2 A;  2XP5 A;  4ODP A;  1F40 A;  4LGX A;  4JFJ A;  3IK8 A;  3O5E A;  1LQ0 A;  3CHC A;  2DSV A;  3RM8 A;  3WD1 A;  3B9E A;  1NH6 A;  1NMW A;  4S3J A;  1D2K A;  3O5P A;  3ARR A;  1E6N A;  2AWG A;  2WLY A;  4DRO A;  1OGB A;  4TX0 A;  1QZ2 A;  4R0X A;  1OWQ A;  2MLX A;  4BF8 A;  1W9V A;  4ODN A;  1UR8 A;  2G8Z A;  3WIJ A;  2LKN A;  2M1I A;  2PPO A;  1Q6I A;  2Q5A A;  2MNT A;  2ZR5 A;  2N87 A;  4DRK A;  5DEZ A;  1J4R A;  3WL1 A;  4L72 B;  1HKJ A;  4L3N A;  4HAR A;  1SR0 A;  4ZS6 A;  1EHN A;  3PRA A;  1K9T A;  4MNL A;  1NWR A;  1BKF A;  2K8I A;  4FN2 A;  3O5L A;  2XP9 A;  4GGQ A;  2RSE A;  1LJY A;  1WNO A;  2A3E A;  1QPF A;  1W26 A;  2XPB A;  1ZBW A;  4NSB A;  1HKK A;  3FY1 A;  2YBT A;  4DZ3 A;  4DH0 A;  4P8X A;  2DSZ A;  1LL4 A;  1PBK A;  1C9H A;  2MPH A;  4DRQ A;  1WB0 A;  4IQ2 A;  4TW7 A;  3NRK A;  1HKI A;  4DWS A;  4TW6 A;  4DIP A;  3AS0 A;  3KAG A;  3O5R A;  3JXV A;  4DZ2 A;  2PV1 A;  1H0I A;  4P8U A;  2Y78 A;  5GQB A;  3AS1 A;  3WQW A;  2UZ5 A;  3ALF A;  5HWB A;  1FKK A;  4LAY A;  1P5Q A;  1ITX A;  1JVW A;  1E15 A;  1FKT A;  1Q1C A;  3UF8 A;  3MDY B;  4W5U A;  1GPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...