5HTGA

Structure of apo p1 form of candida albicans fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
total genus 27
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5htgA00
2RUCA 4ODLA 5HWBA 1YATA 2VN1A 4ODPA 1FKFA 1A7XA 2KE0A 2RUQA 1J6YA 1FKRA 1NMVA 1ZK6A 2DG3A 1Q1CA 2F2DA 4ODNA 4DRHA 3H9RB 3LUOA 1KT0A 5HTGA 5HUAA 2K8IA 2ITKA 3JYMA 2N87A 2XPAA 1QPLA 1FAPA 2M1IA 4GIVA 3O5PA 1D7HA 2L2SA 4BF8A 3O5KA 2XP9A 2LKNA 4ITZA 5BXJA 1FKGA 2XP7A 2M2AA 2MNTA 2JZVA 1D7IA 2RQSA 3O5IA 1ZCNA 1Y0OA 3KABA 3O5FA 4NNRA 3KAFA 5J6EA 1FKHA 2RSEA 3IK8A 4LAYA 3UQIA 5D75A 4TNSA 2ZR6A 4FN2A 3UI6A 1QPFA 1T11A 2KR7A 2XPBA 5HT1A 3JYJA 1FKBA 2DG9A 2VCDA 3O5JA 2XP6A 3FAPA 3VAWA 1NMWA 4DIPA 2MLXA 4ODQA 4TW6A 2OFNA 4J4NA 2XP4A 2ZQTA 4DRMA 3KAHA 1BKFA 5DIVA 2PPNA 4DROA 4DRQA 1M5YA 3UF8A 2M08A 3WH0A 3OOBA 4JFIA 4ODMA 1ROTA 2ZQUA 4TW8A 4JFJA 2PPOA 2ZR4A 2KI3A 3I6CA 3UQBA 1QZ2A 3KAGA 4IPXA 2IF4A 4TX0A 3NI6A 3KZ7A 2KFWA 4DZ2A 1F40A 2ZQSA 1JNSA 3B7XA 4DRIA 3TCZA 2F21A 1KT1A 2RUDA 1L1PA 1NSGA 3JXVA 3UI4A 4DRKA 3PRDA 4W9OA 3NRKA 1R9HA 4QIBA 5GPGA 2AWGA 3O5DA 1EQ3A 1B6CA 4DRNA 4LAVA 4JFLA 1J4HA 4MSPA 4J4OA 1BL4A 4U85A 4N19A 2XP5A 1YW5A 3KADA 3KCEA 4DRJA 2PV1A 4LAXA 1W26A 1PBKA 3MDYB 1FKLA 1U79A 2FKEA 2FAPA 3O5RA 1FKSA 3EY6A 1D7JA 4R0XA 4U84A 5HW8A 5HWCA 1FKIA 2PBCA 1J4IA 5DITA 4W9PA 3O5EA 2PPPA 4U86A 1PINA 4GGQA 3TC5A 5HKGA 2RURA 1JVWA 1J4RA 3O5OA 4O2TA 3KAIA 3KACA 4DH0A 4LAWA 1TCOC 1C9HA 1P5QA 2F4EA 3GPKA 3PRBA 4IQ2A 1N1AA 3ODKA 4ODKA 1FKTA 5HW7A 1ROUA 1F8AB 3O5QA 4JYSA 4G2PA 2ZQVA 4ODOA 3CGNA 2D9FA 1FKDA 2UZ5A 5I98A 3RFWA 2MLZA 3O5GA 2KGJA 2LGOA 1Q6IA 4MGVA 4DRPA 3UQAA 4TW7A 4FAPA 4W9QA 3UI5A 4DT4A 1JNTA 4ODRA 1FKKA 4IQCA 3O5MA 2KO7A 3IKDA 3O5LA 2MF9A 4G50A 2Y78A 3TDBA 2LJ4A 3PA7A 4DZ3A 2MLYA 1Q6UA 2XP3A 4TYOA 1HXVA 2DG4A 2Q5AA 4JFMA 4C02B 1FKJA 4JFKA 4QT3A 4QT2A 2ZR5A 3IKGA 2XP8A 3RGCA 2LPVA 1Q6HA 2PV2A 1EYMA 3NTPA 3IHZA 1FJDA 1FD9A 2PV3A 2MPHA 3CGMA 5B8IC 5HW6A 1D6OA 5DIUA
chains in the Genus database with same CATH superfamily
1UR8A 1YATA 1HKMA 2ESCA 1Q1CA 5HUAA 5HTGA 1KT0A 3B8SA 3WD2A 1X6LA 2N87A 2B31A 3CHCA 1LG1A 3AROA 2L2SA 4BF8A 5BXJA 2LKNA 4LGXA 1NWRA 2MNTA 2RQSA 3O5IA 1ZCNA 3KABA 4MAVA 2RSEA 3IK8A 4LAYA 3UQIA 4FN2A 1QPFA 2DG9A 3FAPA 4Z2HA 2QF8A 4TW6A 1LL6A 1ZB5A 2XP4A 4DRMA 2DSUA 2PPNA 3WD3A 1M5YA 4ZPWR 4HARA 1KFWA 3ARXA 2ZQUA 3I6CA 5DF0A 3ARYA 4Z2LA 3RMEA 2WLZA 3BXWA 4HBOA 2F21A 2WLYA 1L1PA 1UR9A 3PRDA 4W9OA 1B6CA 3B9AA 4MTVA 3KADA 1ZBKA 4P8UA 4Z2GA 1U79A 2FKEA 2FAPA 1W1PA 1CTNA 4MNJA 4WKAA 2IUZA 1EHNA 1SR0A 1ZBWA 3O5EA 1E6ZA 3FXYA 4U86A 3TC5A 5HKGA 1JVWA 3KAIA 3GPKA 4ODKA 3RM9A 4ODOA 4JYSA 2G8ZA 3CHDA 4MNLA 1FKDA 1Q6IA 3UQAA 4DWSA 3CHEA 1JNTA 1RD6A 1FKKA 1EDQA 2MF9A 2MLYA 2XP3A 2Q5AA 2DT0A 4JFMA 2DPEA 1ZBCA 4JFKA 3ARWA 1EYMA 1FFQA 5GPRA 2MPHA 1JNSA 4JFIA 5HWBA 1FKFA 3WD4A 1A7XA 2KE0A 1J6YA 4IT4A 4ZPTR 1FKRA 4DRHA 4ODNA 3H9RB 2XPAA 1QPLA 3GTYX 2XP7A 1E44A 4Z2IA 1NH6A 3RM8A 5D75A 4MNKA 1FKBA 4ZPVR 3VAWA 1W9UA 2ZQTA 1NWSA 2DT3A 4W5UA 2M08A 3WH0A 1HJXA 1HKJA 4ODMA 3RM4A 4JFJA 2OLHA 2PPOA 2KI3A 3EIPA 3AS0A 3OA5A 4NZCA 3NI6A 1F40A 3AQUA 4S3KA 1KT1A 3JXVA 3UI4A 2EULA 4DRKA 1R9HA 4QIBA 4U85A 1J4HA 1NWUA 1YW5A 1WAWA 4WKFA 3MDYB 3BMBA 5GQBA 3O5RA 3WL1A 3EY6A 1D7JA 5HW8A 4U84A 5HWCA 1OGBA 3WD1A 2WM0A 4WJXA 3ARRA 3ALFA 1VF8A 1J4RA 4O2TA 4DH0A 3ALGA 1C9HA 3PRBA 4IQ2A 4IT6A 3O5QA 2YBTA 5I98A 2UZ5A 4DRPA 4IQCA 3O5MA 3O5LA 4G50A 2Y78A 4DZ3A 4HBEA 1GRJA 3WQVA 4L3NA 4MNMA 2DG4A 1HKKA 4QT3A 3RGCA 3IKGA 2XP8A 3NTPA 1FJDA 1GOIA 4PTMA 1D6OA 4ODQA 5HW6A 4ODLA 2VN1A 3CH9A 5HBFA 2RUQA 3QOKA 3AS2A 1ZK6A 1JNDA 4KQZA 1WB0A 2ITKA 3JYMA 2DSVA 1D7HA 1HJWA 2O92A 3O5PA 5JH8A 3AS3A 2M2AA 2JZVA 3FY1A 1Y0OA 3O5FA 3KAFA 5J6EA 4AY1A 1W9VA 2ZR6A 3UI6A 1T11A 5HT1A 1K9TA 2VCDA 3O5JA 1NMWA 3ARTA 4L72B 2OFNA 4J4NA 1GPFA 5DEZA 3GU0A 1E6RA 1HJVA 3KAHA 4DROA 4DRQA 1LQ0A 1WNOA 4KR0B 3B9EA 5DO2A 3OOBA 4TW8A 4ZS6A 2DT1A 3KAGA 2IF4A 3KZ7A 2WK2A 4QZVB 3ARPA 3B7XA 4DRIA 4DWSB 1LL7A 4Q7NA 4DWSD 2AWGA 3O5DA 1EQ3A 1NWTA 4LAVA 1OGGA 1BL4A 4N19A 2A3BA 4DRJA 1W26A 1ZU8A 2A3EA 1PBKA 4NSBA 2DSZA 1FKSA 2ETNA 1FFRA 2FDMA 4R0XA 2PI6A 2A3CA 3W4RA 5DITA 4W9PA 1PINA 3O5OA 3KACA 4LAWA 1TCOC 1P5QA 1SYTA 2F4EA 2DSWA 1N1AA 5HW7A 1F8AB 1ROUA 2ZQVA 2YBUA 2G41A 3CGNA 2D9FA 3ARQA 2MLZA 3O5GA 2LGOA 4MGVA 4WIWA 4FAPA 4W9QA 1ITXA 2PN0A 4ODRA 1ZBVA 3IKDA 3PA7A 1LL4A 1E6PA 4C02B 1E15A 3G6MA 2ZR5A 1Q6HA 1OWQA 1FD9A 2PV3A 4S3JA 5B8IC 2RUCA 3ARSA 4ODPA 2O9OA 1NMVA 2DG3A 2F2DA 3LUOA 4WKHA 2K8IA 2M1IA 1FAPA 4GIVA 2B5UB 3CHFA 4P8XA 3O5KA 2XP9A 4ITZA 4R5EA 1FKGA 1D7IA 2P4VA 2F23A 4NNRA 1FKHA 4XAKA 4Z2JA 4TNSA 1W1VA 4UDMA 3PRAA 2XPBA 2KR7A 4ML4A 3JYJA 4URIA 1IX5A 2XP6A 4DIPA 2MLXA 1ZL1A 1TFVA 1BKFA 3ARUA 5DIVA 4WK9A 3UF8A 4MPKA 1ROTA 2ZR4A 4Z2KA 3UQBA 1W1TA 4DWSC 1QZ2A 4IPXA 1W1YA 4TX0A 3WD0A 4DZ2A 2KFWA 2ZQSA 3PR9A 3WKZA 3TCZA 2RUDA 1NSGA 1EIBA 1XHGA 1X6NA 3NRKA 5GPGA 3ARVA 1JCHB 2A3AA 4DRNA 3WIJA 4JFLA 3ARZA 4J4OA 4MSPA 2XP5A 3KCEA 4P8VA 2PV1A 4LAXA 1FKLA 1LJYA 2DT2A 1HKIA 1XRVA 1FKIA 2PBCA 2AOSA 1J4IA 1JNEA 3AS1A 2PPPA 3WQWA 4GGQA 2RURA 1LG2A 4P8WA 1O6IA 3ODKA 1E9LA 1FKTA 3WL0A 4G2PA 3RFWA 1H0IA 2KGJA 3CZ8A 4TW7A 3B9DA 3UI5A 4DT4A 1H0GA 2KO7A 3TDBA 2LJ4A 1Q6UA 1D2KA 4TYOA 1HXVA 1E6NA 1GUVA 1W9PA 1FKJA 4QT2A 2LPVA 2PV2A 4Q22A 3G6LA 3IHZA 3CGMA 5DIUA
chains in the Genus database with same CATH topology
1UR8A 1YATA 1HKMA 2ESCA 1Q1CA 5HUAA 5HTGA 1KT0A 3B8SA 3WD2A 1X6LA 2N87A 2B31A 3CHCA 1LG1A 3AROA 2L2SA 4BF8A 5BXJA 2LKNA 4LGXA 1NWRA 2MNTA 2RQSA 3O5IA 1ZCNA 3KABA 4MAVA 2RSEA 3IK8A 4LAYA 3UQIA 4FN2A 1QPFA 2DG9A 3FAPA 4Z2HA 2QF8A 4TW6A 1LL6A 1ZB5A 2XP4A 4DRMA 2DSUA 2PPNA 3WD3A 1M5YA 4ZPWR 4HARA 1KFWA 3ARXA 2ZQUA 3I6CA 5DF0A 3ARYA 4Z2LA 3RMEA 2WLZA 3BXWA 4HBOA 2F21A 2WLYA 1L1PA 1UR9A 3PRDA 4W9OA 1B6CA 3B9AA 4MTVA 3KADA 1ZBKA 4P8UA 4Z2GA 1U79A 2FKEA 2FAPA 1W1PA 1CTNA 4MNJA 4WKAA 2IUZA 1EHNA 1SR0A 1ZBWA 3O5EA 1E6ZA 3FXYA 4U86A 3TC5A 5HKGA 1JVWA 3KAIA 3GPKA 4ODKA 3RM9A 4ODOA 4JYSA 2G8ZA 3CHDA 4MNLA 1FKDA 1Q6IA 3UQAA 4DWSA 3CHEA 1JNTA 1RD6A 1FKKA 1EDQA 2MF9A 2MLYA 2XP3A 2Q5AA 2DT0A 4JFMA 2DPEA 1ZBCA 4JFKA 3ARWA 1EYMA 1FFQA 5GPRA 2MPHA 1JNSA 4JFIA 5HWBA 1FKFA 3WD4A 1A7XA 2KE0A 1J6YA 4IT4A 4ZPTR 1FKRA 4DRHA 4ODNA 3H9RB 2XPAA 1QPLA 2XP7A 4Z2IA 1NH6A 3RM8A 5D75A 4MNKA 1FKBA 4ZPVR 3VAWA 1W9UA 2ZQTA 1NWSA 2DT3A 4W5UA 2M08A 3WH0A 1HJXA 1HKJA 4ODMA 3RM4A 4JFJA 2OLHA 2PPOA 2KI3A 3AS0A 3OA5A 4NZCA 3NI6A 1F40A 3AQUA 4S3KA 1KT1A 3JXVA 3UI4A 4DRKA 1R9HA 4QIBA 4U85A 1J4HA 1NWUA 1YW5A 1WAWA 4WKFA 3MDYB 5GQBA 3O5RA 3WL1A 3EY6A 1D7JA 5HW8A 4U84A 5HWCA 1OGBA 3WD1A 2WM0A 4WJXA 3ARRA 3ALFA 1VF8A 1J4RA 4O2TA 4DH0A 3ALGA 1C9HA 3PRBA 4IQ2A 4IT6A 3O5QA 2YBTA 5I98A 2UZ5A 4DRPA 4IQCA 3O5MA 3O5LA 4G50A 2Y78A 4DZ3A 4HBEA 3WQVA 4L3NA 4MNMA 2DG4A 1HKKA 4QT3A 3RGCA 3IKGA 2XP8A 3NTPA 1FJDA 1GOIA 4PTMA 1D6OA 4ODQA 5HW6A 4ODLA 2VN1A 3CH9A 5HBFA 2RUQA 3QOKA 3AS2A 1ZK6A 1JNDA 4KQZA 1WB0A 2ITKA 3JYMA 2DSVA 1D7HA 1HJWA 2O92A 3O5PA 5JH8A 3AS3A 2M2AA 2JZVA 3FY1A 1Y0OA 3O5FA 3KAFA 5J6EA 4AY1A 1W9VA 2ZR6A 3UI6A 1T11A 5HT1A 1K9TA 2VCDA 3O5JA 1NMWA 3ARTA 4L72B 2OFNA 4J4NA 1GPFA 5DEZA 1E6RA 1HJVA 3KAHA 4DROA 4DRQA 1LQ0A 1WNOA 4KR0B 3B9EA 5DO2A 3OOBA 4TW8A 4ZS6A 2DT1A 3KAGA 2IF4A 3KZ7A 2WK2A 4QZVB 3ARPA 3B7XA 4DRIA 4DWSB 1LL7A 4Q7NA 4DWSD 2AWGA 3O5DA 1EQ3A 1NWTA 4LAVA 1OGGA 1BL4A 4N19A 2A3BA 4DRJA 1W26A 1ZU8A 2A3EA 1PBKA 4NSBA 2DSZA 1FKSA 1FFRA 2FDMA 4R0XA 2PI6A 2A3CA 3W4RA 5DITA 4W9PA 1PINA 3O5OA 3KACA 4LAWA 1TCOC 1P5QA 1SYTA 2F4EA 2DSWA 1N1AA 5HW7A 1F8AB 1ROUA 2ZQVA 2YBUA 2G41A 3CGNA 2D9FA 3ARQA 2MLZA 3O5GA 2LGOA 4MGVA 4WIWA 4FAPA 4W9QA 1ITXA 4ODRA 1ZBVA 3IKDA 3PA7A 1LL4A 1E6PA 4C02B 1E15A 3G6MA 2ZR5A 1Q6HA 1OWQA 1FD9A 2PV3A 4S3JA 5B8IC 2RUCA 3ARSA 4ODPA 2O9OA 1NMVA 2DG3A 2F2DA 3LUOA 4WKHA 2K8IA 2M1IA 1FAPA 4GIVA 3CHFA 4P8XA 3O5KA 2XP9A 4ITZA 4R5EA 1FKGA 1D7IA 4NNRA 1FKHA 4XAKA 4Z2JA 4TNSA 1W1VA 3PRAA 2XPBA 2KR7A 4ML4A 3JYJA 4URIA 1IX5A 2XP6A 4DIPA 2MLXA 1ZL1A 1TFVA 1BKFA 3ARUA 5DIVA 4WK9A 3UF8A 4MPKA 1ROTA 2ZR4A 4Z2KA 3UQBA 1W1TA 4DWSC 1QZ2A 4IPXA 1W1YA 4TX0A 3WD0A 4DZ2A 2KFWA 2ZQSA 3PR9A 3WKZA 3TCZA 2RUDA 1NSGA 1EIBA 1XHGA 1X6NA 3NRKA 5GPGA 3ARVA 2A3AA 4DRNA 3WIJA 4JFLA 3ARZA 4J4OA 4MSPA 2XP5A 3KCEA 4P8VA 2PV1A 4LAXA 1FKLA 1LJYA 2DT2A 1HKIA 1XRVA 1FKIA 2PBCA 2AOSA 1J4IA 1JNEA 3AS1A 2PPPA 3WQWA 4GGQA 2RURA 1LG2A 4P8WA 1O6IA 3ODKA 1E9LA 1FKTA 3WL0A 4G2PA 3RFWA 1H0IA 2KGJA 3CZ8A 4TW7A 3B9DA 3UI5A 4DT4A 1H0GA 2KO7A 3TDBA 2LJ4A 1Q6UA 1D2KA 4TYOA 1HXVA 1E6NA 1GUVA 1W9PA 1FKJA 4QT2A 2LPVA 2PV2A 4Q22A 3G6LA 3IHZA 3CGMA 5DIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUC A;  4ODL A;  5HWB A;  1YAT A;  2VN1 A;  4ODP A;  1FKF A;  1A7X A;  2KE0 A;  2RUQ A;  1J6Y A;  1FKR A;  1NMV A;  1ZK6 A;  2DG3 A;  1Q1C A;  2F2D A;  4ODN A;  4DRH A;  3H9R B;  3LUO A;  1KT0 A;  5HTG A;  5HUA A;  2K8I A;  2ITK A;  3JYM A;  2N87 A;  2XPA A;  1QPL A;  1FAP A;  2M1I A;  4GIV A;  3O5P A;  1D7H A;  2L2S A;  4BF8 A;  3O5K A;  2XP9 A;  2LKN A;  4ITZ A;  5BXJ A;  1FKG A;  2XP7 A;  2M2A A;  2MNT A;  2JZV A;  1D7I A;  2RQS A;  3O5I A;  1ZCN A;  1Y0O A;  3KAB A;  3O5F A;  4NNR A;  3KAF A;  5J6E A;  1FKH A;  2RSE A;  3IK8 A;  4LAY A;  3UQI A;  5D75 A;  4TNS A;  2ZR6 A;  4FN2 A;  3UI6 A;  1QPF A;  1T11 A;  2KR7 A;  2XPB A;  5HT1 A;  3JYJ A;  1FKB A;  2DG9 A;  2VCD A;  3O5J A;  2XP6 A;  3FAP A;  3VAW A;  1NMW A;  4DIP A;  2MLX A;  4ODQ A;  4TW6 A;  2OFN A;  4J4N A;  2XP4 A;  2ZQT A;  4DRM A;  3KAH A;  1BKF A;  5DIV A;  2PPN A;  4DRO A;  4DRQ A;  1M5Y A;  3UF8 A;  2M08 A;  3WH0 A;  3OOB A;  4JFI A;  4ODM A;  1ROT A;  2ZQU A;  4TW8 A;  4JFJ A;  2PPO A;  2ZR4 A;  2KI3 A;  3I6C A;  3UQB A;  1QZ2 A;  3KAG A;  4IPX A;  2IF4 A;  4TX0 A;  3NI6 A;  3KZ7 A;  2KFW A;  4DZ2 A;  1F40 A;  2ZQS A;  1JNS A;  3B7X A;  4DRI A;  3TCZ A;  2F21 A;  1KT1 A;  2RUD A;  1L1P A;  1NSG A;  3JXV A;  3UI4 A;  4DRK A;  3PRD A;  4W9O A;  3NRK A;  1R9H A;  4QIB A;  5GPG A;  2AWG A;  3O5D A;  1EQ3 A;  1B6C A;  4DRN A;  4LAV A;  4JFL A;  1J4H A;  4MSP A;  4J4O A;  1BL4 A;  4U85 A;  4N19 A;  2XP5 A;  1YW5 A;  3KAD A;  3KCE A;  4DRJ A;  2PV1 A;  4LAX A;  1W26 A;  1PBK A;  3MDY B;  1FKL A;  1U79 A;  2FKE A;  2FAP A;  3O5R A;  1FKS A;  3EY6 A;  1D7J A;  4R0X A;  4U84 A;  5HW8 A;  5HWC A;  1FKI A;  2PBC A;  1J4I A;  5DIT A;  4W9P A;  3O5E A;  2PPP A;  4U86 A;  1PIN A;  4GGQ A;  3TC5 A;  5HKG A;  2RUR A;  1JVW A;  1J4R A;  3O5O A;  4O2T A;  3KAI A;  3KAC A;  4DH0 A;  4LAW A;  1TCO C;  1C9H A;  1P5Q A;  2F4E A;  3GPK A;  3PRB A;  4IQ2 A;  1N1A A;  3ODK A;  4ODK A;  1FKT A;  5HW7 A;  1ROU A;  1F8A B;  3O5Q A;  4JYS A;  4G2P A;  2ZQV A;  4ODO A;  3CGN A;  2D9F A;  1FKD A;  2UZ5 A;  5I98 A;  3RFW A;  2MLZ A;  3O5G A;  2KGJ A;  2LGO A;  1Q6I A;  4MGV A;  4DRP A;  3UQA A;  4TW7 A;  4FAP A;  4W9Q A;  3UI5 A;  4DT4 A;  1JNT A;  4ODR A;  1FKK A;  4IQC A;  3O5M A;  2KO7 A;  3IKD A;  3O5L A;  2MF9 A;  4G50 A;  2Y78 A;  3TDB A;  2LJ4 A;  3PA7 A;  4DZ3 A;  2MLY A;  1Q6U A;  2XP3 A;  4TYO A;  1HXV A;  2DG4 A;  2Q5A A;  4JFM A;  4C02 B;  1FKJ A;  4JFK A;  4QT3 A;  4QT2 A;  2ZR5 A;  3IKG A;  2XP8 A;  3RGC A;  2LPV A;  1Q6H A;  2PV2 A;  1EYM A;  3NTP A;  3IHZ A;  1FJD A;  1FD9 A;  2PV3 A;  2MPH A;  3CGM A;  5B8I C;  5HW6 A;  1D6O A;  5DIU A; 
#chains in the Genus database with same CATH topology
 1UR8 A;  1YAT A;  1HKM A;  2ESC A;  1Q1C A;  5HUA A;  5HTG A;  1KT0 A;  3B8S A;  3WD2 A;  1X6L A;  2N87 A;  2B31 A;  3CHC A;  1LG1 A;  3ARO A;  2L2S A;  4BF8 A;  5BXJ A;  2LKN A;  4LGX A;  1NWR A;  2MNT A;  2RQS A;  3O5I A;  1ZCN A;  3KAB A;  4MAV A;  2RSE A;  3IK8 A;  4LAY A;  3UQI A;  4FN2 A;  1QPF A;  2DG9 A;  3FAP A;  4Z2H A;  2QF8 A;  4TW6 A;  1LL6 A;  1ZB5 A;  2XP4 A;  4DRM A;  2DSU A;  2PPN A;  3WD3 A;  1M5Y A;  4ZPW R;  4HAR A;  1KFW A;  3ARX A;  2ZQU A;  3I6C A;  5DF0 A;  3ARY A;  4Z2L A;  3RME A;  2WLZ A;  3BXW A;  4HBO A;  2F21 A;  2WLY A;  1L1P A;  1UR9 A;  3PRD A;  4W9O A;  1B6C A;  3B9A A;  4MTV A;  3KAD A;  1ZBK A;  4P8U A;  4Z2G A;  1U79 A;  2FKE A;  2FAP A;  1W1P A;  1CTN A;  4MNJ A;  4WKA A;  2IUZ A;  1EHN A;  1SR0 A;  1ZBW A;  3O5E A;  1E6Z A;  3FXY A;  4U86 A;  3TC5 A;  5HKG A;  1JVW A;  3KAI A;  3GPK A;  4ODK A;  3RM9 A;  4ODO A;  4JYS A;  2G8Z A;  3CHD A;  4MNL A;  1FKD A;  1Q6I A;  3UQA A;  4DWS A;  3CHE A;  1JNT A;  1RD6 A;  1FKK A;  1EDQ A;  2MF9 A;  2MLY A;  2XP3 A;  2Q5A A;  2DT0 A;  4JFM A;  2DPE A;  1ZBC A;  4JFK A;  3ARW A;  1EYM A;  1FFQ A;  5GPR A;  2MPH A;  1JNS A;  4JFI A;  5HWB A;  1FKF A;  3WD4 A;  1A7X A;  2KE0 A;  1J6Y A;  4IT4 A;  4ZPT R;  1FKR A;  4DRH A;  4ODN A;  3H9R B;  2XPA A;  1QPL A;  3GTY X;  2XP7 A;  1E44 A;  4Z2I A;  1NH6 A;  3RM8 A;  5D75 A;  4MNK A;  1FKB A;  4ZPV R;  3VAW A;  1W9U A;  2ZQT A;  1NWS A;  2DT3 A;  4W5U A;  2M08 A;  3WH0 A;  1HJX A;  1HKJ A;  4ODM A;  3RM4 A;  4JFJ A;  2OLH A;  2PPO A;  2KI3 A;  3EIP A;  3AS0 A;  3OA5 A;  4NZC A;  3NI6 A;  1F40 A;  3AQU A;  4S3K A;  1KT1 A;  3JXV A;  3UI4 A;  2EUL A;  4DRK A;  1R9H A;  4QIB A;  4U85 A;  1J4H A;  1NWU A;  1YW5 A;  1WAW A;  4WKF A;  3MDY B;  3BMB A;  5GQB A;  3O5R A;  3WL1 A;  3EY6 A;  1D7J A;  5HW8 A;  4U84 A;  5HWC A;  1OGB A;  3WD1 A;  2WM0 A;  4WJX A;  3ARR A;  3ALF A;  1VF8 A;  1J4R A;  4O2T A;  4DH0 A;  3ALG A;  1C9H A;  3PRB A;  4IQ2 A;  4IT6 A;  3O5Q A;  2YBT A;  5I98 A;  2UZ5 A;  4DRP A;  4IQC A;  3O5M A;  3O5L A;  4G50 A;  2Y78 A;  4DZ3 A;  4HBE A;  1GRJ A;  3WQV A;  4L3N A;  4MNM A;  2DG4 A;  1HKK A;  4QT3 A;  3RGC A;  3IKG A;  2XP8 A;  3NTP A;  1FJD A;  1GOI A;  4PTM A;  1D6O A;  4ODQ A;  5HW6 A;  4ODL A;  2VN1 A;  3CH9 A;  5HBF A;  2RUQ A;  3QOK A;  3AS2 A;  1ZK6 A;  1JND A;  4KQZ A;  1WB0 A;  2ITK A;  3JYM A;  2DSV A;  1D7H A;  1HJW A;  2O92 A;  3O5P A;  5JH8 A;  3AS3 A;  2M2A A;  2JZV A;  3FY1 A;  1Y0O A;  3O5F A;  3KAF A;  5J6E A;  4AY1 A;  1W9V A;  2ZR6 A;  3UI6 A;  1T11 A;  5HT1 A;  1K9T A;  2VCD A;  3O5J A;  1NMW A;  3ART A;  4L72 B;  2OFN A;  4J4N A;  1GPF A;  5DEZ A;  3GU0 A;  1E6R A;  1HJV A;  3KAH A;  4DRO A;  4DRQ A;  1LQ0 A;  1WNO A;  4KR0 B;  3B9E A;  5DO2 A;  3OOB A;  4TW8 A;  4ZS6 A;  2DT1 A;  3KAG A;  2IF4 A;  3KZ7 A;  2WK2 A;  4QZV B;  3ARP A;  3B7X A;  4DRI A;  4DWS B;  1LL7 A;  4Q7N A;  4DWS D;  2AWG A;  3O5D A;  1EQ3 A;  1NWT A;  4LAV A;  1OGG A;  1BL4 A;  4N19 A;  2A3B A;  4DRJ A;  1W26 A;  1ZU8 A;  2A3E A;  1PBK A;  4NSB A;  2DSZ A;  1FKS A;  2ETN A;  1FFR A;  2FDM A;  4R0X A;  2PI6 A;  2A3C A;  3W4R A;  5DIT A;  4W9P A;  1PIN A;  3O5O A;  3KAC A;  4LAW A;  1TCO C;  1P5Q A;  1SYT A;  2F4E A;  2DSW A;  1N1A A;  5HW7 A;  1F8A B;  1ROU A;  2ZQV A;  2YBU A;  2G41 A;  3CGN A;  2D9F A;  3ARQ A;  2MLZ A;  3O5G A;  2LGO A;  4MGV A;  4WIW A;  4FAP A;  4W9Q A;  1ITX A;  2PN0 A;  4ODR A;  1ZBV A;  3IKD A;  3PA7 A;  1LL4 A;  1E6P A;  4C02 B;  1E15 A;  3G6M A;  2ZR5 A;  1Q6H A;  1OWQ A;  1FD9 A;  2PV3 A;  4S3J A;  5B8I C;  2RUC A;  3ARS A;  4ODP A;  2O9O A;  1NMV A;  2DG3 A;  2F2D A;  3LUO A;  4WKH A;  2K8I A;  2M1I A;  1FAP A;  4GIV A;  2B5U B;  3CHF A;  4P8X A;  3O5K A;  2XP9 A;  4ITZ A;  4R5E A;  1FKG A;  1D7I A;  2P4V A;  2F23 A;  4NNR A;  1FKH A;  4XAK A;  4Z2J A;  4TNS A;  1W1V A;  4UDM A;  3PRA A;  2XPB A;  2KR7 A;  4ML4 A;  3JYJ A;  4URI A;  1IX5 A;  2XP6 A;  4DIP A;  2MLX A;  1ZL1 A;  1TFV A;  1BKF A;  3ARU A;  5DIV A;  4WK9 A;  3UF8 A;  4MPK A;  1ROT A;  2ZR4 A;  4Z2K A;  3UQB A;  1W1T A;  4DWS C;  1QZ2 A;  4IPX A;  1W1Y A;  4TX0 A;  3WD0 A;  4DZ2 A;  2KFW A;  2ZQS A;  3PR9 A;  3WKZ A;  3TCZ A;  2RUD A;  1NSG A;  1EIB A;  1XHG A;  1X6N A;  3NRK A;  5GPG A;  3ARV A;  1JCH B;  2A3A A;  4DRN A;  3WIJ A;  4JFL A;  3ARZ A;  4J4O A;  4MSP A;  2XP5 A;  3KCE A;  4P8V A;  2PV1 A;  4LAX A;  1FKL A;  1LJY A;  2DT2 A;  1HKI A;  1XRV A;  1FKI A;  2PBC A;  2AOS A;  1J4I A;  1JNE A;  3AS1 A;  2PPP A;  3WQW A;  4GGQ A;  2RUR A;  1LG2 A;  4P8W A;  1O6I A;  3ODK A;  1E9L A;  1FKT A;  3WL0 A;  4G2P A;  3RFW A;  1H0I A;  2KGJ A;  3CZ8 A;  4TW7 A;  3B9D A;  3UI5 A;  4DT4 A;  1H0G A;  2KO7 A;  3TDB A;  2LJ4 A;  1Q6U A;  1D2K A;  4TYO A;  1HXV A;  1E6N A;  1GUV A;  1W9P A;  1FKJ A;  4QT2 A;  2LPV A;  2PV2 A;  4Q22 A;  3G6L A;  3IHZ A;  3CGM A;  5DIU A; 
#chains in the Genus database with same CATH homology
 1UR8 A;  1YAT A;  1HKM A;  2ESC A;  1Q1C A;  5HUA A;  5HTG A;  1KT0 A;  3B8S A;  3WD2 A;  1X6L A;  2N87 A;  2B31 A;  3CHC A;  1LG1 A;  3ARO A;  2L2S A;  4BF8 A;  5BXJ A;  2LKN A;  4LGX A;  1NWR A;  2MNT A;  2RQS A;  3O5I A;  1ZCN A;  3KAB A;  4MAV A;  2RSE A;  3IK8 A;  4LAY A;  3UQI A;  4FN2 A;  1QPF A;  2DG9 A;  3FAP A;  4Z2H A;  2QF8 A;  4TW6 A;  1LL6 A;  1ZB5 A;  2XP4 A;  4DRM A;  2DSU A;  2PPN A;  3WD3 A;  1M5Y A;  4ZPW R;  4HAR A;  1KFW A;  3ARX A;  2ZQU A;  3I6C A;  5DF0 A;  3ARY A;  4Z2L A;  3RME A;  2WLZ A;  3BXW A;  4HBO A;  2F21 A;  2WLY A;  1L1P A;  1UR9 A;  3PRD A;  4W9O A;  1B6C A;  3B9A A;  4MTV A;  3KAD A;  1ZBK A;  4P8U A;  4Z2G A;  1U79 A;  2FKE A;  2FAP A;  1W1P A;  1CTN A;  4MNJ A;  4WKA A;  2IUZ A;  1EHN A;  1SR0 A;  1ZBW A;  3O5E A;  1E6Z A;  3FXY A;  4U86 A;  3TC5 A;  5HKG A;  1JVW A;  3KAI A;  3GPK A;  4ODK A;  3RM9 A;  4ODO A;  4JYS A;  2G8Z A;  3CHD A;  4MNL A;  1FKD A;  1Q6I A;  3UQA A;  4DWS A;  3CHE A;  1JNT A;  1RD6 A;  1FKK A;  1EDQ A;  2MF9 A;  2MLY A;  2XP3 A;  2Q5A A;  2DT0 A;  4JFM A;  2DPE A;  1ZBC A;  4JFK A;  3ARW A;  1EYM A;  1FFQ A;  5GPR A;  2MPH A;  1JNS A;  4JFI A;  5HWB A;  1FKF A;  3WD4 A;  1A7X A;  2KE0 A;  1J6Y A;  4IT4 A;  4ZPT R;  1FKR A;  4DRH A;  4ODN A;  3H9R B;  2XPA A;  1QPL A;  2XP7 A;  4Z2I A;  1NH6 A;  3RM8 A;  5D75 A;  4MNK A;  1FKB A;  4ZPV R;  3VAW A;  1W9U A;  2ZQT A;  1NWS A;  2DT3 A;  4W5U A;  2M08 A;  3WH0 A;  1HJX A;  1HKJ A;  4ODM A;  3RM4 A;  4JFJ A;  2OLH A;  2PPO A;  2KI3 A;  3AS0 A;  3OA5 A;  4NZC A;  3NI6 A;  1F40 A;  3AQU A;  4S3K A;  1KT1 A;  3JXV A;  3UI4 A;  4DRK A;  1R9H A;  4QIB A;  4U85 A;  1J4H A;  1NWU A;  1YW5 A;  1WAW A;  4WKF A;  3MDY B;  5GQB A;  3O5R A;  3WL1 A;  3EY6 A;  1D7J A;  5HW8 A;  4U84 A;  5HWC A;  1OGB A;  3WD1 A;  2WM0 A;  4WJX A;  3ARR A;  3ALF A;  1VF8 A;  1J4R A;  4O2T A;  4DH0 A;  3ALG A;  1C9H A;  3PRB A;  4IQ2 A;  4IT6 A;  3O5Q A;  2YBT A;  5I98 A;  2UZ5 A;  4DRP A;  4IQC A;  3O5M A;  3O5L A;  4G50 A;  2Y78 A;  4DZ3 A;  4HBE A;  3WQV A;  4L3N A;  4MNM A;  2DG4 A;  1HKK A;  4QT3 A;  3RGC A;  3IKG A;  2XP8 A;  3NTP A;  1FJD A;  1GOI A;  4PTM A;  1D6O A;  4ODQ A;  5HW6 A;  4ODL A;  2VN1 A;  3CH9 A;  5HBF A;  2RUQ A;  3QOK A;  3AS2 A;  1ZK6 A;  1JND A;  4KQZ A;  1WB0 A;  2ITK A;  3JYM A;  2DSV A;  1D7H A;  1HJW A;  2O92 A;  3O5P A;  5JH8 A;  3AS3 A;  2M2A A;  2JZV A;  3FY1 A;  1Y0O A;  3O5F A;  3KAF A;  5J6E A;  4AY1 A;  1W9V A;  2ZR6 A;  3UI6 A;  1T11 A;  5HT1 A;  1K9T A;  2VCD A;  3O5J A;  1NMW A;  3ART A;  4L72 B;  2OFN A;  4J4N A;  1GPF A;  5DEZ A;  1E6R A;  1HJV A;  3KAH A;  4DRO A;  4DRQ A;  1LQ0 A;  1WNO A;  4KR0 B;  3B9E A;  5DO2 A;  3OOB A;  4TW8 A;  4ZS6 A;  2DT1 A;  3KAG A;  2IF4 A;  3KZ7 A;  2WK2 A;  4QZV B;  3ARP A;  3B7X A;  4DRI A;  4DWS B;  1LL7 A;  4Q7N A;  4DWS D;  2AWG A;  3O5D A;  1EQ3 A;  1NWT A;  4LAV A;  1OGG A;  1BL4 A;  4N19 A;  2A3B A;  4DRJ A;  1W26 A;  1ZU8 A;  2A3E A;  1PBK A;  4NSB A;  2DSZ A;  1FKS A;  1FFR A;  2FDM A;  4R0X A;  2PI6 A;  2A3C A;  3W4R A;  5DIT A;  4W9P A;  1PIN A;  3O5O A;  3KAC A;  4LAW A;  1TCO C;  1P5Q A;  1SYT A;  2F4E A;  2DSW A;  1N1A A;  5HW7 A;  1F8A B;  1ROU A;  2ZQV A;  2YBU A;  2G41 A;  3CGN A;  2D9F A;  3ARQ A;  2MLZ A;  3O5G A;  2LGO A;  4MGV A;  4WIW A;  4FAP A;  4W9Q A;  1ITX A;  4ODR A;  1ZBV A;  3IKD A;  3PA7 A;  1LL4 A;  1E6P A;  4C02 B;  1E15 A;  3G6M A;  2ZR5 A;  1Q6H A;  1OWQ A;  1FD9 A;  2PV3 A;  4S3J A;  5B8I C;  2RUC A;  3ARS A;  4ODP A;  2O9O A;  1NMV A;  2DG3 A;  2F2D A;  3LUO A;  4WKH A;  2K8I A;  2M1I A;  1FAP A;  4GIV A;  3CHF A;  4P8X A;  3O5K A;  2XP9 A;  4ITZ A;  4R5E A;  1FKG A;  1D7I A;  4NNR A;  1FKH A;  4XAK A;  4Z2J A;  4TNS A;  1W1V A;  3PRA A;  2XPB A;  2KR7 A;  4ML4 A;  3JYJ A;  4URI A;  1IX5 A;  2XP6 A;  4DIP A;  2MLX A;  1ZL1 A;  1TFV A;  1BKF A;  3ARU A;  5DIV A;  4WK9 A;  3UF8 A;  4MPK A;  1ROT A;  2ZR4 A;  4Z2K A;  3UQB A;  1W1T A;  4DWS C;  1QZ2 A;  4IPX A;  1W1Y A;  4TX0 A;  3WD0 A;  4DZ2 A;  2KFW A;  2ZQS A;  3PR9 A;  3WKZ A;  3TCZ A;  2RUD A;  1NSG A;  1EIB A;  1XHG A;  1X6N A;  3NRK A;  5GPG A;  3ARV A;  2A3A A;  4DRN A;  3WIJ A;  4JFL A;  3ARZ A;  4J4O A;  4MSP A;  2XP5 A;  3KCE A;  4P8V A;  2PV1 A;  4LAX A;  1FKL A;  1LJY A;  2DT2 A;  1HKI A;  1XRV A;  1FKI A;  2PBC A;  2AOS A;  1J4I A;  1JNE A;  3AS1 A;  2PPP A;  3WQW A;  4GGQ A;  2RUR A;  1LG2 A;  4P8W A;  1O6I A;  3ODK A;  1E9L A;  1FKT A;  3WL0 A;  4G2P A;  3RFW A;  1H0I A;  2KGJ A;  3CZ8 A;  4TW7 A;  3B9D A;  3UI5 A;  4DT4 A;  1H0G A;  2KO7 A;  3TDB A;  2LJ4 A;  1Q6U A;  1D2K A;  4TYO A;  1HXV A;  1E6N A;  1GUV A;  1W9P A;  1FKJ A;  4QT2 A;  2LPV A;  2PV2 A;  4Q22 A;  3G6L A;  3IHZ A;  3CGM A;  5DIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...