3RGCA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
251
structure length
248
Chain Sequence
NAIAVVVDKEPITTYDIDQTMKALKIDRNKALGVLINEKMEISQMKQLGIVVNDLELDDAINKMLAQNKTTLNAFKANLKSSYEQFRTNFKKDLEKRKLYEKIASMAKTDFSDDGAKKFFEQNKDKFTFYTQINANIYLSNNPQTLENIKNTKKTILKPQNASLNTSNADPRLLGLLSQIPVGSFSPVLNGKNGYELYEVKSKDGTQTPEYEQVKNEVLNAYVSEQRQNFIQDYFDKLRSKINIEYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible periplasmic protein
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Chaperone
total genus 81
structure length 248
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09312 SurA_N SurA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4030.30 Mainly Alpha Orthogonal Bundle Triger factor/SurA peptide-binding fold Triger factor/SurA peptide-binding fold 3rgcA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rgcA02
2MLYA 4DRNA 4GIVA 3I6CA 4J4NA 1FKTA 4JFLA 4U84A 5BXJA 3RGCA 4DRMA 1A7XA 2ZQVA 4JYSA 4J4OA 1C9HA 1FKJA 1KT1A 3O5KA 3KABA 4ODPA 2XP5A 2PV1A 3UI6A 1L1PA 1U79A 3KAGA 1Q6HA 1NMWA 4FN2A 3O5MA 4W9QA 3LUOA 3MDYB 2ZR5A 1P5QA 4TW6A 2KFWA 2Q5AA 3O5FA 2VCDA 2M1IA 1ZK6A 2MNTA 2XPAA 3O5JA 3O5EA 2DG3A 2XP7A 4GGQA 4DROA 1FKDA 1JVWA 5HKGA 1JNSA 2LJ4A 1ZCNA 1FKHA 1EYMA 2OFNA 2RURA 4DZ3A 1R9HA 2KO7A 1NSGA 1D6OA 1FKIA 2MLZA 2PPOA 2RUQA 4NNRA 4QT3A 4TNSA 4TYOA 5HT1A 3UQIA 4DRPA 2UZ5A 5HUAA 2XP3A 3O5DA 5HW8A 3CGNA 4MGVA 3IKGA 1PINA 4ODRA 3TCZA 3TDBA 1FKFA 1KT0A 2JZVA 1QPLA 1ROTA 2MF9A 3KACA 1FKKA 1W26A 3KZ7A 2ZR4A 3O5LA 3TC5A 2VN1A 1F8AB 3O5OA 2ITKA 4FAPA 5HW6A 4ODOA 3UQAA 1Q1CA 2FKEA 3KAIA 4QIBA 4DRKA 4QT2A 4G50A 1M5YA 4W9OA 3WH0A 2ZQTA 2XP4A 3GPKA 2MPHA 5GPGA 1BL4A 3KCEA 2K8IA 2PPPA 1BKFA 2F21A 4ODQA 3UI5A 1T11A 1D7JA 2MLXA 5D75A 1Q6IA 2D9FA 4TW8A 3PRDA 3O5RA 4LAXA 1HXVA 1J4IA 3NTPA 1FKRA 1PBKA 3IK8A 3KADA 2FAPA 4DRJA 3O5GA 4DZ2A 4R0XA 3IKDA 2PBCA 1FAPA 1QPFA 3UF8A 2XP9A 4LAVA 5B8IC 4IQCA 1FKLA 4ODMA 3B7XA 4O2TA 2ZQSA 1J4RA 2PV2A 4LAWA 1YATA 2PPNA 1NMVA 2M2AA 4DRHA 2L2SA 4LAYA 2KR7A 2RSEA 2Y78A 2LPVA 1D7IA 2KE0A 2ZQUA 3ODKA 1FD9A 3EY6A 3JXVA 4JFKA 1B6CA 2XP6A 5DITA 4G2PA 2LGOA 4ODLA 2LKNA 4TW7A 3NI6A 2RQSA 2RUCA 3JYMA 1D7HA 1FKGA 4JFMA 3KAFA 1FKBA 2N87A 4N19A 2AWGA 2PV3A 5HWCA 2RUDA 5J6EA 3IHZA 1J4HA 2DG9A 4W9PA 3NRKA 3KAHA 2IF4A 4DT4A 5HW7A 2ZR6A 3UQBA 2KGJA 1Y0OA 4DRQA 4MSPA 4JFJA 5DIUA 2DG4A 3PA7A 4IQ2A 4BF8A 4DIPA 2F2DA 4JFIA 1TCOC 4C02B 4U85A 5HTGA 3H9RB 3RFWA 4U86A 1F40A 2F4EA 2KI3A 1FKSA 1JNTA 1YW5A 3O5QA 3JYJA 4TX0A 4DH0A 1EQ3A 2M08A 2XPBA 4ODKA 1QZ2A 1J6YA 5I98A 3FAPA 3O5PA 3O5IA 3OOBA 3PRBA 4DRIA 3UI4A 4ODNA 4IPXA 2XP8A 5DIVA 1ROUA 4ITZA 1Q6UA 5HWBA 1FJDA 1N1AA 3VAWA 3CGMA
chains in the Genus database with same CATH superfamily
1FKTA 3B9AA 4JYSA 3WIJA 3O5KA 4KQZA 4MNLA 2XP5A 2PV1A 3O5MA 4W9QA 3MDYB 1X6LA 1NWSA 3WL1A 1WAWA 2AOSA 4P8XA 4W5UA 2XPAA 3PR9A 1D2KA 1JNSA 1FKDA 1LL7A 1ZCNA 1TFVA 3B8SA 2WLYA 2KO7A 1NSGA 2DT2A 1FKIA 4TNSA 1UR8A 3B9DA 4QT3A 4DRPA 1E15A 2XP3A 3O5DA 3WD1A 3TCZA 5GQBA 3WD0A 1ZBCA 2MF9A 3KACA 3TC5A 1W26A 2ZR4A 1F8AB 2F23A 2PN0A 1EHNA 2DSWA 4G50A 4W9OA 3WH0A 2MPHA 1BL4A 2K8IA 2PPPA 4ODQA 5D75A 1Q6IA 1HKKA 1GOIA 3O5RA 1JCHB 1OWQA 4MNKA 2FAPA 4DRJA 1IX5A 1LL6A 4R0XA 1O6IA 1OGGA 2PBCA 1ZU8A 4IT4A 5B8IC 1FKLA 3CH9A 4O2TA 2ZQSA 4AY1A 1NMVA 2L2SA 4ZPWR 4Z2HA 3AS2A 2Y78A 2LPVA 5DITA 1LQ0A 1UR9A 4G2PA 2LGOA 2B5UB 2LKNA 3NI6A 2RQSA 4MAVA 4ZPTR 4JFMA 2AWGA 2FDMA 2WLZA 5DF0A 3IHZA 4DT4A 4PTMA 2IF4A 2G8ZA 4DWSA 4DRQA 3QOKA 4MSPA 4R5EA 1W9VA 4BF8A 5HTGA 2F2DA 4U86A 4NZCA 1YW5A 3JYJA 4WJXA 1J6YA 3FAPA 3O5PA 3UI4A 3WL0A 1ROUA 4ITZA 3VAWA 3CGMA 3ARTA 1WNOA 4DRNA 2OLHA 3ALGA 5BXJA 4DRMA 1A7XA 4J4OA 2DT3A 1FKJA 3KABA 3KAGA 3ARRA 2Q5AA 1XRVA 3AS0A 4HARA 3O5JA 1JNEA 2O92A 4Z2KA 1EYMA 4DZ3A 1D6OA 3UQIA 5HT1A 4NNRA 5HUAA 3CZ8A 2UZ5A 3CGNA 3TDBA 4L72B 3KZ7A 1FKKA 3O5LA 3GTYX 3O5OA 5HW6A 4FAPA 1H0GA 4QIBA 4DRKA 2XP4A 1NWUA 5GPGA 2MLXA 2P4VA 2G41A 3NTPA 4UDMA 1PBKA 3IK8A 3WKZA 3KADA 3ARSA 2ESCA 3IKDA 2A3EA 4Z2GA 1FAPA 4IT6A 2XP9A 5DEZA 4IQCA 4WKFA 1EDQA 1WB0A 4WIWA 2PPNA 3ARPA 3ARQA 1LJYA 2O9OA 4ZS6A 2KR7A 4QZVB 4Q7NA 2RSEA 4L3NA 2KE0A 3RMEA 3EY6A 1B6CA 3WQWA 3BMBA 3CHCA 1D7HA 1NWTA 3KAFA 1FKBA 5HWCA 2RUDA 5HBFA 4DWSB 2ZR6A 1SR0A 3UQBA 1KFWA 3PA7A 1VF8A 4MTVA 4DIPA 3GU0A 4C02B 1TCOC 2KI3A 1FKSA 1GPFA 3O5QA 4TX0A 1E6PA 2WM0A 2XPBA 4DWSD 3AS3A 4IPXA 5DIVA 2ETNA 2MLYA 4GIVA 4J4NA 3B9EA 3ARYA 2ZQVA 4XAKA 1C9HA 1KT1A 3UI6A 1L1PA 1HJXA 1NWRA 1U79A 1NMWA 4FN2A 1ZBVA 2ZR5A 4MNMA 1E44A 4WKHA 5JH8A 1ZK6A 2WK2A 2DG3A 3ALFA 2OFNA 2RURA 4LGXA 1R9HA 2EULA 4TYOA 2MLZA 2RUQA 5HW8A 3WQVA 3IKGA 1PINA 4ODRA 5DO2A 1KT0A 1CTNA 2VN1A 2ITKA 3KAIA 4QT2A 3GPKA 1HKJA 3KCEA 1ITXA 1BKFA 3RM4A 1E6RA 3UI5A 1T11A 1D7JA 2DT1A 3PRDA 4LAXA 1W9PA 1J4IA 3G6LA 3WD4A 3O5GA 3UF8A 3CHFA 1GUVA 4ODMA 1J4RA 4LAWA 2M2AA 3PRAA 4HBEA 4DRHA 1ZBWA 4KR0B 3CHDA 1FD9A 3JXVA 1SYTA 1FFQA 2N87A 3G6MA 2PV3A 4N19A 5J6EA 1J4HA 4W9PA 3NRKA 3ARVA 1HKIA 1HKMA 1NH6A 1E6NA 1LG1A 4DWSC 1E6ZA 1XHGA 5DIUA 3W4RA 2DG4A 2DSVA 4JFIA 2A3BA 3H9RB 3RFWA 1F40A 2F4EA 1JNTA 1EQ3A 2M08A 1QZ2A 4Z2IA 3O5IA 3PRBA 3WD3A 4ODNA 1FJDA 2XP8A 4URIA 3ARZA 1Q6UA 1N1AA 3I6CA 4U84A 4JFLA 2DT0A 4HBOA 3RGCA 3RM9A 4ODPA 2B31A 4WK9A 3FY1A 4S3JA 4NSBA 1LL4A 1Q6HA 4WKAA 1H0IA 3LUOA 1P5QA 1HJWA 2KFWA 3O5FA 4TW6A 5GPRA 2VCDA 2M1IA 2MNTA 3O5EA 2XP7A 4GGQA 4DROA 1JVWA 5HKGA 2LJ4A 1FKHA 1W1VA 1K9TA 2PPOA 3WD2A 3OA5A 1FFRA 4MGVA 2YBUA 1FKFA 2JZVA 1QPLA 1ROTA 2YBTA 1W1PA 4MPKA 3UQAA 4ODOA 4Z2JA 1Q1CA 2FKEA 3BXWA 1M5YA 2ZQTA 3ARXA 2F21A 1OGBA 1W1YA 2DSZA 2D9FA 3ARUA 4TW8A 1ZBKA 3FXYA 1HXVA 4P8WA 1W9UA 1FKRA 4ML4A 3RM8A 2DPEA 4DZ2A 4P8UA 3AS1A 1QPFA 4LAVA 4ZPVR 3B7XA 4Q22A 2PV2A 1YATA 4LAYA 1EIBA 1GRJA 3AROA 3EIPA 1LG2A 1D7IA 2ZQUA 3AQUA 3ODKA 4JFKA 2XP6A 4ODLA 4TW7A 2RUCA 3JYMA 1FKGA 1W1TA 3CHEA 2DG9A 3ARWA 3KAHA 5HW7A 2IUZA 2KGJA 1Y0OA 2DSUA 4JFJA 4MNJA 1HJVA 4IQ2A 4Z2LA 1JNDA 1RD6A 4U85A 2PI6A 1E9LA 4DH0A 4ODKA 2A3AA 5I98A 4S3KA 4P8VA 2A3CA 1ZL1A 3OOBA 4DRIA 1X6NA 5HWBA 2QF8A 1ZB5A
chains in the Genus database with same CATH topology
1FKTA 3B9AA 4JYSA 3WIJA 3O5KA 4KQZA 4MNLA 2XP5A 2PV1A 3O5MA 4W9QA 3MDYB 1X6LA 1NWSA 3WL1A 1WAWA 2AOSA 4P8XA 4W5UA 2XPAA 3PR9A 1D2KA 1JNSA 1FKDA 1LL7A 1ZCNA 1TFVA 3B8SA 2WLYA 2KO7A 1NSGA 2DT2A 1FKIA 4TNSA 1UR8A 3B9DA 4QT3A 4DRPA 1E15A 2XP3A 3O5DA 3WD1A 3TCZA 5GQBA 3WD0A 1ZBCA 2MF9A 3KACA 3TC5A 1W26A 2ZR4A 1F8AB 1EHNA 2DSWA 4G50A 4W9OA 3WH0A 2MPHA 1BL4A 2K8IA 2PPPA 4ODQA 5D75A 1Q6IA 1HKKA 1GOIA 3O5RA 1OWQA 4MNKA 2FAPA 4DRJA 1IX5A 1LL6A 4R0XA 1O6IA 1OGGA 2PBCA 1ZU8A 4IT4A 5B8IC 1FKLA 3CH9A 4O2TA 2ZQSA 4AY1A 1NMVA 2L2SA 4ZPWR 4Z2HA 3AS2A 2Y78A 2LPVA 5DITA 1LQ0A 1UR9A 4G2PA 2LGOA 2LKNA 3NI6A 2RQSA 4MAVA 4ZPTR 4JFMA 2AWGA 2FDMA 2WLZA 5DF0A 3IHZA 4DT4A 4PTMA 2IF4A 2G8ZA 4DWSA 4DRQA 3QOKA 4MSPA 4R5EA 1W9VA 4BF8A 5HTGA 2F2DA 4U86A 4NZCA 1YW5A 3JYJA 4WJXA 1J6YA 3FAPA 3O5PA 3UI4A 3WL0A 1ROUA 4ITZA 3VAWA 3CGMA 3ARTA 1WNOA 4DRNA 2OLHA 3ALGA 5BXJA 4DRMA 1A7XA 4J4OA 2DT3A 1FKJA 3KABA 3KAGA 3ARRA 2Q5AA 1XRVA 3AS0A 4HARA 3O5JA 1JNEA 2O92A 4Z2KA 1EYMA 4DZ3A 1D6OA 3UQIA 5HT1A 4NNRA 5HUAA 3CZ8A 2UZ5A 3CGNA 3TDBA 4L72B 3KZ7A 1FKKA 3O5LA 3O5OA 5HW6A 4FAPA 1H0GA 4QIBA 4DRKA 2XP4A 1NWUA 5GPGA 2MLXA 2G41A 3NTPA 1PBKA 3IK8A 3WKZA 3KADA 3ARSA 2ESCA 3IKDA 2A3EA 4Z2GA 1FAPA 4IT6A 2XP9A 5DEZA 4IQCA 4WKFA 1EDQA 1WB0A 4WIWA 2PPNA 3ARPA 3ARQA 1LJYA 2O9OA 4ZS6A 2KR7A 4QZVB 4Q7NA 2RSEA 4L3NA 2KE0A 3RMEA 3EY6A 1B6CA 3WQWA 3CHCA 1D7HA 1NWTA 3KAFA 1FKBA 5HWCA 2RUDA 5HBFA 4DWSB 2ZR6A 1SR0A 3UQBA 1KFWA 3PA7A 1VF8A 4MTVA 4DIPA 4C02B 1TCOC 2KI3A 1FKSA 1GPFA 3O5QA 4TX0A 1E6PA 2WM0A 2XPBA 4DWSD 3AS3A 4IPXA 5DIVA 2MLYA 4GIVA 4J4NA 3B9EA 3ARYA 2ZQVA 4XAKA 1C9HA 1KT1A 3UI6A 1L1PA 1HJXA 1NWRA 1U79A 1NMWA 4FN2A 1ZBVA 2ZR5A 4MNMA 4WKHA 5JH8A 1ZK6A 2WK2A 2DG3A 3ALFA 2OFNA 2RURA 4LGXA 1R9HA 4TYOA 2MLZA 2RUQA 5HW8A 3WQVA 3IKGA 1PINA 4ODRA 5DO2A 1KT0A 1CTNA 2VN1A 2ITKA 3KAIA 4QT2A 3GPKA 1HKJA 3KCEA 1ITXA 1BKFA 3RM4A 1E6RA 3UI5A 1T11A 1D7JA 2DT1A 3PRDA 4LAXA 1W9PA 1J4IA 3G6LA 3WD4A 3O5GA 3UF8A 3CHFA 1GUVA 4ODMA 1J4RA 4LAWA 2M2AA 3PRAA 4HBEA 4DRHA 1ZBWA 4KR0B 3CHDA 1FD9A 3JXVA 1SYTA 1FFQA 2N87A 3G6MA 2PV3A 4N19A 5J6EA 1J4HA 4W9PA 3NRKA 3ARVA 1HKIA 1HKMA 1NH6A 1E6NA 1LG1A 4DWSC 1E6ZA 1XHGA 5DIUA 3W4RA 2DG4A 2DSVA 4JFIA 2A3BA 3H9RB 3RFWA 1F40A 2F4EA 1JNTA 1EQ3A 2M08A 1QZ2A 4Z2IA 3O5IA 3PRBA 3WD3A 4ODNA 1FJDA 2XP8A 4URIA 3ARZA 1Q6UA 1N1AA 3I6CA 4U84A 4JFLA 2DT0A 4HBOA 3RGCA 3RM9A 4ODPA 2B31A 4WK9A 3FY1A 4S3JA 4NSBA 1LL4A 1Q6HA 4WKAA 1H0IA 3LUOA 1P5QA 1HJWA 2KFWA 3O5FA 4TW6A 5GPRA 2VCDA 2M1IA 2MNTA 3O5EA 2XP7A 4GGQA 4DROA 1JVWA 5HKGA 2LJ4A 1FKHA 1W1VA 1K9TA 2PPOA 3WD2A 3OA5A 1FFRA 4MGVA 2YBUA 1FKFA 2JZVA 1QPLA 1ROTA 2YBTA 1W1PA 4MPKA 3UQAA 4ODOA 4Z2JA 1Q1CA 2FKEA 3BXWA 1M5YA 2ZQTA 3ARXA 2F21A 1OGBA 1W1YA 2DSZA 2D9FA 3ARUA 4TW8A 1ZBKA 3FXYA 1HXVA 4P8WA 1W9UA 1FKRA 4ML4A 3RM8A 2DPEA 4DZ2A 4P8UA 3AS1A 1QPFA 4LAVA 4ZPVR 3B7XA 4Q22A 2PV2A 1YATA 4LAYA 1EIBA 3AROA 1LG2A 1D7IA 2ZQUA 3AQUA 3ODKA 4JFKA 2XP6A 4ODLA 4TW7A 2RUCA 3JYMA 1FKGA 1W1TA 3CHEA 2DG9A 3ARWA 3KAHA 5HW7A 2IUZA 2KGJA 1Y0OA 2DSUA 4JFJA 4MNJA 1HJVA 4IQ2A 4Z2LA 1JNDA 1RD6A 4U85A 2PI6A 1E9LA 4DH0A 4ODKA 2A3AA 5I98A 4S3KA 4P8VA 2A3CA 1ZL1A 3OOBA 4DRIA 1X6NA 5HWBA 2QF8A 1ZB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLY A;  4DRN A;  4GIV A;  3I6C A;  4J4N A;  1FKT A;  4JFL A;  4U84 A;  5BXJ A;  3RGC A;  4DRM A;  1A7X A;  2ZQV A;  4JYS A;  4J4O A;  1C9H A;  1FKJ A;  1KT1 A;  3O5K A;  3KAB A;  4ODP A;  2XP5 A;  2PV1 A;  3UI6 A;  1L1P A;  1U79 A;  3KAG A;  1Q6H A;  1NMW A;  4FN2 A;  3O5M A;  4W9Q A;  3LUO A;  3MDY B;  2ZR5 A;  1P5Q A;  4TW6 A;  2KFW A;  2Q5A A;  3O5F A;  2VCD A;  2M1I A;  1ZK6 A;  2MNT A;  2XPA A;  3O5J A;  3O5E A;  2DG3 A;  2XP7 A;  4GGQ A;  4DRO A;  1FKD A;  1JVW A;  5HKG A;  1JNS A;  2LJ4 A;  1ZCN A;  1FKH A;  1EYM A;  2OFN A;  2RUR A;  4DZ3 A;  1R9H A;  2KO7 A;  1NSG A;  1D6O A;  1FKI A;  2MLZ A;  2PPO A;  2RUQ A;  4NNR A;  4QT3 A;  4TNS A;  4TYO A;  5HT1 A;  3UQI A;  4DRP A;  2UZ5 A;  5HUA A;  2XP3 A;  3O5D A;  5HW8 A;  3CGN A;  4MGV A;  3IKG A;  1PIN A;  4ODR A;  3TCZ A;  3TDB A;  1FKF A;  1KT0 A;  2JZV A;  1QPL A;  1ROT A;  2MF9 A;  3KAC A;  1FKK A;  1W26 A;  3KZ7 A;  2ZR4 A;  3O5L A;  3TC5 A;  2VN1 A;  1F8A B;  3O5O A;  2ITK A;  4FAP A;  5HW6 A;  4ODO A;  3UQA A;  1Q1C A;  2FKE A;  3KAI A;  4QIB A;  4DRK A;  4QT2 A;  4G50 A;  1M5Y A;  4W9O A;  3WH0 A;  2ZQT A;  2XP4 A;  3GPK A;  2MPH A;  5GPG A;  1BL4 A;  3KCE A;  2K8I A;  2PPP A;  1BKF A;  2F21 A;  4ODQ A;  3UI5 A;  1T11 A;  1D7J A;  2MLX A;  5D75 A;  1Q6I A;  2D9F A;  4TW8 A;  3PRD A;  3O5R A;  4LAX A;  1HXV A;  1J4I A;  3NTP A;  1FKR A;  1PBK A;  3IK8 A;  3KAD A;  2FAP A;  4DRJ A;  3O5G A;  4DZ2 A;  4R0X A;  3IKD A;  2PBC A;  1FAP A;  1QPF A;  3UF8 A;  2XP9 A;  4LAV A;  5B8I C;  4IQC A;  1FKL A;  4ODM A;  3B7X A;  4O2T A;  2ZQS A;  1J4R A;  2PV2 A;  4LAW A;  1YAT A;  2PPN A;  1NMV A;  2M2A A;  4DRH A;  2L2S A;  4LAY A;  2KR7 A;  2RSE A;  2Y78 A;  2LPV A;  1D7I A;  2KE0 A;  2ZQU A;  3ODK A;  1FD9 A;  3EY6 A;  3JXV A;  4JFK A;  1B6C A;  2XP6 A;  5DIT A;  4G2P A;  2LGO A;  4ODL A;  2LKN A;  4TW7 A;  3NI6 A;  2RQS A;  2RUC A;  3JYM A;  1D7H A;  1FKG A;  4JFM A;  3KAF A;  1FKB A;  2N87 A;  4N19 A;  2AWG A;  2PV3 A;  5HWC A;  2RUD A;  5J6E A;  3IHZ A;  1J4H A;  2DG9 A;  4W9P A;  3NRK A;  3KAH A;  2IF4 A;  4DT4 A;  5HW7 A;  2ZR6 A;  3UQB A;  2KGJ A;  1Y0O A;  4DRQ A;  4MSP A;  4JFJ A;  5DIU A;  2DG4 A;  3PA7 A;  4IQ2 A;  4BF8 A;  4DIP A;  2F2D A;  4JFI A;  1TCO C;  4C02 B;  4U85 A;  5HTG A;  3H9R B;  3RFW A;  4U86 A;  1F40 A;  2F4E A;  2KI3 A;  1FKS A;  1JNT A;  1YW5 A;  3O5Q A;  3JYJ A;  4TX0 A;  4DH0 A;  1EQ3 A;  2M08 A;  2XPB A;  4ODK A;  1QZ2 A;  1J6Y A;  5I98 A;  3FAP A;  3O5P A;  3O5I A;  3OOB A;  3PRB A;  4DRI A;  3UI4 A;  4ODN A;  4IPX A;  2XP8 A;  5DIV A;  1ROU A;  4ITZ A;  1Q6U A;  5HWB A;  1FJD A;  1N1A A;  3VAW A;  3CGM A; 
#chains in the Genus database with same CATH topology
 1FKT A;  3B9A A;  4JYS A;  3WIJ A;  3O5K A;  4KQZ A;  4MNL A;  2XP5 A;  2PV1 A;  3O5M A;  4W9Q A;  3MDY B;  1X6L A;  1NWS A;  3WL1 A;  1WAW A;  2AOS A;  4P8X A;  4W5U A;  2XPA A;  3PR9 A;  1D2K A;  1JNS A;  1FKD A;  1LL7 A;  1ZCN A;  1TFV A;  3B8S A;  2WLY A;  2KO7 A;  1NSG A;  2DT2 A;  1FKI A;  4TNS A;  1UR8 A;  3B9D A;  4QT3 A;  4DRP A;  1E15 A;  2XP3 A;  3O5D A;  3WD1 A;  3TCZ A;  5GQB A;  3WD0 A;  1ZBC A;  2MF9 A;  3KAC A;  3TC5 A;  1W26 A;  2ZR4 A;  1F8A B;  2F23 A;  2PN0 A;  1EHN A;  2DSW A;  4G50 A;  4W9O A;  3WH0 A;  2MPH A;  1BL4 A;  2K8I A;  2PPP A;  4ODQ A;  5D75 A;  1Q6I A;  1HKK A;  1GOI A;  3O5R A;  1JCH B;  1OWQ A;  4MNK A;  2FAP A;  4DRJ A;  1IX5 A;  1LL6 A;  4R0X A;  1O6I A;  1OGG A;  2PBC A;  1ZU8 A;  4IT4 A;  5B8I C;  1FKL A;  3CH9 A;  4O2T A;  2ZQS A;  4AY1 A;  1NMV A;  2L2S A;  4ZPW R;  4Z2H A;  3AS2 A;  2Y78 A;  2LPV A;  5DIT A;  1LQ0 A;  1UR9 A;  4G2P A;  2LGO A;  2B5U B;  2LKN A;  3NI6 A;  2RQS A;  4MAV A;  4ZPT R;  4JFM A;  2AWG A;  2FDM A;  2WLZ A;  5DF0 A;  3IHZ A;  4DT4 A;  4PTM A;  2IF4 A;  2G8Z A;  4DWS A;  4DRQ A;  3QOK A;  4MSP A;  4R5E A;  1W9V A;  4BF8 A;  5HTG A;  2F2D A;  4U86 A;  4NZC A;  1YW5 A;  3JYJ A;  4WJX A;  1J6Y A;  3FAP A;  3O5P A;  3UI4 A;  3WL0 A;  1ROU A;  4ITZ A;  3VAW A;  3CGM A;  3ART A;  1WNO A;  4DRN A;  2OLH A;  3ALG A;  5BXJ A;  4DRM A;  1A7X A;  4J4O A;  2DT3 A;  1FKJ A;  3KAB A;  3KAG A;  3ARR A;  2Q5A A;  1XRV A;  3AS0 A;  4HAR A;  3O5J A;  1JNE A;  2O92 A;  4Z2K A;  1EYM A;  4DZ3 A;  1D6O A;  3UQI A;  5HT1 A;  4NNR A;  5HUA A;  3CZ8 A;  2UZ5 A;  3CGN A;  3TDB A;  4L72 B;  3KZ7 A;  1FKK A;  3O5L A;  3GTY X;  3O5O A;  5HW6 A;  4FAP A;  1H0G A;  4QIB A;  4DRK A;  2XP4 A;  1NWU A;  5GPG A;  2MLX A;  2P4V A;  2G41 A;  3NTP A;  4UDM A;  1PBK A;  3IK8 A;  3WKZ A;  3KAD A;  3ARS A;  2ESC A;  3IKD A;  2A3E A;  4Z2G A;  1FAP A;  4IT6 A;  2XP9 A;  5DEZ A;  4IQC A;  4WKF A;  1EDQ A;  1WB0 A;  4WIW A;  2PPN A;  3ARP A;  3ARQ A;  1LJY A;  2O9O A;  4ZS6 A;  2KR7 A;  4QZV B;  4Q7N A;  2RSE A;  4L3N A;  2KE0 A;  3RME A;  3EY6 A;  1B6C A;  3WQW A;  3BMB A;  3CHC A;  1D7H A;  1NWT A;  3KAF A;  1FKB A;  5HWC A;  2RUD A;  5HBF A;  4DWS B;  2ZR6 A;  1SR0 A;  3UQB A;  1KFW A;  3PA7 A;  1VF8 A;  4MTV A;  4DIP A;  3GU0 A;  4C02 B;  1TCO C;  2KI3 A;  1FKS A;  1GPF A;  3O5Q A;  4TX0 A;  1E6P A;  2WM0 A;  2XPB A;  4DWS D;  3AS3 A;  4IPX A;  5DIV A;  2ETN A;  2MLY A;  4GIV A;  4J4N A;  3B9E A;  3ARY A;  2ZQV A;  4XAK A;  1C9H A;  1KT1 A;  3UI6 A;  1L1P A;  1HJX A;  1NWR A;  1U79 A;  1NMW A;  4FN2 A;  1ZBV A;  2ZR5 A;  4MNM A;  1E44 A;  4WKH A;  5JH8 A;  1ZK6 A;  2WK2 A;  2DG3 A;  3ALF A;  2OFN A;  2RUR A;  4LGX A;  1R9H A;  2EUL A;  4TYO A;  2MLZ A;  2RUQ A;  5HW8 A;  3WQV A;  3IKG A;  1PIN A;  4ODR A;  5DO2 A;  1KT0 A;  1CTN A;  2VN1 A;  2ITK A;  3KAI A;  4QT2 A;  3GPK A;  1HKJ A;  3KCE A;  1ITX A;  1BKF A;  3RM4 A;  1E6R A;  3UI5 A;  1T11 A;  1D7J A;  2DT1 A;  3PRD A;  4LAX A;  1W9P A;  1J4I A;  3G6L A;  3WD4 A;  3O5G A;  3UF8 A;  3CHF A;  1GUV A;  4ODM A;  1J4R A;  4LAW A;  2M2A A;  3PRA A;  4HBE A;  4DRH A;  1ZBW A;  4KR0 B;  3CHD A;  1FD9 A;  3JXV A;  1SYT A;  1FFQ A;  2N87 A;  3G6M A;  2PV3 A;  4N19 A;  5J6E A;  1J4H A;  4W9P A;  3NRK A;  3ARV A;  1HKI A;  1HKM A;  1NH6 A;  1E6N A;  1LG1 A;  4DWS C;  1E6Z A;  1XHG A;  5DIU A;  3W4R A;  2DG4 A;  2DSV A;  4JFI A;  2A3B A;  3H9R B;  3RFW A;  1F40 A;  2F4E A;  1JNT A;  1EQ3 A;  2M08 A;  1QZ2 A;  4Z2I A;  3O5I A;  3PRB A;  3WD3 A;  4ODN A;  1FJD A;  2XP8 A;  4URI A;  3ARZ A;  1Q6U A;  1N1A A;  3I6C A;  4U84 A;  4JFL A;  2DT0 A;  4HBO A;  3RGC A;  3RM9 A;  4ODP A;  2B31 A;  4WK9 A;  3FY1 A;  4S3J A;  4NSB A;  1LL4 A;  1Q6H A;  4WKA A;  1H0I A;  3LUO A;  1P5Q A;  1HJW A;  2KFW A;  3O5F A;  4TW6 A;  5GPR A;  2VCD A;  2M1I A;  2MNT A;  3O5E A;  2XP7 A;  4GGQ A;  4DRO A;  1JVW A;  5HKG A;  2LJ4 A;  1FKH A;  1W1V A;  1K9T A;  2PPO A;  3WD2 A;  3OA5 A;  1FFR A;  4MGV A;  2YBU A;  1FKF A;  2JZV A;  1QPL A;  1ROT A;  2YBT A;  1W1P A;  4MPK A;  3UQA A;  4ODO A;  4Z2J A;  1Q1C A;  2FKE A;  3BXW A;  1M5Y A;  2ZQT A;  3ARX A;  2F21 A;  1OGB A;  1W1Y A;  2DSZ A;  2D9F A;  3ARU A;  4TW8 A;  1ZBK A;  3FXY A;  1HXV A;  4P8W A;  1W9U A;  1FKR A;  4ML4 A;  3RM8 A;  2DPE A;  4DZ2 A;  4P8U A;  3AS1 A;  1QPF A;  4LAV A;  4ZPV R;  3B7X A;  4Q22 A;  2PV2 A;  1YAT A;  4LAY A;  1EIB A;  1GRJ A;  3ARO A;  3EIP A;  1LG2 A;  1D7I A;  2ZQU A;  3AQU A;  3ODK A;  4JFK A;  2XP6 A;  4ODL A;  4TW7 A;  2RUC A;  3JYM A;  1FKG A;  1W1T A;  3CHE A;  2DG9 A;  3ARW A;  3KAH A;  5HW7 A;  2IUZ A;  2KGJ A;  1Y0O A;  2DSU A;  4JFJ A;  4MNJ A;  1HJV A;  4IQ2 A;  4Z2L A;  1JND A;  1RD6 A;  4U85 A;  2PI6 A;  1E9L A;  4DH0 A;  4ODK A;  2A3A A;  5I98 A;  4S3K A;  4P8V A;  2A3C A;  1ZL1 A;  3OOB A;  4DRI A;  1X6N A;  5HWB A;  2QF8 A;  1ZB5 A; 
#chains in the Genus database with same CATH homology
 1FKT A;  3B9A A;  4JYS A;  3WIJ A;  3O5K A;  4KQZ A;  4MNL A;  2XP5 A;  2PV1 A;  3O5M A;  4W9Q A;  3MDY B;  1X6L A;  1NWS A;  3WL1 A;  1WAW A;  2AOS A;  4P8X A;  4W5U A;  2XPA A;  3PR9 A;  1D2K A;  1JNS A;  1FKD A;  1LL7 A;  1ZCN A;  1TFV A;  3B8S A;  2WLY A;  2KO7 A;  1NSG A;  2DT2 A;  1FKI A;  4TNS A;  1UR8 A;  3B9D A;  4QT3 A;  4DRP A;  1E15 A;  2XP3 A;  3O5D A;  3WD1 A;  3TCZ A;  5GQB A;  3WD0 A;  1ZBC A;  2MF9 A;  3KAC A;  3TC5 A;  1W26 A;  2ZR4 A;  1F8A B;  1EHN A;  2DSW A;  4G50 A;  4W9O A;  3WH0 A;  2MPH A;  1BL4 A;  2K8I A;  2PPP A;  4ODQ A;  5D75 A;  1Q6I A;  1HKK A;  1GOI A;  3O5R A;  1OWQ A;  4MNK A;  2FAP A;  4DRJ A;  1IX5 A;  1LL6 A;  4R0X A;  1O6I A;  1OGG A;  2PBC A;  1ZU8 A;  4IT4 A;  5B8I C;  1FKL A;  3CH9 A;  4O2T A;  2ZQS A;  4AY1 A;  1NMV A;  2L2S A;  4ZPW R;  4Z2H A;  3AS2 A;  2Y78 A;  2LPV A;  5DIT A;  1LQ0 A;  1UR9 A;  4G2P A;  2LGO A;  2LKN A;  3NI6 A;  2RQS A;  4MAV A;  4ZPT R;  4JFM A;  2AWG A;  2FDM A;  2WLZ A;  5DF0 A;  3IHZ A;  4DT4 A;  4PTM A;  2IF4 A;  2G8Z A;  4DWS A;  4DRQ A;  3QOK A;  4MSP A;  4R5E A;  1W9V A;  4BF8 A;  5HTG A;  2F2D A;  4U86 A;  4NZC A;  1YW5 A;  3JYJ A;  4WJX A;  1J6Y A;  3FAP A;  3O5P A;  3UI4 A;  3WL0 A;  1ROU A;  4ITZ A;  3VAW A;  3CGM A;  3ART A;  1WNO A;  4DRN A;  2OLH A;  3ALG A;  5BXJ A;  4DRM A;  1A7X A;  4J4O A;  2DT3 A;  1FKJ A;  3KAB A;  3KAG A;  3ARR A;  2Q5A A;  1XRV A;  3AS0 A;  4HAR A;  3O5J A;  1JNE A;  2O92 A;  4Z2K A;  1EYM A;  4DZ3 A;  1D6O A;  3UQI A;  5HT1 A;  4NNR A;  5HUA A;  3CZ8 A;  2UZ5 A;  3CGN A;  3TDB A;  4L72 B;  3KZ7 A;  1FKK A;  3O5L A;  3O5O A;  5HW6 A;  4FAP A;  1H0G A;  4QIB A;  4DRK A;  2XP4 A;  1NWU A;  5GPG A;  2MLX A;  2G41 A;  3NTP A;  1PBK A;  3IK8 A;  3WKZ A;  3KAD A;  3ARS A;  2ESC A;  3IKD A;  2A3E A;  4Z2G A;  1FAP A;  4IT6 A;  2XP9 A;  5DEZ A;  4IQC A;  4WKF A;  1EDQ A;  1WB0 A;  4WIW A;  2PPN A;  3ARP A;  3ARQ A;  1LJY A;  2O9O A;  4ZS6 A;  2KR7 A;  4QZV B;  4Q7N A;  2RSE A;  4L3N A;  2KE0 A;  3RME A;  3EY6 A;  1B6C A;  3WQW A;  3CHC A;  1D7H A;  1NWT A;  3KAF A;  1FKB A;  5HWC A;  2RUD A;  5HBF A;  4DWS B;  2ZR6 A;  1SR0 A;  3UQB A;  1KFW A;  3PA7 A;  1VF8 A;  4MTV A;  4DIP A;  4C02 B;  1TCO C;  2KI3 A;  1FKS A;  1GPF A;  3O5Q A;  4TX0 A;  1E6P A;  2WM0 A;  2XPB A;  4DWS D;  3AS3 A;  4IPX A;  5DIV A;  2MLY A;  4GIV A;  4J4N A;  3B9E A;  3ARY A;  2ZQV A;  4XAK A;  1C9H A;  1KT1 A;  3UI6 A;  1L1P A;  1HJX A;  1NWR A;  1U79 A;  1NMW A;  4FN2 A;  1ZBV A;  2ZR5 A;  4MNM A;  4WKH A;  5JH8 A;  1ZK6 A;  2WK2 A;  2DG3 A;  3ALF A;  2OFN A;  2RUR A;  4LGX A;  1R9H A;  4TYO A;  2MLZ A;  2RUQ A;  5HW8 A;  3WQV A;  3IKG A;  1PIN A;  4ODR A;  5DO2 A;  1KT0 A;  1CTN A;  2VN1 A;  2ITK A;  3KAI A;  4QT2 A;  3GPK A;  1HKJ A;  3KCE A;  1ITX A;  1BKF A;  3RM4 A;  1E6R A;  3UI5 A;  1T11 A;  1D7J A;  2DT1 A;  3PRD A;  4LAX A;  1W9P A;  1J4I A;  3G6L A;  3WD4 A;  3O5G A;  3UF8 A;  3CHF A;  1GUV A;  4ODM A;  1J4R A;  4LAW A;  2M2A A;  3PRA A;  4HBE A;  4DRH A;  1ZBW A;  4KR0 B;  3CHD A;  1FD9 A;  3JXV A;  1SYT A;  1FFQ A;  2N87 A;  3G6M A;  2PV3 A;  4N19 A;  5J6E A;  1J4H A;  4W9P A;  3NRK A;  3ARV A;  1HKI A;  1HKM A;  1NH6 A;  1E6N A;  1LG1 A;  4DWS C;  1E6Z A;  1XHG A;  5DIU A;  3W4R A;  2DG4 A;  2DSV A;  4JFI A;  2A3B A;  3H9R B;  3RFW A;  1F40 A;  2F4E A;  1JNT A;  1EQ3 A;  2M08 A;  1QZ2 A;  4Z2I A;  3O5I A;  3PRB A;  3WD3 A;  4ODN A;  1FJD A;  2XP8 A;  4URI A;  3ARZ A;  1Q6U A;  1N1A A;  3I6C A;  4U84 A;  4JFL A;  2DT0 A;  4HBO A;  3RGC A;  3RM9 A;  4ODP A;  2B31 A;  4WK9 A;  3FY1 A;  4S3J A;  4NSB A;  1LL4 A;  1Q6H A;  4WKA A;  1H0I A;  3LUO A;  1P5Q A;  1HJW A;  2KFW A;  3O5F A;  4TW6 A;  5GPR A;  2VCD A;  2M1I A;  2MNT A;  3O5E A;  2XP7 A;  4GGQ A;  4DRO A;  1JVW A;  5HKG A;  2LJ4 A;  1FKH A;  1W1V A;  1K9T A;  2PPO A;  3WD2 A;  3OA5 A;  1FFR A;  4MGV A;  2YBU A;  1FKF A;  2JZV A;  1QPL A;  1ROT A;  2YBT A;  1W1P A;  4MPK A;  3UQA A;  4ODO A;  4Z2J A;  1Q1C A;  2FKE A;  3BXW A;  1M5Y A;  2ZQT A;  3ARX A;  2F21 A;  1OGB A;  1W1Y A;  2DSZ A;  2D9F A;  3ARU A;  4TW8 A;  1ZBK A;  3FXY A;  1HXV A;  4P8W A;  1W9U A;  1FKR A;  4ML4 A;  3RM8 A;  2DPE A;  4DZ2 A;  4P8U A;  3AS1 A;  1QPF A;  4LAV A;  4ZPV R;  3B7X A;  4Q22 A;  2PV2 A;  1YAT A;  4LAY A;  1EIB A;  3ARO A;  1LG2 A;  1D7I A;  2ZQU A;  3AQU A;  3ODK A;  4JFK A;  2XP6 A;  4ODL A;  4TW7 A;  2RUC A;  3JYM A;  1FKG A;  1W1T A;  3CHE A;  2DG9 A;  3ARW A;  3KAH A;  5HW7 A;  2IUZ A;  2KGJ A;  1Y0O A;  2DSU A;  4JFJ A;  4MNJ A;  1HJV A;  4IQ2 A;  4Z2L A;  1JND A;  1RD6 A;  4U85 A;  2PI6 A;  1E9L A;  4DH0 A;  4ODK A;  2A3A A;  5I98 A;  4S3K A;  4P8V A;  2A3C A;  1ZL1 A;  3OOB A;  4DRI A;  1X6N A;  5HWB A;  2QF8 A;  1ZB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...