3RGCA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
251
structure length
248
Chain Sequence
NAIAVVVDKEPITTYDIDQTMKALKIDRNKALGVLINEKMEISQMKQLGIVVNDLELDDAINKMLAQNKTTLNAFKANLKSSYEQFRTNFKKDLEKRKLYEKIASMAKTDFSDDGAKKFFEQNKDKFTFYTQINANIYLSNNPQTLENIKNTKKTILKPQNASLNTSNADPRLLGLLSQIPVGSFSPVLNGKNGYELYEVKSKDGTQTPEYEQVKNEVLNAYVSEQRQNFIQDYFDKLRSKINIEYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Possible periplasmic protein
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
total genus 81
structure length 248
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09312 SurA_N SurA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4030.30 Mainly Alpha Orthogonal Bundle Triger factor/SurA peptide-binding fold Triger factor/SurA peptide-binding fold 3rgcA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rgcA02
2MLXA 2PPPA 3IKGA 3NI6A 1EQ3A 1FKHA 2PBCA 4JFKA 1KT1A 5HW6A 1FAPA 2MLZA 4JYSA 1EYMA 2OFNA 3PRBA 1J4RA 1D7HA 4ODOA 1D6OA 2M1IA 4G2PA 1ROUA 4ODRA 2K8IA 4NNRA 4QT2A 2F4EA 4IQ2A 2VN1A 3KACA 2XPBA 2LJ4A 2MLYA 2UZ5A 3O5GA 3RFWA 1FKBA 2F2DA 2XP3A 4IPXA 3UI5A 2AWGA 3KAGA 1FKLA 1Q1CA 3UQBA 2RUDA 4LAXA 4MGVA 1FKDA 1ZK6A 4FAPA 2PV3A 3UI4A 2XP5A 3IHZA 1BKFA 3PA7A 1NSGA 1Y0OA 3FAPA 4GIVA 4QIBA 3TCZA 1QPLA 5HT1A 3O5OA 4R0XA 1FKFA 3NRKA 4DT4A 1D7JA 5HWCA 2MF9A 1FKJA 1Q6HA 2FAPA 4U84A 2IF4A 3O5JA 4LAYA 1FD9A 3PRDA 4DRQA 3NTPA 3JXVA 3IKDA 5B8IC 2PPNA 1N1AA 1FKSA 4N19A 1M5YA 3ODKA 2L2SA 4ODPA 3I6CA 3KADA 3KAFA 4TNSA 4TX0A 3UQIA 4DRPA 1F8AB 1FKIA 4IQCA 5HWBA 2PV1A 2RQSA 2Y78A 5HW7A 1J4HA 1YATA 2JZVA 4ODNA 3VAWA 2XP4A 5D75A 2ZR4A 2F21A 5HUAA 4JFLA 4DRJA 2ZQUA 3O5QA 1ZCNA 4TYOA 3O5LA 3CGMA 4JFJA 4DH0A 2ITKA 1ROTA 4LAWA 2KR7A 2PPOA 4TW8A 4W9OA 1C9HA 1P5QA 2DG3A 4FN2A 5DIUA 4DIPA 4J4NA 2KGJA 1Q6UA 4ODLA 1F40A 1T11A 1YW5A 3UI6A 5HTGA 3TDBA 2RUQA 3O5IA 4DRMA 4J4OA 5DITA 2D9FA 4BF8A 3RGCA 3UQAA 4W9QA 3CGNA 1JNSA 2MNTA 1NMWA 4DZ2A 1QPFA 2KO7A 2KI3A 2ZQVA 2ZQTA 4GGQA 4ODMA 2MPHA 4U85A 5GPGA 1HXVA 1PBKA 4W9PA 5HKGA 2Q5AA 4TW6A 2XP6A 1W26A 3JYJA 2DG4A 1JNTA 2RSEA 2XP7A 1FKGA 1QZ2A 1U79A 2PV2A 3O5MA 2M08A 2VCDA 3JYMA 3H9RB 2LGOA 2M2AA 2LKNA 2RUCA 4DRNA 3KABA 3EY6A 5BXJA 1FKRA 3LUOA 2XPAA 1D7IA 5DIVA 1J6YA 2XP8A 4TW7A 3WH0A 2DG9A 4QT3A 5J6EA 3KCEA 3O5EA 4ODKA 3O5KA 2KE0A 1NMVA 1Q6IA 2XP9A 3MDYB 1B6CA 1J4IA 4DRKA 4DRIA 1R9HA 3KAIA 4ODQA 1KT0A 3O5RA 3IK8A 1FKKA 3KZ7A 4LAVA 4U86A 5I98A 3B7XA 1L1PA 1A7XA 2RURA 4JFIA 5HW8A 2ZR5A 2N87A 1FKTA 4G50A 3O5PA 4O2TA 1FJDA 3TC5A 4DZ3A 2ZR6A 4DROA 3O5FA 4DRHA 1TCOC 3UF8A 3GPKA 2KFWA 3OOBA 4MSPA 4ITZA 3O5DA 4C02B 2ZQSA 2LPVA 3KAHA 4JFMA 1PINA 1JVWA 1BL4A 2FKEA
chains in the Genus database with same CATH superfamily
2PPPA 3IKGA 1VF8A 1FKHA 3CHFA 3AROA 2QF8A 4JYSA 1HJXA 3PRBA 4ODOA 1D6OA 4G2PA 3WD2A 4NNRA 4IQ2A 2VN1A 1WNOA 2LJ4A 3O5GA 1FKBA 3UI5A 1H0IA 3AS3A 4MNLA 4IT6A 2DT2A 1FKDA 4FAPA 3WKZA 4QIBA 1Y0OA 1QPLA 3O5OA 3NRKA 2DT1A 2MF9A 1GRJA 1GOIA 4NZCA 3PRDA 2PI6A 3IKDA 4TX0A 1ZBKA 1YATA 1HKKA 1W1VA 5HUAA 1ZCNA 4TYOA 4LGXA 1NWRA 3RM4A 2KR7A 4MPKA 4DIPA 3WL1A 3QOKA 3UI6A 3TDBA 2RUQA 1HKMA 3WQWA 4J4OA 4BF8A 4W9QA 1ZBVA 2KO7A 2KI3A 3BXWA 4MNJA 4W9PA 2B5UB 3JYJA 5GQBA 4DWSC 1JNTA 3B8SA 2A3EA 1QZ2A 1W9PA 2LGOA 2RUCA 3CHCA 4DWSD 3EY6A 5BXJA 2DG9A 1FFQA 2O9OA 4KR0B 2OLHA 2KE0A 3ALFA 2XP9A 3MDYB 1LL4A 3CZ8A 1X6LA 4Q22A 3CHDA 3KAIA 4ODQA 1ZL1A 1KT0A 5I98A 3KZ7A 1L1PA 5HW8A 3WD4A 4JFIA 2ZR5A 1NH6A 2N87A 1FKTA 3TC5A 2A3BA 3O5FA 2KFWA 3AS1A 1JNSA 1BL4A 3PRAA 1EQ3A 4AY1A 2PBCA 3AS0A 1KT1A 5HW6A 1E44A 1E15A 1EDQA 1ROUA 2K8IA 4QT2A 3RFWA 2MLYA 2DSWA 3ARQA 2PN0A 4WKFA 2AWGA 3KAGA 1FKLA 3FXYA 3ARVA 3UI4A 3TCZA 1BKFA 4L72B 1FKFA 4U84A 2IF4A 3O5JA 4LAYA 4DRQA 2PPNA 4WKHA 1FKSA 1FFRA 3ODKA 5JH8A 3W4RA 4TNSA 3KAFA 3UQIA 1UR8A 1FKIA 4IQCA 2Y78A 4Z2HA 4HBEA 2XP4A 1HKJA 2ZR4A 2DT3A 4JFLA 4NSBA 3O5QA 4L3NA 3O5LA 2ITKA 1ROTA 1ZU8A 2PPOA 1C9HA 2DG3A 4FN2A 2KGJA 4P8UA 1YW5A 5HTGA 1O6IA 5DITA 2D9FA 1SR0A 2WM0A 2ZQVA 4ODMA 1E6NA 3G6LA 3B9DA 1EIBA 1LQ0A 4TW6A 2XP6A 4ZPVR 2RSEA 2XP7A 3WL0A 2PV2A 3O5MA 4W5UA 3GU0A 2DSUA 1JNDA 3LUOA 2XPAA 2XP8A 4TW7A 4ODKA 1LJYA 1HJWA 4URIA 1J4IA 1W9UA 4DRIA 2A3CA 4WJXA 1JCHB 4G50A 3O5PA 4DZ3A 2ZR6A 1EHNA 3ARUA 4Z2KA 1WB0A 3ARPA 2ZQSA 3FAPA 4KQZA 4QZVB 4N19A 3NI6A 4Z2JA 4MAVA 1OGBA 2MLZA 2DT0A 2OFNA 1D7HA 5DO2A 1LG1A 2M1IA 4ODRA 2XPBA 2UZ5A 4IPXA 2F2DA 4P8WA 4ZPWR 1Q1CA 5GPRA 4LAXA 1JNEA 1ZK6A 2PV3A 3IHZA 1NSGA 1ITXA 5HT1A 4R0XA 4DT4A 1D7JA 5HWCA 3B9AA 1FD9A 5B8IC 1W1TA 2L2SA 1CTNA 3KADA 5HWBA 4P8VA 1LL7A 2PV1A 1W9VA 2G41A 4ODNA 3VAWA 3ARZA 2F21A 3WD0A 2WLYA 4DRJA 2ZQUA 4WK9A 4JFJA 3PR9A 1E6ZA 4LAWA 4W9OA 4TW8A 5DIUA 1P5QA 1E9LA 1XRVA 1HJVA 4ODLA 1T11A 3O5IA 3FY1A 3ARTA 3GTYX 2DPEA 3CGNA 2MNTA 1NMWA 1GPFA 2DSVA 4DZ2A 1RD6A 1QPFA 4U85A 5GPGA 2YBUA 1IX5A 1HXVA 5HKGA 3ALGA 1W26A 2DG4A 4Z2LA 1FKGA 1U79A 4HBOA 3JYMA 3H9RB 2M2AA 2LKNA 4DRNA 3KABA 1FKRA 5DIVA 1D2KA 1J6YA 3WH0A 4QT3A 2F23A 3KCEA 3O5EA 1E6RA 5J6EA 4MNMA 3ARRA 1OGGA 4UDMA 1UR9A 1Q6IA 4ZPTR 1R9HA 3ARSA 3O5RA 4LAVA 4U86A 1FKKA 5HBFA 2DSZA 3B7XA 2ETNA 4WKAA 4O2TA 3UF8A 1W1PA 4MSPA 4C02B 2AOSA 3CH9A 2LPVA 2O92A 4JFMA 4Z2IA 1JVWA 4DRHA 2FKEA 2MLXA 4IT4A 4JFKA 4MTVA 1FAPA 3EIPA 1EYMA 3WIJA 1TFVA 1J4RA 2P4VA 4DWSA 2F4EA 4Q7NA 2ESCA 3KACA 1ZB5A 2XP3A 2RUDA 4MGVA 4ZS6A 2XP5A 3PA7A 3UQBA 4GIVA 1NWUA 3WQVA 2G8ZA 4WIWA 1SYTA 1FKJA 1Q6HA 2FAPA 3ARXA 1H0GA 3AQUA 3NTPA 3RM8A 3JXVA 4DWSB 1OWQA 1N1AA 1NWSA 1M5YA 3CHEA 4ODPA 3I6CA 5DF0A 4DRPA 1F8AB 4R5EA 2RQSA 5HW7A 1J4HA 2JZVA 1GUVA 1LG2A 5D75A 3ARWA 4S3KA 3CGMA 4DH0A 3BMBA 2B31A 2IUZA 4HARA 3WD1A 4J4NA 1Q6UA 1F40A 2FDMA 1W1YA 3B9EA 1X6NA 4DRMA 3RGCA 2EULA 4XAKA 3UQAA 2WK2A 1HKIA 1ZBCA 2A3AA 4GGQA 2ZQTA 1ZBWA 2MPHA 1PBKA 1NWTA 3AS2A 5DEZA 4MNKA 1KFWA 2M08A 2VCDA 1WAWA 3ARYA 3RM9A 4Z2GA 1D7IA 3OA5A 1E6PA 4PTMA 3G6MA 2WLZA 3O5KA 2YBTA 1NMVA 1B6CA 4DRKA 4ML4A 3WD3A 1K9TA 3IK8A 1A7XA 2RURA 1XHGA 4P8XA 1FJDA 1LL6A 4DROA 4S3JA 1TCOC 3RMEA 3GPKA 3OOBA 4ITZA 3O5DA 2Q5AA 3KAHA 1PINA
chains in the Genus database with same CATH topology
2PPPA 3IKGA 1VF8A 1FKHA 3CHFA 3AROA 2QF8A 4JYSA 1HJXA 3PRBA 4ODOA 1D6OA 4G2PA 3WD2A 4NNRA 4IQ2A 2VN1A 1WNOA 2LJ4A 3O5GA 1FKBA 3UI5A 1H0IA 3AS3A 4MNLA 4IT6A 2DT2A 1FKDA 4FAPA 3WKZA 4QIBA 1Y0OA 1QPLA 3O5OA 3NRKA 2DT1A 2MF9A 1GOIA 4NZCA 3PRDA 2PI6A 3IKDA 4TX0A 1ZBKA 1YATA 1HKKA 1W1VA 5HUAA 1ZCNA 4TYOA 4LGXA 1NWRA 3RM4A 2KR7A 4MPKA 4DIPA 3WL1A 3QOKA 3UI6A 3TDBA 2RUQA 1HKMA 3WQWA 4J4OA 4BF8A 4W9QA 1ZBVA 2KO7A 2KI3A 3BXWA 4MNJA 4W9PA 3JYJA 5GQBA 4DWSC 1JNTA 3B8SA 2A3EA 1QZ2A 1W9PA 2LGOA 2RUCA 3CHCA 4DWSD 3EY6A 5BXJA 2DG9A 1FFQA 2O9OA 4KR0B 2OLHA 2KE0A 3ALFA 2XP9A 3MDYB 1LL4A 3CZ8A 1X6LA 4Q22A 3CHDA 3KAIA 4ODQA 1ZL1A 1KT0A 5I98A 3KZ7A 1L1PA 5HW8A 3WD4A 4JFIA 2ZR5A 1NH6A 2N87A 1FKTA 3TC5A 2A3BA 3O5FA 2KFWA 3AS1A 1JNSA 1BL4A 3PRAA 1EQ3A 4AY1A 2PBCA 3AS0A 1KT1A 5HW6A 1E15A 1EDQA 1ROUA 2K8IA 4QT2A 3RFWA 2MLYA 2DSWA 3ARQA 4WKFA 2AWGA 3KAGA 1FKLA 3FXYA 3ARVA 3UI4A 3TCZA 1BKFA 4L72B 1FKFA 4U84A 2IF4A 3O5JA 4LAYA 4DRQA 2PPNA 4WKHA 1FKSA 1FFRA 3ODKA 5JH8A 3W4RA 4TNSA 3KAFA 3UQIA 1UR8A 1FKIA 4IQCA 2Y78A 4Z2HA 4HBEA 2XP4A 1HKJA 2ZR4A 2DT3A 4JFLA 4NSBA 3O5QA 4L3NA 3O5LA 2ITKA 1ROTA 1ZU8A 2PPOA 1C9HA 2DG3A 4FN2A 2KGJA 4P8UA 1YW5A 5HTGA 1O6IA 5DITA 2D9FA 1SR0A 2WM0A 2ZQVA 4ODMA 1E6NA 3G6LA 3B9DA 1EIBA 1LQ0A 4TW6A 2XP6A 4ZPVR 2RSEA 2XP7A 3WL0A 2PV2A 3O5MA 4W5UA 2DSUA 1JNDA 3LUOA 2XPAA 2XP8A 4TW7A 4ODKA 1LJYA 1HJWA 4URIA 1J4IA 1W9UA 4DRIA 2A3CA 4WJXA 4G50A 3O5PA 4DZ3A 2ZR6A 1EHNA 3ARUA 4Z2KA 1WB0A 3ARPA 2ZQSA 3FAPA 4KQZA 4QZVB 4N19A 3NI6A 4Z2JA 4MAVA 1OGBA 2MLZA 2DT0A 2OFNA 1D7HA 5DO2A 1LG1A 2M1IA 4ODRA 2XPBA 2UZ5A 4IPXA 2F2DA 4P8WA 4ZPWR 1Q1CA 5GPRA 4LAXA 1JNEA 1ZK6A 2PV3A 3IHZA 1NSGA 1ITXA 5HT1A 4R0XA 4DT4A 1D7JA 5HWCA 3B9AA 1FD9A 5B8IC 1W1TA 2L2SA 1CTNA 3KADA 5HWBA 4P8VA 1LL7A 2PV1A 1W9VA 2G41A 4ODNA 3VAWA 3ARZA 2F21A 3WD0A 2WLYA 4DRJA 2ZQUA 4WK9A 4JFJA 3PR9A 1E6ZA 4LAWA 4W9OA 4TW8A 5DIUA 1P5QA 1E9LA 1XRVA 1HJVA 4ODLA 1T11A 3O5IA 3FY1A 3ARTA 2DPEA 3CGNA 2MNTA 1NMWA 1GPFA 2DSVA 4DZ2A 1RD6A 1QPFA 4U85A 5GPGA 2YBUA 1IX5A 1HXVA 5HKGA 3ALGA 1W26A 2DG4A 4Z2LA 1FKGA 1U79A 4HBOA 3JYMA 3H9RB 2M2AA 2LKNA 4DRNA 3KABA 1FKRA 5DIVA 1D2KA 1J6YA 3WH0A 4QT3A 5J6EA 3KCEA 3O5EA 1E6RA 4MNMA 3ARRA 1OGGA 1UR9A 1Q6IA 4ZPTR 1R9HA 3ARSA 3O5RA 4LAVA 4U86A 1FKKA 5HBFA 2DSZA 3B7XA 4WKAA 4O2TA 3UF8A 1W1PA 4MSPA 4C02B 2AOSA 3CH9A 2LPVA 2O92A 4JFMA 4Z2IA 1JVWA 4DRHA 2FKEA 2MLXA 4IT4A 4JFKA 4MTVA 1FAPA 1EYMA 3WIJA 1TFVA 1J4RA 4DWSA 2F4EA 4Q7NA 2ESCA 3KACA 1ZB5A 2XP3A 2RUDA 4MGVA 4ZS6A 2XP5A 3PA7A 3UQBA 4GIVA 1NWUA 3WQVA 2G8ZA 4WIWA 1SYTA 1FKJA 1Q6HA 2FAPA 3ARXA 1H0GA 3AQUA 3NTPA 3RM8A 3JXVA 4DWSB 1OWQA 1N1AA 1NWSA 1M5YA 3CHEA 4ODPA 3I6CA 5DF0A 4DRPA 1F8AB 4R5EA 2RQSA 5HW7A 1J4HA 2JZVA 1GUVA 1LG2A 5D75A 3ARWA 4S3KA 3CGMA 4DH0A 2B31A 2IUZA 4HARA 3WD1A 4J4NA 1Q6UA 1F40A 2FDMA 1W1YA 3B9EA 1X6NA 4DRMA 3RGCA 4XAKA 3UQAA 2WK2A 1HKIA 1ZBCA 2A3AA 4GGQA 2ZQTA 1ZBWA 2MPHA 1PBKA 1NWTA 3AS2A 5DEZA 4MNKA 1KFWA 2M08A 2VCDA 1WAWA 3ARYA 3RM9A 4Z2GA 1D7IA 3OA5A 1E6PA 4PTMA 3G6MA 2WLZA 3O5KA 2YBTA 1NMVA 1B6CA 4DRKA 4ML4A 3WD3A 1K9TA 3IK8A 1A7XA 2RURA 1XHGA 4P8XA 1FJDA 1LL6A 4DROA 4S3JA 1TCOC 3RMEA 3GPKA 3OOBA 4ITZA 3O5DA 2Q5AA 3KAHA 1PINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLX A;  2PPP A;  3IKG A;  3NI6 A;  1EQ3 A;  1FKH A;  2PBC A;  4JFK A;  1KT1 A;  5HW6 A;  1FAP A;  2MLZ A;  4JYS A;  1EYM A;  2OFN A;  3PRB A;  1J4R A;  1D7H A;  4ODO A;  1D6O A;  2M1I A;  4G2P A;  1ROU A;  4ODR A;  2K8I A;  4NNR A;  4QT2 A;  2F4E A;  4IQ2 A;  2VN1 A;  3KAC A;  2XPB A;  2LJ4 A;  2MLY A;  2UZ5 A;  3O5G A;  3RFW A;  1FKB A;  2F2D A;  2XP3 A;  4IPX A;  3UI5 A;  2AWG A;  3KAG A;  1FKL A;  1Q1C A;  3UQB A;  2RUD A;  4LAX A;  4MGV A;  1FKD A;  1ZK6 A;  4FAP A;  2PV3 A;  3UI4 A;  2XP5 A;  3IHZ A;  1BKF A;  3PA7 A;  1NSG A;  1Y0O A;  3FAP A;  4GIV A;  4QIB A;  3TCZ A;  1QPL A;  5HT1 A;  3O5O A;  4R0X A;  1FKF A;  3NRK A;  4DT4 A;  1D7J A;  5HWC A;  2MF9 A;  1FKJ A;  1Q6H A;  2FAP A;  4U84 A;  2IF4 A;  3O5J A;  4LAY A;  1FD9 A;  3PRD A;  4DRQ A;  3NTP A;  3JXV A;  3IKD A;  5B8I C;  2PPN A;  1N1A A;  1FKS A;  4N19 A;  1M5Y A;  3ODK A;  2L2S A;  4ODP A;  3I6C A;  3KAD A;  3KAF A;  4TNS A;  4TX0 A;  3UQI A;  4DRP A;  1F8A B;  1FKI A;  4IQC A;  5HWB A;  2PV1 A;  2RQS A;  2Y78 A;  5HW7 A;  1J4H A;  1YAT A;  2JZV A;  4ODN A;  3VAW A;  2XP4 A;  5D75 A;  2ZR4 A;  2F21 A;  5HUA A;  4JFL A;  4DRJ A;  2ZQU A;  3O5Q A;  1ZCN A;  4TYO A;  3O5L A;  3CGM A;  4JFJ A;  4DH0 A;  2ITK A;  1ROT A;  4LAW A;  2KR7 A;  2PPO A;  4TW8 A;  4W9O A;  1C9H A;  1P5Q A;  2DG3 A;  4FN2 A;  5DIU A;  4DIP A;  4J4N A;  2KGJ A;  1Q6U A;  4ODL A;  1F40 A;  1T11 A;  1YW5 A;  3UI6 A;  5HTG A;  3TDB A;  2RUQ A;  3O5I A;  4DRM A;  4J4O A;  5DIT A;  2D9F A;  4BF8 A;  3RGC A;  3UQA A;  4W9Q A;  3CGN A;  1JNS A;  2MNT A;  1NMW A;  4DZ2 A;  1QPF A;  2KO7 A;  2KI3 A;  2ZQV A;  2ZQT A;  4GGQ A;  4ODM A;  2MPH A;  4U85 A;  5GPG A;  1HXV A;  1PBK A;  4W9P A;  5HKG A;  2Q5A A;  4TW6 A;  2XP6 A;  1W26 A;  3JYJ A;  2DG4 A;  1JNT A;  2RSE A;  2XP7 A;  1FKG A;  1QZ2 A;  1U79 A;  2PV2 A;  3O5M A;  2M08 A;  2VCD A;  3JYM A;  3H9R B;  2LGO A;  2M2A A;  2LKN A;  2RUC A;  4DRN A;  3KAB A;  3EY6 A;  5BXJ A;  1FKR A;  3LUO A;  2XPA A;  1D7I A;  5DIV A;  1J6Y A;  2XP8 A;  4TW7 A;  3WH0 A;  2DG9 A;  4QT3 A;  5J6E A;  3KCE A;  3O5E A;  4ODK A;  3O5K A;  2KE0 A;  1NMV A;  1Q6I A;  2XP9 A;  3MDY B;  1B6C A;  1J4I A;  4DRK A;  4DRI A;  1R9H A;  3KAI A;  4ODQ A;  1KT0 A;  3O5R A;  3IK8 A;  1FKK A;  3KZ7 A;  4LAV A;  4U86 A;  5I98 A;  3B7X A;  1L1P A;  1A7X A;  2RUR A;  4JFI A;  5HW8 A;  2ZR5 A;  2N87 A;  1FKT A;  4G50 A;  3O5P A;  4O2T A;  1FJD A;  3TC5 A;  4DZ3 A;  2ZR6 A;  4DRO A;  3O5F A;  4DRH A;  1TCO C;  3UF8 A;  3GPK A;  2KFW A;  3OOB A;  4MSP A;  4ITZ A;  3O5D A;  4C02 B;  2ZQS A;  2LPV A;  3KAH A;  4JFM A;  1PIN A;  1JVW A;  1BL4 A;  2FKE A; 
#chains in the Genus database with same CATH topology
 2PPP A;  3IKG A;  1VF8 A;  1FKH A;  3CHF A;  3ARO A;  2QF8 A;  4JYS A;  1HJX A;  3PRB A;  4ODO A;  1D6O A;  4G2P A;  3WD2 A;  4NNR A;  4IQ2 A;  2VN1 A;  1WNO A;  2LJ4 A;  3O5G A;  1FKB A;  3UI5 A;  1H0I A;  3AS3 A;  4MNL A;  4IT6 A;  2DT2 A;  1FKD A;  4FAP A;  3WKZ A;  4QIB A;  1Y0O A;  1QPL A;  3O5O A;  3NRK A;  2DT1 A;  2MF9 A;  1GRJ A;  1GOI A;  4NZC A;  3PRD A;  2PI6 A;  3IKD A;  4TX0 A;  1ZBK A;  1YAT A;  1HKK A;  1W1V A;  5HUA A;  1ZCN A;  4TYO A;  4LGX A;  1NWR A;  3RM4 A;  2KR7 A;  4MPK A;  4DIP A;  3WL1 A;  3QOK A;  3UI6 A;  3TDB A;  2RUQ A;  1HKM A;  3WQW A;  4J4O A;  4BF8 A;  4W9Q A;  1ZBV A;  2KO7 A;  2KI3 A;  3BXW A;  4MNJ A;  4W9P A;  2B5U B;  3JYJ A;  5GQB A;  4DWS C;  1JNT A;  3B8S A;  2A3E A;  1QZ2 A;  1W9P A;  2LGO A;  2RUC A;  3CHC A;  4DWS D;  3EY6 A;  5BXJ A;  2DG9 A;  1FFQ A;  2O9O A;  4KR0 B;  2OLH A;  2KE0 A;  3ALF A;  2XP9 A;  3MDY B;  1LL4 A;  3CZ8 A;  1X6L A;  4Q22 A;  3CHD A;  3KAI A;  4ODQ A;  1ZL1 A;  1KT0 A;  5I98 A;  3KZ7 A;  1L1P A;  5HW8 A;  3WD4 A;  4JFI A;  2ZR5 A;  1NH6 A;  2N87 A;  1FKT A;  3TC5 A;  2A3B A;  3O5F A;  2KFW A;  3AS1 A;  1JNS A;  1BL4 A;  3PRA A;  1EQ3 A;  4AY1 A;  2PBC A;  3AS0 A;  1KT1 A;  5HW6 A;  1E44 A;  1E15 A;  1EDQ A;  1ROU A;  2K8I A;  4QT2 A;  3RFW A;  2MLY A;  2DSW A;  3ARQ A;  2PN0 A;  4WKF A;  2AWG A;  3KAG A;  1FKL A;  3FXY A;  3ARV A;  3UI4 A;  3TCZ A;  1BKF A;  4L72 B;  1FKF A;  4U84 A;  2IF4 A;  3O5J A;  4LAY A;  4DRQ A;  2PPN A;  4WKH A;  1FKS A;  1FFR A;  3ODK A;  5JH8 A;  3W4R A;  4TNS A;  3KAF A;  3UQI A;  1UR8 A;  1FKI A;  4IQC A;  2Y78 A;  4Z2H A;  4HBE A;  2XP4 A;  1HKJ A;  2ZR4 A;  2DT3 A;  4JFL A;  4NSB A;  3O5Q A;  4L3N A;  3O5L A;  2ITK A;  1ROT A;  1ZU8 A;  2PPO A;  1C9H A;  2DG3 A;  4FN2 A;  2KGJ A;  4P8U A;  1YW5 A;  5HTG A;  1O6I A;  5DIT A;  2D9F A;  1SR0 A;  2WM0 A;  2ZQV A;  4ODM A;  1E6N A;  3G6L A;  3B9D A;  1EIB A;  1LQ0 A;  4TW6 A;  2XP6 A;  4ZPV R;  2RSE A;  2XP7 A;  3WL0 A;  2PV2 A;  3O5M A;  4W5U A;  3GU0 A;  2DSU A;  1JND A;  3LUO A;  2XPA A;  2XP8 A;  4TW7 A;  4ODK A;  1LJY A;  1HJW A;  4URI A;  1J4I A;  1W9U A;  4DRI A;  2A3C A;  4WJX A;  1JCH B;  4G50 A;  3O5P A;  4DZ3 A;  2ZR6 A;  1EHN A;  3ARU A;  4Z2K A;  1WB0 A;  3ARP A;  2ZQS A;  3FAP A;  4KQZ A;  4QZV B;  4N19 A;  3NI6 A;  4Z2J A;  4MAV A;  1OGB A;  2MLZ A;  2DT0 A;  2OFN A;  1D7H A;  5DO2 A;  1LG1 A;  2M1I A;  4ODR A;  2XPB A;  2UZ5 A;  4IPX A;  2F2D A;  4P8W A;  4ZPW R;  1Q1C A;  5GPR A;  4LAX A;  1JNE A;  1ZK6 A;  2PV3 A;  3IHZ A;  1NSG A;  1ITX A;  5HT1 A;  4R0X A;  4DT4 A;  1D7J A;  5HWC A;  3B9A A;  1FD9 A;  5B8I C;  1W1T A;  2L2S A;  1CTN A;  3KAD A;  5HWB A;  4P8V A;  1LL7 A;  2PV1 A;  1W9V A;  2G41 A;  4ODN A;  3VAW A;  3ARZ A;  2F21 A;  3WD0 A;  2WLY A;  4DRJ A;  2ZQU A;  4WK9 A;  4JFJ A;  3PR9 A;  1E6Z A;  4LAW A;  4W9O A;  4TW8 A;  5DIU A;  1P5Q A;  1E9L A;  1XRV A;  1HJV A;  4ODL A;  1T11 A;  3O5I A;  3FY1 A;  3ART A;  3GTY X;  2DPE A;  3CGN A;  2MNT A;  1NMW A;  1GPF A;  2DSV A;  4DZ2 A;  1RD6 A;  1QPF A;  4U85 A;  5GPG A;  2YBU A;  1IX5 A;  1HXV A;  5HKG A;  3ALG A;  1W26 A;  2DG4 A;  4Z2L A;  1FKG A;  1U79 A;  4HBO A;  3JYM A;  3H9R B;  2M2A A;  2LKN A;  4DRN A;  3KAB A;  1FKR A;  5DIV A;  1D2K A;  1J6Y A;  3WH0 A;  4QT3 A;  2F23 A;  3KCE A;  3O5E A;  1E6R A;  5J6E A;  4MNM A;  3ARR A;  1OGG A;  4UDM A;  1UR9 A;  1Q6I A;  4ZPT R;  1R9H A;  3ARS A;  3O5R A;  4LAV A;  4U86 A;  1FKK A;  5HBF A;  2DSZ A;  3B7X A;  2ETN A;  4WKA A;  4O2T A;  3UF8 A;  1W1P A;  4MSP A;  4C02 B;  2AOS A;  3CH9 A;  2LPV A;  2O92 A;  4JFM A;  4Z2I A;  1JVW A;  4DRH A;  2FKE A;  2MLX A;  4IT4 A;  4JFK A;  4MTV A;  1FAP A;  3EIP A;  1EYM A;  3WIJ A;  1TFV A;  1J4R A;  2P4V A;  4DWS A;  2F4E A;  4Q7N A;  2ESC A;  3KAC A;  1ZB5 A;  2XP3 A;  2RUD A;  4MGV A;  4ZS6 A;  2XP5 A;  3PA7 A;  3UQB A;  4GIV A;  1NWU A;  3WQV A;  2G8Z A;  4WIW A;  1SYT A;  1FKJ A;  1Q6H A;  2FAP A;  3ARX A;  1H0G A;  3AQU A;  3NTP A;  3RM8 A;  3JXV A;  4DWS B;  1OWQ A;  1N1A A;  1NWS A;  1M5Y A;  3CHE A;  4ODP A;  3I6C A;  5DF0 A;  4DRP A;  1F8A B;  4R5E A;  2RQS A;  5HW7 A;  1J4H A;  2JZV A;  1GUV A;  1LG2 A;  5D75 A;  3ARW A;  4S3K A;  3CGM A;  4DH0 A;  3BMB A;  2B31 A;  2IUZ A;  4HAR A;  3WD1 A;  4J4N A;  1Q6U A;  1F40 A;  2FDM A;  1W1Y A;  3B9E A;  1X6N A;  4DRM A;  3RGC A;  2EUL A;  4XAK A;  3UQA A;  2WK2 A;  1HKI A;  1ZBC A;  2A3A A;  4GGQ A;  2ZQT A;  1ZBW A;  2MPH A;  1PBK A;  1NWT A;  3AS2 A;  5DEZ A;  4MNK A;  1KFW A;  2M08 A;  2VCD A;  1WAW A;  3ARY A;  3RM9 A;  4Z2G A;  1D7I A;  3OA5 A;  1E6P A;  4PTM A;  3G6M A;  2WLZ A;  3O5K A;  2YBT A;  1NMV A;  1B6C A;  4DRK A;  4ML4 A;  3WD3 A;  1K9T A;  3IK8 A;  1A7X A;  2RUR A;  1XHG A;  4P8X A;  1FJD A;  1LL6 A;  4DRO A;  4S3J A;  1TCO C;  3RME A;  3GPK A;  3OOB A;  4ITZ A;  3O5D A;  2Q5A A;  3KAH A;  1PIN A; 
#chains in the Genus database with same CATH homology
 2PPP A;  3IKG A;  1VF8 A;  1FKH A;  3CHF A;  3ARO A;  2QF8 A;  4JYS A;  1HJX A;  3PRB A;  4ODO A;  1D6O A;  4G2P A;  3WD2 A;  4NNR A;  4IQ2 A;  2VN1 A;  1WNO A;  2LJ4 A;  3O5G A;  1FKB A;  3UI5 A;  1H0I A;  3AS3 A;  4MNL A;  4IT6 A;  2DT2 A;  1FKD A;  4FAP A;  3WKZ A;  4QIB A;  1Y0O A;  1QPL A;  3O5O A;  3NRK A;  2DT1 A;  2MF9 A;  1GOI A;  4NZC A;  3PRD A;  2PI6 A;  3IKD A;  4TX0 A;  1ZBK A;  1YAT A;  1HKK A;  1W1V A;  5HUA A;  1ZCN A;  4TYO A;  4LGX A;  1NWR A;  3RM4 A;  2KR7 A;  4MPK A;  4DIP A;  3WL1 A;  3QOK A;  3UI6 A;  3TDB A;  2RUQ A;  1HKM A;  3WQW A;  4J4O A;  4BF8 A;  4W9Q A;  1ZBV A;  2KO7 A;  2KI3 A;  3BXW A;  4MNJ A;  4W9P A;  3JYJ A;  5GQB A;  4DWS C;  1JNT A;  3B8S A;  2A3E A;  1QZ2 A;  1W9P A;  2LGO A;  2RUC A;  3CHC A;  4DWS D;  3EY6 A;  5BXJ A;  2DG9 A;  1FFQ A;  2O9O A;  4KR0 B;  2OLH A;  2KE0 A;  3ALF A;  2XP9 A;  3MDY B;  1LL4 A;  3CZ8 A;  1X6L A;  4Q22 A;  3CHD A;  3KAI A;  4ODQ A;  1ZL1 A;  1KT0 A;  5I98 A;  3KZ7 A;  1L1P A;  5HW8 A;  3WD4 A;  4JFI A;  2ZR5 A;  1NH6 A;  2N87 A;  1FKT A;  3TC5 A;  2A3B A;  3O5F A;  2KFW A;  3AS1 A;  1JNS A;  1BL4 A;  3PRA A;  1EQ3 A;  4AY1 A;  2PBC A;  3AS0 A;  1KT1 A;  5HW6 A;  1E15 A;  1EDQ A;  1ROU A;  2K8I A;  4QT2 A;  3RFW A;  2MLY A;  2DSW A;  3ARQ A;  4WKF A;  2AWG A;  3KAG A;  1FKL A;  3FXY A;  3ARV A;  3UI4 A;  3TCZ A;  1BKF A;  4L72 B;  1FKF A;  4U84 A;  2IF4 A;  3O5J A;  4LAY A;  4DRQ A;  2PPN A;  4WKH A;  1FKS A;  1FFR A;  3ODK A;  5JH8 A;  3W4R A;  4TNS A;  3KAF A;  3UQI A;  1UR8 A;  1FKI A;  4IQC A;  2Y78 A;  4Z2H A;  4HBE A;  2XP4 A;  1HKJ A;  2ZR4 A;  2DT3 A;  4JFL A;  4NSB A;  3O5Q A;  4L3N A;  3O5L A;  2ITK A;  1ROT A;  1ZU8 A;  2PPO A;  1C9H A;  2DG3 A;  4FN2 A;  2KGJ A;  4P8U A;  1YW5 A;  5HTG A;  1O6I A;  5DIT A;  2D9F A;  1SR0 A;  2WM0 A;  2ZQV A;  4ODM A;  1E6N A;  3G6L A;  3B9D A;  1EIB A;  1LQ0 A;  4TW6 A;  2XP6 A;  4ZPV R;  2RSE A;  2XP7 A;  3WL0 A;  2PV2 A;  3O5M A;  4W5U A;  2DSU A;  1JND A;  3LUO A;  2XPA A;  2XP8 A;  4TW7 A;  4ODK A;  1LJY A;  1HJW A;  4URI A;  1J4I A;  1W9U A;  4DRI A;  2A3C A;  4WJX A;  4G50 A;  3O5P A;  4DZ3 A;  2ZR6 A;  1EHN A;  3ARU A;  4Z2K A;  1WB0 A;  3ARP A;  2ZQS A;  3FAP A;  4KQZ A;  4QZV B;  4N19 A;  3NI6 A;  4Z2J A;  4MAV A;  1OGB A;  2MLZ A;  2DT0 A;  2OFN A;  1D7H A;  5DO2 A;  1LG1 A;  2M1I A;  4ODR A;  2XPB A;  2UZ5 A;  4IPX A;  2F2D A;  4P8W A;  4ZPW R;  1Q1C A;  5GPR A;  4LAX A;  1JNE A;  1ZK6 A;  2PV3 A;  3IHZ A;  1NSG A;  1ITX A;  5HT1 A;  4R0X A;  4DT4 A;  1D7J A;  5HWC A;  3B9A A;  1FD9 A;  5B8I C;  1W1T A;  2L2S A;  1CTN A;  3KAD A;  5HWB A;  4P8V A;  1LL7 A;  2PV1 A;  1W9V A;  2G41 A;  4ODN A;  3VAW A;  3ARZ A;  2F21 A;  3WD0 A;  2WLY A;  4DRJ A;  2ZQU A;  4WK9 A;  4JFJ A;  3PR9 A;  1E6Z A;  4LAW A;  4W9O A;  4TW8 A;  5DIU A;  1P5Q A;  1E9L A;  1XRV A;  1HJV A;  4ODL A;  1T11 A;  3O5I A;  3FY1 A;  3ART A;  2DPE A;  3CGN A;  2MNT A;  1NMW A;  1GPF A;  2DSV A;  4DZ2 A;  1RD6 A;  1QPF A;  4U85 A;  5GPG A;  2YBU A;  1IX5 A;  1HXV A;  5HKG A;  3ALG A;  1W26 A;  2DG4 A;  4Z2L A;  1FKG A;  1U79 A;  4HBO A;  3JYM A;  3H9R B;  2M2A A;  2LKN A;  4DRN A;  3KAB A;  1FKR A;  5DIV A;  1D2K A;  1J6Y A;  3WH0 A;  4QT3 A;  5J6E A;  3KCE A;  3O5E A;  1E6R A;  4MNM A;  3ARR A;  1OGG A;  1UR9 A;  1Q6I A;  4ZPT R;  1R9H A;  3ARS A;  3O5R A;  4LAV A;  4U86 A;  1FKK A;  5HBF A;  2DSZ A;  3B7X A;  4WKA A;  4O2T A;  3UF8 A;  1W1P A;  4MSP A;  4C02 B;  2AOS A;  3CH9 A;  2LPV A;  2O92 A;  4JFM A;  4Z2I A;  1JVW A;  4DRH A;  2FKE A;  2MLX A;  4IT4 A;  4JFK A;  4MTV A;  1FAP A;  1EYM A;  3WIJ A;  1TFV A;  1J4R A;  4DWS A;  2F4E A;  4Q7N A;  2ESC A;  3KAC A;  1ZB5 A;  2XP3 A;  2RUD A;  4MGV A;  4ZS6 A;  2XP5 A;  3PA7 A;  3UQB A;  4GIV A;  1NWU A;  3WQV A;  2G8Z A;  4WIW A;  1SYT A;  1FKJ A;  1Q6H A;  2FAP A;  3ARX A;  1H0G A;  3AQU A;  3NTP A;  3RM8 A;  3JXV A;  4DWS B;  1OWQ A;  1N1A A;  1NWS A;  1M5Y A;  3CHE A;  4ODP A;  3I6C A;  5DF0 A;  4DRP A;  1F8A B;  4R5E A;  2RQS A;  5HW7 A;  1J4H A;  2JZV A;  1GUV A;  1LG2 A;  5D75 A;  3ARW A;  4S3K A;  3CGM A;  4DH0 A;  2B31 A;  2IUZ A;  4HAR A;  3WD1 A;  4J4N A;  1Q6U A;  1F40 A;  2FDM A;  1W1Y A;  3B9E A;  1X6N A;  4DRM A;  3RGC A;  4XAK A;  3UQA A;  2WK2 A;  1HKI A;  1ZBC A;  2A3A A;  4GGQ A;  2ZQT A;  1ZBW A;  2MPH A;  1PBK A;  1NWT A;  3AS2 A;  5DEZ A;  4MNK A;  1KFW A;  2M08 A;  2VCD A;  1WAW A;  3ARY A;  3RM9 A;  4Z2G A;  1D7I A;  3OA5 A;  1E6P A;  4PTM A;  3G6M A;  2WLZ A;  3O5K A;  2YBT A;  1NMV A;  1B6C A;  4DRK A;  4ML4 A;  3WD3 A;  1K9T A;  3IK8 A;  1A7X A;  2RUR A;  1XHG A;  4P8X A;  1FJD A;  1LL6 A;  4DRO A;  4S3J A;  1TCO C;  3RME A;  3GPK A;  3OOB A;  4ITZ A;  3O5D A;  2Q5A A;  3KAH A;  1PIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...