3RGCA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
251
structure length
248
Chain Sequence
NAIAVVVDKEPITTYDIDQTMKALKIDRNKALGVLINEKMEISQMKQLGIVVNDLELDDAINKMLAQNKTTLNAFKANLKSSYEQFRTNFKKDLEKRKLYEKIASMAKTDFSDDGAKKFFEQNKDKFTFYTQINANIYLSNNPQTLENIKNTKKTILKPQNASLNTSNADPRLLGLLSQIPVGSFSPVLNGKNGYELYEVKSKDGTQTPEYEQVKNEVLNAYVSEQRQNFIQDYFDKLRSKINIEYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible periplasmic protein
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Chaperone
total genus 81
structure length 248
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09312 SurA_N SurA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4030.30 Mainly Alpha Orthogonal Bundle Triger factor/SurA peptide-binding fold Triger factor/SurA peptide-binding fold 3rgcA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rgcA02
4GIVA 3UQIA 1PBKA 2XP8A 1FKKA 4LAYA 1YW5A 1D7JA 3KADA 3KCEA 4R0XA 3NI6A 4G2PA 4IQCA 4TNSA 4U84A 5HUAA 3O5PA 3LUOA 1M5YA 3O5IA 4ITZA 1L1PA 1FKHA 1HXVA 2OFNA 2XP9A 2RURA 1D7IA 1FKDA 2LGOA 4ODRA 2D9FA 3O5FA 4O2TA 4DROA 2PV3A 2DG9A 4FAPA 2VN1A 1FD9A 1FKSA 2LPVA 1ROTA 2KO7A 2PPNA 2ZQUA 3KAGA 4W9PA 3PRDA 3B7XA 4ODQA 4W9OA 3NRKA 4JFKA 2DG3A 4ODPA 3CGNA 1N1AA 3KAIA 1KT1A 2KGJA 2ZR6A 4JFJA 1Y0OA 1YATA 2MLYA 2VCDA 3KZ7A 4LAWA 4DH0A 3NTPA 1JNTA 2M1IA 2MLXA 3IKGA 4FN2A 4DRMA 1EQ3A 1J4IA 2KI3A 3KACA 5HW6A 4U86A 4DRNA 2M08A 3O5LA 3TDBA 3O5OA 4ODNA 5I98A 3PRBA 5HW7A 1QPFA 5HW8A 2XP4A 3UF8A 2UZ5A 1Q6IA 1ZK6A 1Q1CA 3O5KA 1NSGA 1Q6HA 5GPGA 4U85A 1EYMA 1QPLA 3GPKA 1U79A 2XP3A 4TW8A 4J4OA 1J6YA 3I6CA 3UI6A 3JYMA 5DIUA 4ODKA 1BKFA 2N87A 4DZ3A 1FJDA 4LAVA 4GGQA 2FAPA 4DIPA 1FKJA 3WH0A 4JFLA 4C02B 4TYOA 4DT4A 3TC5A 2ZQVA 4JYSA 1FAPA 4DRIA 4G50A 4DRJA 4JFMA 1NMWA 4ODOA 2IF4A 1A7XA 2KR7A 1QZ2A 1P5QA 3VAWA 2F4EA 2Q5AA 4ODMA 3KAHA 4TX0A 1FKBA 2RUDA 3RFWA 3RGCA 1NMVA 5BXJA 1FKFA 2F2DA 2MLZA 2ITKA 3UQAA 1C9HA 3FAPA 4N19A 4IPXA 2ZQSA 3JYJA 2FKEA 1R9HA 2PV1A 4BF8A 2K8IA 3JXVA 5DIVA 2F21A 1J4HA 2LJ4A 2KE0A 3UI4A 3MDYB 3O5QA 4DRKA 4DRPA 4MSPA 1FKIA 3UQBA 2JZVA 1TCOC 1T11A 1B6CA 1J4RA 1BL4A 2PPOA 1FKTA 2PPPA 2ZR4A 3IHZA 3IKDA 3KAFA 4QT3A 5HT1A 1D7HA 3ODKA 4QT2A 4DZ2A 3O5EA 5J6EA 2DG4A 2ZR5A 3KABA 3UI5A 5B8IC 4J4NA 1JNSA 4ODLA 1D6OA 2LKNA 4TW6A 1FKLA 1W26A 3O5GA 5DITA 4MGVA 2XP7A 4DRQA 2XPBA 4JFIA 3O5RA 1JVWA 2ZQTA 2L2SA 2KFWA 2RUQA 3TCZA 4IQ2A 5HKGA 2MNTA 3CGMA 1F40A 2PV2A 2XP5A 2RSEA 1ZCNA 4NNRA 1FKGA 2Y78A 3OOBA 3O5JA 3EY6A 2RQSA 3IK8A 4LAXA 5HWBA 1ROUA 2MPHA 3PA7A 4DRHA 5HTGA 2M2AA 5HWCA 3O5MA 1KT0A 4QIBA 1FKRA 4W9QA 2MF9A 4TW7A 2AWGA 2XP6A 1PINA 5D75A 2RUCA 1F8AB 3O5DA 2PBCA 1Q6UA 3H9RB 2XPAA
chains in the Genus database with same CATH superfamily
3GU0A 3UQIA 1TFVA 1CTNA 3KADA 4P8VA 1NWUA 1NWSA 4R0XA 1JNEA 3O5PA 1FFRA 3LUOA 1M5YA 3O5IA 4ITZA 1HXVA 2DT0A 1FKDA 1E44A 2LGOA 4ODRA 3O5FA 1ZBWA 3WD0A 4Q7NA 1NWRA 4MTVA 1JNDA 1W1VA 3RM4A 1Y0OA 1YATA 4LAWA 2O92A 1HKKA 1J4IA 2KI3A 4Q22A 1E6RA 1GRJA 3UF8A 4DWSC 1Q6IA 1ZK6A 3O5KA 1NSGA 1Q6HA 1QPLA 2XP3A 1HJWA 1E15A 2FAPA 1WAWA 3WH0A 4JFLA 4KQZA 4ODOA 4ODMA 1C9HA 2DSVA 1EDQA 4N19A 3ARTA 1OGGA 1ZBVA 4P8WA 2PV1A 1W1TA 5DIVA 2F21A 1J4HA 2G8ZA 2KE0A 3MDYB 4DRKA 4MSPA 4W5UA 3WD3A 1TCOC 5JH8A 1J4RA 3ARYA 1BL4A 2PPPA 2ZR4A 5HT1A 4QT2A 4DZ2A 3UI5A 1D6OA 4TW6A 1W26A 4MGVA 4DRQA 2DSWA 2MNTA 1F40A 1E6NA 3ARWA 2PV2A 4NNRA 4MNMA 3OOBA 3O5JA 3B9EA 4Z2KA 1HJVA 3AS3A 1ROUA 1ITXA 1ZU8A 2MPHA 3PA7A 2M2AA 4S3JA 5HTGA 4W9QA 2MF9A 1HJXA 4TW7A 2XP6A 5D75A 2YBUA 3BXWA 3O5DA 1Q6UA 4GIVA 1ZB5A 1FKKA 4ZS6A 3WIJA 2DSUA 4G2PA 2DT3A 1L1PA 1FKHA 2D9FA 1W9PA 4O2TA 2PV3A 2DG9A 4AY1A 1FKSA 3KAGA 3PRDA 2YBTA 4HBEA 3ARSA 3CHEA 3KAIA 1NWTA 2KGJA 3B9DA 3RMEA 3ARZA 4JFJA 2VCDA 3NTPA 3ARUA 4FN2A 3AROA 1NH6A 4U86A 4DRNA 2M08A 2IUZA 4URIA 3O5LA 3TDBA 3PRBA 3RM8A 3FY1A 3ARQA 2OLHA 3GPKA 1U79A 4J4OA 1J6YA 3JYMA 4ODKA 1BKFA 1FJDA 1GUVA 4LAVA 4C02B 1E9LA 1FAPA 4JFMA 1NMWA 1UR9A 3VAWA 2Q5AA 4Z2LA 1W9VA 1NMVA 5BXJA 2MLZA 2ITKA 3WQWA 3FAPA 4IPXA 2ZQSA 3JYJA 2A3EA 1R9HA 1ZBKA 3UI4A 2DPEA 3O5QA 4DRPA 1FKIA 3UQBA 2JZVA 3W4RA 1LG1A 2PI6A 1T11A 1O6IA 2FDMA 2PPOA 4DWSD 3IHZA 4QT3A 4Z2GA 4LGXA 2DG4A 1JNSA 2A3BA 4ZPTR 2LKNA 5DITA 4L72B 3ALGA 2KFWA 2RUQA 4IQ2A 2O9OA 1LG2A 5HKGA 3CGMA 2XP5A 2ESCA 2QF8A 5GQBA 1GOIA 4DWSA 1E6ZA 2RQSA 1VF8A 3GTYX 4LAXA 3FXYA 1PINA 2RUCA 1F8AB 2XPAA 1UR8A 4MNJA 1LJYA 4ZPVR 2XP8A 1OWQA 3ARVA 1YW5A 4U84A 3NI6A 4IQCA 5HUAA 1IX5A 4P8XA 4WK9A 3B9AA 4WKAA 2B31A 2F23A 3CZ8A 2EULA 4MNLA 4FAPA 2VN1A 2LPVA 1ROTA 2ZQUA 4W9OA 3B7XA 4ODQA 3NRKA 4JFKA 4IT4A 4ODPA 3CGNA 4DWSB 4XAKA 2MLYA 5DO2A 3IKGA 3KACA 1LL7A 1KFWA 2DSZA 1RD6A 3O5OA 5HW7A 1QPFA 5HW8A 2UZ5A 4HBOA 1EYMA 4DZ3A 1FFQA 5DIUA 3UI6A 2N87A 4HARA 4GGQA 1WB0A 2ZQVA 4DRIA 1GPFA 1LQ0A 1ZL1A 4G50A 4UDMA 1P5QA 3PR9A 2F4EA 2WM0A 4Z2HA 1XRVA 1FKBA 2RUDA 3RFWA 3G6MA 3AS0A 1FKFA 4ZPWR 1X6NA 2DT2A 4BF8A 3JXVA 4R5EA 2LJ4A 1WNOA 1B6CA 1LL4A 1FKTA 1D7HA 3ODKA 5J6EA 3KABA 2ZR5A 5B8IC 1FKLA 3AS2A 5GPRA 3O5GA 2XP7A 3WD2A 2XPBA 3O5RA 2ZQTA 3PRAA 2RSEA 1W1YA 1EIBA 4WJXA 1HKIA 2DT1A 1W1PA 5HWCA 2P4VA 3O5MA 1KT0A 3CHCA 3H9RB 3ARXA 1PBKA 1LL6A 4LAYA 1D7JA 3KCEA 4TNSA 4NSBA 3WKZA 1HKJA 2WLYA 2OFNA 2XP9A 2RURA 1D7IA 4ML4A 3ALFA 1D2KA 4DROA 3ARPA 4IT6A 1FD9A 3WD1A 2PPNA 2KO7A 1H0IA 4W9PA 4QZVB 2DG3A 3BMBA 1N1AA 1KT1A 2ZR6A 5DF0A 3AS1A 3KZ7A 4MNKA 4DH0A 1EQ3A 4WKHA 1JNTA 2M1IA 2MLXA 4DRMA 1SR0A 4Z2JA 4NZCA 2WLZA 5HW6A 1XHGA 4S3KA 4ODNA 5I98A 4WKFA 2XP4A 1Q1CA 4L3NA 4WIWA 5GPGA 3WD4A 4U85A 4TW8A 3I6CA 3CHDA 4DIPA 1FKJA 1HKMA 4TYOA 4DT4A 3TC5A 1JCHB 4JYSA 1OGBA 1H0GA 4DRJA 3G6LA 2PN0A 2IF4A 1A7XA 2KR7A 1QZ2A 4TX0A 3KAHA 3RM9A 5HBFA 3RGCA 3OA5A 2F2DA 2A3CA 3UQAA 1K9TA 1EHNA 4MPKA 3CHFA 3B8SA 2FKEA 4Z2IA 2K8IA 3AQUA 1X6LA 5DEZA 2G41A 1E6PA 1W9UA 3WL0A 4MAVA 3CH9A 3IKDA 3KAFA 2AOSA 3O5EA 4J4NA 4ODLA 3QOKA 4JFIA 1JVWA 2L2SA 3TCZA 2ETNA 4PTMA 1ZCNA 2B5UB 1FKGA 2Y78A 3EY6A 3WQVA 3IK8A 3ARRA 3EIPA 4P8UA 5HWBA 4DRHA 1FKRA 1ZBCA 1SYTA 4QIBA 2AWGA 4KR0B 2A3AA 2WK2A 3WL1A 2PBCA
chains in the Genus database with same CATH topology
3UQIA 1TFVA 1CTNA 3KADA 4P8VA 1NWUA 1NWSA 4R0XA 1JNEA 3O5PA 1FFRA 3LUOA 1M5YA 3O5IA 4ITZA 1HXVA 2DT0A 1FKDA 2LGOA 4ODRA 3O5FA 1ZBWA 3WD0A 4Q7NA 1NWRA 4MTVA 1JNDA 1W1VA 3RM4A 1Y0OA 1YATA 4LAWA 2O92A 1HKKA 1J4IA 2KI3A 4Q22A 1E6RA 3UF8A 4DWSC 1Q6IA 1ZK6A 3O5KA 1NSGA 1Q6HA 1QPLA 2XP3A 1HJWA 1E15A 2FAPA 1WAWA 3WH0A 4JFLA 4KQZA 4ODOA 4ODMA 1C9HA 2DSVA 1EDQA 4N19A 3ARTA 1OGGA 1ZBVA 4P8WA 2PV1A 1W1TA 5DIVA 2F21A 1J4HA 2G8ZA 2KE0A 3MDYB 4DRKA 4MSPA 4W5UA 3WD3A 1TCOC 5JH8A 1J4RA 3ARYA 1BL4A 2PPPA 2ZR4A 5HT1A 4QT2A 4DZ2A 3UI5A 1D6OA 4TW6A 1W26A 4MGVA 4DRQA 2DSWA 2MNTA 1F40A 1E6NA 3ARWA 2PV2A 4NNRA 4MNMA 3OOBA 3O5JA 3B9EA 4Z2KA 1HJVA 3AS3A 1ROUA 1ITXA 1ZU8A 2MPHA 3PA7A 2M2AA 4S3JA 5HTGA 4W9QA 2MF9A 1HJXA 4TW7A 2XP6A 5D75A 2YBUA 3BXWA 3O5DA 1Q6UA 4GIVA 1ZB5A 1FKKA 4ZS6A 3WIJA 2DSUA 4G2PA 2DT3A 1L1PA 1FKHA 2D9FA 1W9PA 4O2TA 2PV3A 2DG9A 4AY1A 1FKSA 3KAGA 3PRDA 2YBTA 4HBEA 3ARSA 3CHEA 3KAIA 1NWTA 2KGJA 3B9DA 3RMEA 3ARZA 4JFJA 2VCDA 3NTPA 3ARUA 4FN2A 3AROA 1NH6A 4U86A 4DRNA 2M08A 2IUZA 4URIA 3O5LA 3TDBA 3PRBA 3RM8A 3FY1A 3ARQA 2OLHA 3GPKA 1U79A 4J4OA 1J6YA 3JYMA 4ODKA 1BKFA 1FJDA 1GUVA 4LAVA 4C02B 1E9LA 1FAPA 4JFMA 1NMWA 1UR9A 3VAWA 2Q5AA 4Z2LA 1W9VA 1NMVA 5BXJA 2MLZA 2ITKA 3WQWA 3FAPA 4IPXA 2ZQSA 3JYJA 2A3EA 1R9HA 1ZBKA 3UI4A 2DPEA 3O5QA 4DRPA 1FKIA 3UQBA 2JZVA 3W4RA 1LG1A 2PI6A 1T11A 1O6IA 2FDMA 2PPOA 4DWSD 3IHZA 4QT3A 4Z2GA 4LGXA 2DG4A 1JNSA 2A3BA 4ZPTR 2LKNA 5DITA 4L72B 3ALGA 2KFWA 2RUQA 4IQ2A 2O9OA 1LG2A 5HKGA 3CGMA 2XP5A 2ESCA 2QF8A 5GQBA 1GOIA 4DWSA 1E6ZA 2RQSA 1VF8A 4LAXA 3FXYA 1PINA 2RUCA 1F8AB 2XPAA 1UR8A 4MNJA 1LJYA 4ZPVR 2XP8A 1OWQA 3ARVA 1YW5A 4U84A 3NI6A 4IQCA 5HUAA 1IX5A 4P8XA 4WK9A 3B9AA 4WKAA 2B31A 3CZ8A 4MNLA 4FAPA 2VN1A 2LPVA 1ROTA 2ZQUA 4W9OA 3B7XA 4ODQA 3NRKA 4JFKA 4IT4A 4ODPA 3CGNA 4DWSB 4XAKA 2MLYA 5DO2A 3IKGA 3KACA 1LL7A 1KFWA 2DSZA 1RD6A 3O5OA 5HW7A 1QPFA 5HW8A 2UZ5A 4HBOA 1EYMA 4DZ3A 1FFQA 5DIUA 3UI6A 2N87A 4HARA 4GGQA 1WB0A 2ZQVA 4DRIA 1GPFA 1LQ0A 1ZL1A 4G50A 1P5QA 3PR9A 2F4EA 2WM0A 4Z2HA 1XRVA 1FKBA 2RUDA 3RFWA 3G6MA 3AS0A 1FKFA 4ZPWR 1X6NA 2DT2A 4BF8A 3JXVA 4R5EA 2LJ4A 1WNOA 1B6CA 1LL4A 1FKTA 1D7HA 3ODKA 5J6EA 3KABA 2ZR5A 5B8IC 1FKLA 3AS2A 5GPRA 3O5GA 2XP7A 3WD2A 2XPBA 3O5RA 2ZQTA 3PRAA 2RSEA 1W1YA 1EIBA 4WJXA 1HKIA 2DT1A 1W1PA 5HWCA 3O5MA 1KT0A 3CHCA 3H9RB 3ARXA 1PBKA 1LL6A 4LAYA 1D7JA 3KCEA 4TNSA 4NSBA 3WKZA 1HKJA 2WLYA 2OFNA 2XP9A 2RURA 1D7IA 4ML4A 3ALFA 1D2KA 4DROA 3ARPA 4IT6A 1FD9A 3WD1A 2PPNA 2KO7A 1H0IA 4W9PA 4QZVB 2DG3A 1N1AA 1KT1A 2ZR6A 5DF0A 3AS1A 3KZ7A 4MNKA 4DH0A 1EQ3A 4WKHA 1JNTA 2M1IA 2MLXA 4DRMA 1SR0A 4Z2JA 4NZCA 2WLZA 5HW6A 1XHGA 4S3KA 4ODNA 5I98A 4WKFA 2XP4A 1Q1CA 4L3NA 4WIWA 5GPGA 3WD4A 4U85A 4TW8A 3I6CA 3CHDA 4DIPA 1FKJA 1HKMA 4TYOA 4DT4A 3TC5A 4JYSA 1OGBA 1H0GA 4DRJA 3G6LA 2IF4A 1A7XA 2KR7A 1QZ2A 4TX0A 3KAHA 3RM9A 5HBFA 3RGCA 3OA5A 2F2DA 2A3CA 3UQAA 1K9TA 1EHNA 4MPKA 3CHFA 3B8SA 2FKEA 4Z2IA 2K8IA 3AQUA 1X6LA 5DEZA 2G41A 1E6PA 1W9UA 3WL0A 4MAVA 3CH9A 3IKDA 3KAFA 2AOSA 3O5EA 4J4NA 4ODLA 3QOKA 4JFIA 1JVWA 2L2SA 3TCZA 4PTMA 1ZCNA 1FKGA 2Y78A 3EY6A 3WQVA 3IK8A 3ARRA 4P8UA 5HWBA 4DRHA 1FKRA 1ZBCA 1SYTA 4QIBA 2AWGA 4KR0B 2A3AA 2WK2A 3WL1A 2PBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIV A;  3UQI A;  1PBK A;  2XP8 A;  1FKK A;  4LAY A;  1YW5 A;  1D7J A;  3KAD A;  3KCE A;  4R0X A;  3NI6 A;  4G2P A;  4IQC A;  4TNS A;  4U84 A;  5HUA A;  3O5P A;  3LUO A;  1M5Y A;  3O5I A;  4ITZ A;  1L1P A;  1FKH A;  1HXV A;  2OFN A;  2XP9 A;  2RUR A;  1D7I A;  1FKD A;  2LGO A;  4ODR A;  2D9F A;  3O5F A;  4O2T A;  4DRO A;  2PV3 A;  2DG9 A;  4FAP A;  2VN1 A;  1FD9 A;  1FKS A;  2LPV A;  1ROT A;  2KO7 A;  2PPN A;  2ZQU A;  3KAG A;  4W9P A;  3PRD A;  3B7X A;  4ODQ A;  4W9O A;  3NRK A;  4JFK A;  2DG3 A;  4ODP A;  3CGN A;  1N1A A;  3KAI A;  1KT1 A;  2KGJ A;  2ZR6 A;  4JFJ A;  1Y0O A;  1YAT A;  2MLY A;  2VCD A;  3KZ7 A;  4LAW A;  4DH0 A;  3NTP A;  1JNT A;  2M1I A;  2MLX A;  3IKG A;  4FN2 A;  4DRM A;  1EQ3 A;  1J4I A;  2KI3 A;  3KAC A;  5HW6 A;  4U86 A;  4DRN A;  2M08 A;  3O5L A;  3TDB A;  3O5O A;  4ODN A;  5I98 A;  3PRB A;  5HW7 A;  1QPF A;  5HW8 A;  2XP4 A;  3UF8 A;  2UZ5 A;  1Q6I A;  1ZK6 A;  1Q1C A;  3O5K A;  1NSG A;  1Q6H A;  5GPG A;  4U85 A;  1EYM A;  1QPL A;  3GPK A;  1U79 A;  2XP3 A;  4TW8 A;  4J4O A;  1J6Y A;  3I6C A;  3UI6 A;  3JYM A;  5DIU A;  4ODK A;  1BKF A;  2N87 A;  4DZ3 A;  1FJD A;  4LAV A;  4GGQ A;  2FAP A;  4DIP A;  1FKJ A;  3WH0 A;  4JFL A;  4C02 B;  4TYO A;  4DT4 A;  3TC5 A;  2ZQV A;  4JYS A;  1FAP A;  4DRI A;  4G50 A;  4DRJ A;  4JFM A;  1NMW A;  4ODO A;  2IF4 A;  1A7X A;  2KR7 A;  1QZ2 A;  1P5Q A;  3VAW A;  2F4E A;  2Q5A A;  4ODM A;  3KAH A;  4TX0 A;  1FKB A;  2RUD A;  3RFW A;  3RGC A;  1NMV A;  5BXJ A;  1FKF A;  2F2D A;  2MLZ A;  2ITK A;  3UQA A;  1C9H A;  3FAP A;  4N19 A;  4IPX A;  2ZQS A;  3JYJ A;  2FKE A;  1R9H A;  2PV1 A;  4BF8 A;  2K8I A;  3JXV A;  5DIV A;  2F21 A;  1J4H A;  2LJ4 A;  2KE0 A;  3UI4 A;  3MDY B;  3O5Q A;  4DRK A;  4DRP A;  4MSP A;  1FKI A;  3UQB A;  2JZV A;  1TCO C;  1T11 A;  1B6C A;  1J4R A;  1BL4 A;  2PPO A;  1FKT A;  2PPP A;  2ZR4 A;  3IHZ A;  3IKD A;  3KAF A;  4QT3 A;  5HT1 A;  1D7H A;  3ODK A;  4QT2 A;  4DZ2 A;  3O5E A;  5J6E A;  2DG4 A;  2ZR5 A;  3KAB A;  3UI5 A;  5B8I C;  4J4N A;  1JNS A;  4ODL A;  1D6O A;  2LKN A;  4TW6 A;  1FKL A;  1W26 A;  3O5G A;  5DIT A;  4MGV A;  2XP7 A;  4DRQ A;  2XPB A;  4JFI A;  3O5R A;  1JVW A;  2ZQT A;  2L2S A;  2KFW A;  2RUQ A;  3TCZ A;  4IQ2 A;  5HKG A;  2MNT A;  3CGM A;  1F40 A;  2PV2 A;  2XP5 A;  2RSE A;  1ZCN A;  4NNR A;  1FKG A;  2Y78 A;  3OOB A;  3O5J A;  3EY6 A;  2RQS A;  3IK8 A;  4LAX A;  5HWB A;  1ROU A;  2MPH A;  3PA7 A;  4DRH A;  5HTG A;  2M2A A;  5HWC A;  3O5M A;  1KT0 A;  4QIB A;  1FKR A;  4W9Q A;  2MF9 A;  4TW7 A;  2AWG A;  2XP6 A;  1PIN A;  5D75 A;  2RUC A;  1F8A B;  3O5D A;  2PBC A;  1Q6U A;  3H9R B;  2XPA A; 
#chains in the Genus database with same CATH topology
 3GU0 A;  3UQI A;  1TFV A;  1CTN A;  3KAD A;  4P8V A;  1NWU A;  1NWS A;  4R0X A;  1JNE A;  3O5P A;  1FFR A;  3LUO A;  1M5Y A;  3O5I A;  4ITZ A;  1HXV A;  2DT0 A;  1FKD A;  1E44 A;  2LGO A;  4ODR A;  3O5F A;  1ZBW A;  3WD0 A;  4Q7N A;  1NWR A;  4MTV A;  1JND A;  1W1V A;  3RM4 A;  1Y0O A;  1YAT A;  4LAW A;  2O92 A;  1HKK A;  1J4I A;  2KI3 A;  4Q22 A;  1E6R A;  1GRJ A;  3UF8 A;  4DWS C;  1Q6I A;  1ZK6 A;  3O5K A;  1NSG A;  1Q6H A;  1QPL A;  2XP3 A;  1HJW A;  1E15 A;  2FAP A;  1WAW A;  3WH0 A;  4JFL A;  4KQZ A;  4ODO A;  4ODM A;  1C9H A;  2DSV A;  1EDQ A;  4N19 A;  3ART A;  1OGG A;  1ZBV A;  4P8W A;  2PV1 A;  1W1T A;  5DIV A;  2F21 A;  1J4H A;  2G8Z A;  2KE0 A;  3MDY B;  4DRK A;  4MSP A;  4W5U A;  3WD3 A;  1TCO C;  5JH8 A;  1J4R A;  3ARY A;  1BL4 A;  2PPP A;  2ZR4 A;  5HT1 A;  4QT2 A;  4DZ2 A;  3UI5 A;  1D6O A;  4TW6 A;  1W26 A;  4MGV A;  4DRQ A;  2DSW A;  2MNT A;  1F40 A;  1E6N A;  3ARW A;  2PV2 A;  4NNR A;  4MNM A;  3OOB A;  3O5J A;  3B9E A;  4Z2K A;  1HJV A;  3AS3 A;  1ROU A;  1ITX A;  1ZU8 A;  2MPH A;  3PA7 A;  2M2A A;  4S3J A;  5HTG A;  4W9Q A;  2MF9 A;  1HJX A;  4TW7 A;  2XP6 A;  5D75 A;  2YBU A;  3BXW A;  3O5D A;  1Q6U A;  4GIV A;  1ZB5 A;  1FKK A;  4ZS6 A;  3WIJ A;  2DSU A;  4G2P A;  2DT3 A;  1L1P A;  1FKH A;  2D9F A;  1W9P A;  4O2T A;  2PV3 A;  2DG9 A;  4AY1 A;  1FKS A;  3KAG A;  3PRD A;  2YBT A;  4HBE A;  3ARS A;  3CHE A;  3KAI A;  1NWT A;  2KGJ A;  3B9D A;  3RME A;  3ARZ A;  4JFJ A;  2VCD A;  3NTP A;  3ARU A;  4FN2 A;  3ARO A;  1NH6 A;  4U86 A;  4DRN A;  2M08 A;  2IUZ A;  4URI A;  3O5L A;  3TDB A;  3PRB A;  3RM8 A;  3FY1 A;  3ARQ A;  2OLH A;  3GPK A;  1U79 A;  4J4O A;  1J6Y A;  3JYM A;  4ODK A;  1BKF A;  1FJD A;  1GUV A;  4LAV A;  4C02 B;  1E9L A;  1FAP A;  4JFM A;  1NMW A;  1UR9 A;  3VAW A;  2Q5A A;  4Z2L A;  1W9V A;  1NMV A;  5BXJ A;  2MLZ A;  2ITK A;  3WQW A;  3FAP A;  4IPX A;  2ZQS A;  3JYJ A;  2A3E A;  1R9H A;  1ZBK A;  3UI4 A;  2DPE A;  3O5Q A;  4DRP A;  1FKI A;  3UQB A;  2JZV A;  3W4R A;  1LG1 A;  2PI6 A;  1T11 A;  1O6I A;  2FDM A;  2PPO A;  4DWS D;  3IHZ A;  4QT3 A;  4Z2G A;  4LGX A;  2DG4 A;  1JNS A;  2A3B A;  4ZPT R;  2LKN A;  5DIT A;  4L72 B;  3ALG A;  2KFW A;  2RUQ A;  4IQ2 A;  2O9O A;  1LG2 A;  5HKG A;  3CGM A;  2XP5 A;  2ESC A;  2QF8 A;  5GQB A;  1GOI A;  4DWS A;  1E6Z A;  2RQS A;  1VF8 A;  3GTY X;  4LAX A;  3FXY A;  1PIN A;  2RUC A;  1F8A B;  2XPA A;  1UR8 A;  4MNJ A;  1LJY A;  4ZPV R;  2XP8 A;  1OWQ A;  3ARV A;  1YW5 A;  4U84 A;  3NI6 A;  4IQC A;  5HUA A;  1IX5 A;  4P8X A;  4WK9 A;  3B9A A;  4WKA A;  2B31 A;  2F23 A;  3CZ8 A;  2EUL A;  4MNL A;  4FAP A;  2VN1 A;  2LPV A;  1ROT A;  2ZQU A;  4W9O A;  3B7X A;  4ODQ A;  3NRK A;  4JFK A;  4IT4 A;  4ODP A;  3CGN A;  4DWS B;  4XAK A;  2MLY A;  5DO2 A;  3IKG A;  3KAC A;  1LL7 A;  1KFW A;  2DSZ A;  1RD6 A;  3O5O A;  5HW7 A;  1QPF A;  5HW8 A;  2UZ5 A;  4HBO A;  1EYM A;  4DZ3 A;  1FFQ A;  5DIU A;  3UI6 A;  2N87 A;  4HAR A;  4GGQ A;  1WB0 A;  2ZQV A;  4DRI A;  1GPF A;  1LQ0 A;  1ZL1 A;  4G50 A;  4UDM A;  1P5Q A;  3PR9 A;  2F4E A;  2WM0 A;  4Z2H A;  1XRV A;  1FKB A;  2RUD A;  3RFW A;  3G6M A;  3AS0 A;  1FKF A;  4ZPW R;  1X6N A;  2DT2 A;  4BF8 A;  3JXV A;  4R5E A;  2LJ4 A;  1WNO A;  1B6C A;  1LL4 A;  1FKT A;  1D7H A;  3ODK A;  5J6E A;  3KAB A;  2ZR5 A;  5B8I C;  1FKL A;  3AS2 A;  5GPR A;  3O5G A;  2XP7 A;  3WD2 A;  2XPB A;  3O5R A;  2ZQT A;  3PRA A;  2RSE A;  1W1Y A;  1EIB A;  4WJX A;  1HKI A;  2DT1 A;  1W1P A;  5HWC A;  2P4V A;  3O5M A;  1KT0 A;  3CHC A;  3H9R B;  3ARX A;  1PBK A;  1LL6 A;  4LAY A;  1D7J A;  3KCE A;  4TNS A;  4NSB A;  3WKZ A;  1HKJ A;  2WLY A;  2OFN A;  2XP9 A;  2RUR A;  1D7I A;  4ML4 A;  3ALF A;  1D2K A;  4DRO A;  3ARP A;  4IT6 A;  1FD9 A;  3WD1 A;  2PPN A;  2KO7 A;  1H0I A;  4W9P A;  4QZV B;  2DG3 A;  3BMB A;  1N1A A;  1KT1 A;  2ZR6 A;  5DF0 A;  3AS1 A;  3KZ7 A;  4MNK A;  4DH0 A;  1EQ3 A;  4WKH A;  1JNT A;  2M1I A;  2MLX A;  4DRM A;  1SR0 A;  4Z2J A;  4NZC A;  2WLZ A;  5HW6 A;  1XHG A;  4S3K A;  4ODN A;  5I98 A;  4WKF A;  2XP4 A;  1Q1C A;  4L3N A;  4WIW A;  5GPG A;  3WD4 A;  4U85 A;  4TW8 A;  3I6C A;  3CHD A;  4DIP A;  1FKJ A;  1HKM A;  4TYO A;  4DT4 A;  3TC5 A;  1JCH B;  4JYS A;  1OGB A;  1H0G A;  4DRJ A;  3G6L A;  2PN0 A;  2IF4 A;  1A7X A;  2KR7 A;  1QZ2 A;  4TX0 A;  3KAH A;  3RM9 A;  5HBF A;  3RGC A;  3OA5 A;  2F2D A;  2A3C A;  3UQA A;  1K9T A;  1EHN A;  4MPK A;  3CHF A;  3B8S A;  2FKE A;  4Z2I A;  2K8I A;  3AQU A;  1X6L A;  5DEZ A;  2G41 A;  1E6P A;  1W9U A;  3WL0 A;  4MAV A;  3CH9 A;  3IKD A;  3KAF A;  2AOS A;  3O5E A;  4J4N A;  4ODL A;  3QOK A;  4JFI A;  1JVW A;  2L2S A;  3TCZ A;  2ETN A;  4PTM A;  1ZCN A;  2B5U B;  1FKG A;  2Y78 A;  3EY6 A;  3WQV A;  3IK8 A;  3ARR A;  3EIP A;  4P8U A;  5HWB A;  4DRH A;  1FKR A;  1ZBC A;  1SYT A;  4QIB A;  2AWG A;  4KR0 B;  2A3A A;  2WK2 A;  3WL1 A;  2PBC A; 
#chains in the Genus database with same CATH homology
 3UQI A;  1TFV A;  1CTN A;  3KAD A;  4P8V A;  1NWU A;  1NWS A;  4R0X A;  1JNE A;  3O5P A;  1FFR A;  3LUO A;  1M5Y A;  3O5I A;  4ITZ A;  1HXV A;  2DT0 A;  1FKD A;  2LGO A;  4ODR A;  3O5F A;  1ZBW A;  3WD0 A;  4Q7N A;  1NWR A;  4MTV A;  1JND A;  1W1V A;  3RM4 A;  1Y0O A;  1YAT A;  4LAW A;  2O92 A;  1HKK A;  1J4I A;  2KI3 A;  4Q22 A;  1E6R A;  3UF8 A;  4DWS C;  1Q6I A;  1ZK6 A;  3O5K A;  1NSG A;  1Q6H A;  1QPL A;  2XP3 A;  1HJW A;  1E15 A;  2FAP A;  1WAW A;  3WH0 A;  4JFL A;  4KQZ A;  4ODO A;  4ODM A;  1C9H A;  2DSV A;  1EDQ A;  4N19 A;  3ART A;  1OGG A;  1ZBV A;  4P8W A;  2PV1 A;  1W1T A;  5DIV A;  2F21 A;  1J4H A;  2G8Z A;  2KE0 A;  3MDY B;  4DRK A;  4MSP A;  4W5U A;  3WD3 A;  1TCO C;  5JH8 A;  1J4R A;  3ARY A;  1BL4 A;  2PPP A;  2ZR4 A;  5HT1 A;  4QT2 A;  4DZ2 A;  3UI5 A;  1D6O A;  4TW6 A;  1W26 A;  4MGV A;  4DRQ A;  2DSW A;  2MNT A;  1F40 A;  1E6N A;  3ARW A;  2PV2 A;  4NNR A;  4MNM A;  3OOB A;  3O5J A;  3B9E A;  4Z2K A;  1HJV A;  3AS3 A;  1ROU A;  1ITX A;  1ZU8 A;  2MPH A;  3PA7 A;  2M2A A;  4S3J A;  5HTG A;  4W9Q A;  2MF9 A;  1HJX A;  4TW7 A;  2XP6 A;  5D75 A;  2YBU A;  3BXW A;  3O5D A;  1Q6U A;  4GIV A;  1ZB5 A;  1FKK A;  4ZS6 A;  3WIJ A;  2DSU A;  4G2P A;  2DT3 A;  1L1P A;  1FKH A;  2D9F A;  1W9P A;  4O2T A;  2PV3 A;  2DG9 A;  4AY1 A;  1FKS A;  3KAG A;  3PRD A;  2YBT A;  4HBE A;  3ARS A;  3CHE A;  3KAI A;  1NWT A;  2KGJ A;  3B9D A;  3RME A;  3ARZ A;  4JFJ A;  2VCD A;  3NTP A;  3ARU A;  4FN2 A;  3ARO A;  1NH6 A;  4U86 A;  4DRN A;  2M08 A;  2IUZ A;  4URI A;  3O5L A;  3TDB A;  3PRB A;  3RM8 A;  3FY1 A;  3ARQ A;  2OLH A;  3GPK A;  1U79 A;  4J4O A;  1J6Y A;  3JYM A;  4ODK A;  1BKF A;  1FJD A;  1GUV A;  4LAV A;  4C02 B;  1E9L A;  1FAP A;  4JFM A;  1NMW A;  1UR9 A;  3VAW A;  2Q5A A;  4Z2L A;  1W9V A;  1NMV A;  5BXJ A;  2MLZ A;  2ITK A;  3WQW A;  3FAP A;  4IPX A;  2ZQS A;  3JYJ A;  2A3E A;  1R9H A;  1ZBK A;  3UI4 A;  2DPE A;  3O5Q A;  4DRP A;  1FKI A;  3UQB A;  2JZV A;  3W4R A;  1LG1 A;  2PI6 A;  1T11 A;  1O6I A;  2FDM A;  2PPO A;  4DWS D;  3IHZ A;  4QT3 A;  4Z2G A;  4LGX A;  2DG4 A;  1JNS A;  2A3B A;  4ZPT R;  2LKN A;  5DIT A;  4L72 B;  3ALG A;  2KFW A;  2RUQ A;  4IQ2 A;  2O9O A;  1LG2 A;  5HKG A;  3CGM A;  2XP5 A;  2ESC A;  2QF8 A;  5GQB A;  1GOI A;  4DWS A;  1E6Z A;  2RQS A;  1VF8 A;  4LAX A;  3FXY A;  1PIN A;  2RUC A;  1F8A B;  2XPA A;  1UR8 A;  4MNJ A;  1LJY A;  4ZPV R;  2XP8 A;  1OWQ A;  3ARV A;  1YW5 A;  4U84 A;  3NI6 A;  4IQC A;  5HUA A;  1IX5 A;  4P8X A;  4WK9 A;  3B9A A;  4WKA A;  2B31 A;  3CZ8 A;  4MNL A;  4FAP A;  2VN1 A;  2LPV A;  1ROT A;  2ZQU A;  4W9O A;  3B7X A;  4ODQ A;  3NRK A;  4JFK A;  4IT4 A;  4ODP A;  3CGN A;  4DWS B;  4XAK A;  2MLY A;  5DO2 A;  3IKG A;  3KAC A;  1LL7 A;  1KFW A;  2DSZ A;  1RD6 A;  3O5O A;  5HW7 A;  1QPF A;  5HW8 A;  2UZ5 A;  4HBO A;  1EYM A;  4DZ3 A;  1FFQ A;  5DIU A;  3UI6 A;  2N87 A;  4HAR A;  4GGQ A;  1WB0 A;  2ZQV A;  4DRI A;  1GPF A;  1LQ0 A;  1ZL1 A;  4G50 A;  1P5Q A;  3PR9 A;  2F4E A;  2WM0 A;  4Z2H A;  1XRV A;  1FKB A;  2RUD A;  3RFW A;  3G6M A;  3AS0 A;  1FKF A;  4ZPW R;  1X6N A;  2DT2 A;  4BF8 A;  3JXV A;  4R5E A;  2LJ4 A;  1WNO A;  1B6C A;  1LL4 A;  1FKT A;  1D7H A;  3ODK A;  5J6E A;  3KAB A;  2ZR5 A;  5B8I C;  1FKL A;  3AS2 A;  5GPR A;  3O5G A;  2XP7 A;  3WD2 A;  2XPB A;  3O5R A;  2ZQT A;  3PRA A;  2RSE A;  1W1Y A;  1EIB A;  4WJX A;  1HKI A;  2DT1 A;  1W1P A;  5HWC A;  3O5M A;  1KT0 A;  3CHC A;  3H9R B;  3ARX A;  1PBK A;  1LL6 A;  4LAY A;  1D7J A;  3KCE A;  4TNS A;  4NSB A;  3WKZ A;  1HKJ A;  2WLY A;  2OFN A;  2XP9 A;  2RUR A;  1D7I A;  4ML4 A;  3ALF A;  1D2K A;  4DRO A;  3ARP A;  4IT6 A;  1FD9 A;  3WD1 A;  2PPN A;  2KO7 A;  1H0I A;  4W9P A;  4QZV B;  2DG3 A;  1N1A A;  1KT1 A;  2ZR6 A;  5DF0 A;  3AS1 A;  3KZ7 A;  4MNK A;  4DH0 A;  1EQ3 A;  4WKH A;  1JNT A;  2M1I A;  2MLX A;  4DRM A;  1SR0 A;  4Z2J A;  4NZC A;  2WLZ A;  5HW6 A;  1XHG A;  4S3K A;  4ODN A;  5I98 A;  4WKF A;  2XP4 A;  1Q1C A;  4L3N A;  4WIW A;  5GPG A;  3WD4 A;  4U85 A;  4TW8 A;  3I6C A;  3CHD A;  4DIP A;  1FKJ A;  1HKM A;  4TYO A;  4DT4 A;  3TC5 A;  4JYS A;  1OGB A;  1H0G A;  4DRJ A;  3G6L A;  2IF4 A;  1A7X A;  2KR7 A;  1QZ2 A;  4TX0 A;  3KAH A;  3RM9 A;  5HBF A;  3RGC A;  3OA5 A;  2F2D A;  2A3C A;  3UQA A;  1K9T A;  1EHN A;  4MPK A;  3CHF A;  3B8S A;  2FKE A;  4Z2I A;  2K8I A;  3AQU A;  1X6L A;  5DEZ A;  2G41 A;  1E6P A;  1W9U A;  3WL0 A;  4MAV A;  3CH9 A;  3IKD A;  3KAF A;  2AOS A;  3O5E A;  4J4N A;  4ODL A;  3QOK A;  4JFI A;  1JVW A;  2L2S A;  3TCZ A;  4PTM A;  1ZCN A;  1FKG A;  2Y78 A;  3EY6 A;  3WQV A;  3IK8 A;  3ARR A;  4P8U A;  5HWB A;  4DRH A;  1FKR A;  1ZBC A;  1SYT A;  4QIB A;  2AWG A;  4KR0 B;  2A3A A;  2WK2 A;  3WL1 A;  2PBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...