5HTGA

Structure of apo p1 form of candida albicans fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
122
structure length
122
Chain Sequence
b'EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 27
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5htgA00
1D6OA 4J4OA 2LPVA 1Y0OA 1QPFA 2RSEA 3O5KA 4O2TA 2KR7A 3EY6A 5HTGA 1YATA 4DRHA 2KI3A 3IK8A 3O5EA 2XP3A 4MGVA 3PRBA 2MF9A 4DRQA 5HUAA 1R9HA 5GPGA 2XPBA 1A7XA 3O5GA 4IPXA 3JYJA 1FKFA 2ZQVA 4ODLA 1F40A 1FD9A 4DZ3A 4U86A 1PBKA 2XP9A 2M2AA 2LKNA 1FKDA 1FKSA 1Q6HA 2ITKA 2M1IA 4R0XA 1J6YA 1FKLA 5HW6A 1FKKA 4N19A 5BXJA 1BL4A 4TW8A 3O5JA 2ZR5A 2KE0A 5HW7A 3OOBA 1L1PA 4W9PA 1F8AB 2MPHA 1ROTA 2MLXA 3O5PA 2DG9A 4ODPA 1B6CA 4BF8A 3KAFA 4JFIA 3NRKA 1J4RA 2MLYA 2MLZA 3KCEA 4DRJA 4IQ2A 3CGMA 2XP5A 3UI4A 2PPOA 4TW7A 1QPLA 4C02B 2L2SA 4FN2A 3B7XA 3H9RB 1ROUA 4LAVA 3UI5A 1NMWA 2KFWA 4ODKA 2DG4A 1T11A 1FKIA 1J4IA 3KADA 4J4NA 4TNSA 4GIVA 3PRDA 4DZ2A 3KZ7A 3JXVA 4TYOA 3IKDA 4G2PA 5DIUA 1FAPA 3UQIA 2LJ4A 1EYMA 2XP6A 3KAIA 4DH0A 2XP8A 4DRNA 3GPKA 1KT1A 3IHZA 3O5QA 2ZQUA 1ZK6A 5HT1A 1W26A 1NMVA 2ZR6A 4ODNA 4DT4A 4U85A 1FJDA 1FKRA 4DRIA 3RGCA 3PA7A 1JNTA 1FKJA 2VN1A 2RQSA 3MDYB 4G50A 1TCOC 4LAYA 3UQBA 1HXVA 2PPPA 2FAPA 4NNRA 2ZQTA 3O5MA 3CGNA 1C9HA 3UF8A 2D9FA 2F21A 3O5RA 5DITA 3O5DA 2M08A 2XPAA 3VAWA 4DRMA 3KAGA 1P5QA 2XP7A 1FKTA 2RUQA 2KO7A 3ODKA 2Q5AA 4DRKA 1FKBA 4MSPA 4LAWA 4JFJA 1FKHA 3LUOA 1FKGA 2RUCA 1D7JA 4DRPA 3WH0A 3O5IA 1J4HA 2N87A 4JFLA 4ODQA 4W9OA 1BKFA 3FAPA 2IF4A 5HWCA 4JYSA 2RUDA 4ODOA 4FAPA 4LAXA 2K8IA 2Y78A 3O5OA 4TW6A 2DG3A 1JNSA 2F4EA 2PV2A 2PBCA 5HKGA 2LGOA 3JYMA 3UI6A 4QT3A 1Q6UA 4ITZA 2F2DA 5HWBA 4ODMA 1D7HA 4TX0A 3TCZA 2MNTA 2OFNA 2PV1A 4QT2A 2PV3A 4JFKA 5I98A 3O5LA 1EQ3A 2ZR4A 1M5YA 4ODRA 4DIPA 4W9QA 2KGJA 4IQCA 5J6EA 4U84A 4GGQA 2VCDA 1Q6IA 2RURA 3O5FA 1KT0A 1Q1CA 1U79A 3TDBA 5HW8A 2AWGA 2JZVA 2ZQSA 4QIBA 1ZCNA 3KAHA 2XP4A 3NTPA 4JFMA 1NSGA 1YW5A 3KABA 2FKEA 3UQAA 3I6CA 3KACA 3IKGA 4DROA 1JVWA 1N1AA 2UZ5A 5B8IC 1PINA 3RFWA 5D75A 2PPNA 3NI6A 1QZ2A 3TC5A 5DIVA 1D7IA
chains in the Genus database with same CATH superfamily
1Y0OA 4Z2JA 3O5KA 2KR7A 1YATA 3RMEA 3GU0A 2XP3A 1GPFA 1UR9A 2XPBA 3O5GA 3RM8A 2O92A 1X6NA 2ZQVA 4ODLA 2M2AA 1FKDA 4R0XA 4Z2GA 5HW6A 3ARWA 1LJYA 5BXJA 1BL4A 4TW8A 2ZR5A 2KE0A 4HBOA 3G6MA 1EDQA 1NH6A 1W9VA 2DG9A 1B6CA 4BF8A 4ZPTR 1WNOA 1J4RA 3CGMA 4AY1A 2P4VA 3B8SA 3G6LA 3H9RB 4LAVA 5GPRA 1NMWA 2KFWA 4R5EA 2IUZA 2G8ZA 1K9TA 4J4NA 1H0IA 1EIBA 5DIUA 2XP6A 4DRNA 1FFRA 3O5QA 4DT4A 1ZK6A 1W26A 3ARYA 4DWSC 4U85A 1FKRA 1SR0A 1FKJA 2VN1A 3MDYB 4G50A 4MPKA 1FFQA 1C9HA 3UF8A 3O5DA 5DF0A 2DT1A 4WKAA 1E6RA 1XHGA 2RUQA 4DRKA 1HJXA 1D7JA 3CHDA 1HKIA 3WH0A 3O5IA 3CHEA 2K8IA 2F4EA 2O9OA 5HKGA 4ODMA 1W1TA 1E6PA 2MNTA 2OFNA 2PV3A 3WD3A 2DSWA 3ALGA 1M5YA 3ARSA 1OGGA 3B9EA 2B31A 5J6EA 1ZB5A 2VCDA 2RURA 1Q1CA 5HW8A 1GOIA 2JZVA 1HKKA 2AOSA 2XP4A 4JFMA 2FKEA 3UQAA 3KACA 1N1AA 4WJXA 3NI6A 5DIVA 1D7IA 4DWSD 1H0GA 4J4OA 1IX5A 2RSEA 4DWSB 3EY6A 1XRVA 5HTGA 1ZU8A 2KI3A 3IK8A 4MGVA 3PRBA 4IT6A 4DRQA 1R9HA 3ARZA 1A7XA 4IPXA 3AS0A 3AROA 3WL0A 4S3KA 4DZ3A 2XP9A 4N19A 3OOBA 2MPHA 3ARTA 2PN0A 5JH8A 3KCEA 3FY1A 2XP5A 4TW7A 2OLHA 3B7XA 1TFVA 3UI5A 2FDMA 4Q7NA 2DPEA 2DG4A 1T11A 1FKIA 4DZ2A 4TNSA 3PRDA 1D2KA 3IKDA 1EYMA 3ARUA 1LG2A 2XP8A 3GPKA 3IHZA 2ZQUA 5HT1A 1NMVA 4ODNA 1LL6A 2WM0A 2QF8A 3ARXA 3AS1A 4LAYA 4NNRA 3O5MA 1JNDA 3GTYX 1UR8A 2XPAA 5DO2A 1P5QA 1FKTA 2Q5AA 4MNMA 2DT2A 2N87A 1OGBA 2IF4A 5HWCA 1LQ0A 4FAPA 4LAXA 3O5OA 2Y78A 3EIPA 2DSZA 1JNSA 3UI6A 1Q6UA 4TX0A 3ARQA 4QT2A 2DSUA 4NZCA 4WIWA 5I98A 1ZBKA 1NWUA 1W9PA 4HBEA 4DIPA 3WKZA 4WKFA 1Q6IA 1ITXA 3TDBA 1HKJA 1X6LA 1ZBVA 4QIBA 3FXYA 1LL4A 2ETNA 2YBUA 1YW5A 3KABA 3QOKA 5GQBA 2WLYA 5B8IC 1QZ2A 3AQUA 1D6OA 1VF8A 3BMBA 1QPFA 4O2TA 1GRJA 3CHCA 4DRHA 3O5EA 3ARVA 5HUAA 5GPGA 3WQWA 3CZ8A 4ZS6A 1FKFA 1FD9A 4U86A 3BXWA 2LKNA 3RM4A 1FKSA 2M1IA 4WKHA 1FKLA 1FKKA 3O5JA 4MNLA 1LG1A 1L1PA 1F8AB 3WD1A 3B9DA 1ROTA 2G41A 3O5PA 1CTNA 3KAFA 4JFIA 3NRKA 2MLZA 4DRJA 3UI4A 2PPOA 5HBFA 2L2SA 1E6ZA 1O6IA 1E6NA 4QZVB 4ODKA 1W1VA 1J4IA 4TYOA 3JXVA 3PRAA 1HKMA 3UQIA 4P8WA 4DH0A 1NWTA 1KFWA 1FJDA 3WL1A 4DRIA 3PA7A 1JNEA 2RQSA 3UQBA 3W4RA 2PPPA 3CGNA 2DT0A 2F21A 3ALFA 3O5RA 4WK9A 3ARPA 5DITA 4DRMA 3KAGA 2YBTA 3ODKA 1FKBA 4MSPA 4JFJA 1FKHA 2RUCA 4DRPA 4ZPWR 2A3BA 1J4HA 4JFLA 4ODQA 1E15A 1LL7A 4W9OA 1BKFA 1WB0A 3CH9A 2RUDA 4ODOA 4TW6A 3WD0A 2PV2A 2WK2A 4ZPVR 2LGOA 3JYMA 4DWSA 4QT3A 4ITZA 2F2DA 2PV1A 3AS2A 2ESCA 3O5LA 3WIJA 1HJVA 4ODRA 1JCHB 1WAWA 2KGJA 2A3CA 4W9QA 4IT4A 4U84A 4Z2HA 3O5FA 4XAKA 1KT0A 1U79A 2WLZA 2ZQSA 1ZCNA 4MNKA 3NTPA 3B9AA 1JVWA 3CHFA 4HARA 1PINA 5D75A 2PPNA 3TC5A 2EULA 2LPVA 1HJWA 4NSBA 2MF9A 4LGXA 3PR9A 3JYJA 1E44A 2DT3A 1F40A 1E9LA 1PBKA 1Q6HA 2ITKA 2A3AA 1J6YA 4P8VA 4W5UA 1ZBCA 1W9UA 5HW7A 4W9PA 4P8XA 2MLXA 4ODPA 4ML4A 4P8UA 2MLYA 4DROA 4IQ2A 4C02B 1QPLA 4S3JA 4FN2A 1ROUA 4URIA 3WD2A 3KADA 2PI6A 4GIVA 3KZ7A 3RM9A 4G2PA 1FAPA 2LJ4A 1KT1A 4MNJA 2ZR6A 4L72B 3RGCA 1JNTA 1TCOC 1HXVA 1SYTA 1ZBWA 4KR0B 2FAPA 4Q22A 2ZQTA 3WD4A 2D9FA 2M08A 3VAWA 1NWRA 5DEZA 4PTMA 2XP7A 2F23A 1RD6A 2KO7A 4UDMA 4LAWA 3LUOA 1FKGA 1W1YA 2DSVA 3ARRA 3FAPA 1W1PA 4JYSA 2DG3A 2PBCA 1NWSA 5HWBA 1D7HA 3TCZA 4Z2LA 4JFKA 2A3EA 4MAVA 4L3NA 2ZR4A 1EQ3A 4IQCA 4GGQA 3AS3A 2B5UB 2AWGA 1OWQA 3KAHA 1NSGA 1ZL1A 3WQVA 4MTVA 4Z2IA 1GUVA 3I6CA 4KQZA 3OA5A 3IKGA 2UZ5A 1EHNA 3RFWA 3KAIA 4Z2KA
chains in the Genus database with same CATH topology
1Y0OA 4Z2JA 3O5KA 2KR7A 1YATA 3RMEA 2XP3A 1GPFA 1UR9A 2XPBA 3O5GA 3RM8A 2O92A 1X6NA 2ZQVA 4ODLA 2M2AA 1FKDA 4R0XA 4Z2GA 5HW6A 3ARWA 1LJYA 5BXJA 1BL4A 4TW8A 2ZR5A 2KE0A 4HBOA 3G6MA 1EDQA 1NH6A 1W9VA 2DG9A 1B6CA 4BF8A 4ZPTR 1WNOA 1J4RA 3CGMA 4AY1A 3B8SA 3G6LA 3H9RB 4LAVA 5GPRA 1NMWA 2KFWA 4R5EA 2IUZA 2G8ZA 1K9TA 4J4NA 1H0IA 1EIBA 5DIUA 2XP6A 4DRNA 3O5QA 1FFRA 4DT4A 1ZK6A 1W26A 3ARYA 4DWSC 4U85A 1FKRA 1SR0A 1FKJA 2VN1A 3MDYB 4G50A 4MPKA 1FFQA 1C9HA 3UF8A 3O5DA 5DF0A 2DT1A 4WKAA 1E6RA 1XHGA 2RUQA 4DRKA 1HJXA 1D7JA 3CHDA 1HKIA 3WH0A 3O5IA 3CHEA 2K8IA 2F4EA 2O9OA 5HKGA 4ODMA 1W1TA 1E6PA 2MNTA 2OFNA 2PV3A 3WD3A 2DSWA 3ALGA 1M5YA 3ARSA 1OGGA 3B9EA 2B31A 5J6EA 1ZB5A 2VCDA 2RURA 1Q1CA 5HW8A 1GOIA 2JZVA 1HKKA 2AOSA 2XP4A 4JFMA 2FKEA 3UQAA 3KACA 1N1AA 4WJXA 3NI6A 5DIVA 1D7IA 4DWSD 1H0GA 4J4OA 1IX5A 2RSEA 4DWSB 3EY6A 1XRVA 5HTGA 1ZU8A 2KI3A 3IK8A 4MGVA 3PRBA 4IT6A 4DRQA 1R9HA 3ARZA 1A7XA 4IPXA 3AS0A 3AROA 3WL0A 4S3KA 4DZ3A 2XP9A 4N19A 3OOBA 2MPHA 3ARTA 5JH8A 3KCEA 3FY1A 2XP5A 4TW7A 2OLHA 3B7XA 1TFVA 3UI5A 2FDMA 4Q7NA 2DPEA 2DG4A 1T11A 1FKIA 4DZ2A 4TNSA 3PRDA 1D2KA 3IKDA 1EYMA 3ARUA 1LG2A 2XP8A 3GPKA 3IHZA 2ZQUA 5HT1A 1NMVA 4ODNA 1LL6A 2WM0A 2QF8A 3ARXA 3AS1A 4LAYA 4NNRA 3O5MA 1JNDA 1UR8A 2XPAA 5DO2A 1P5QA 1FKTA 2Q5AA 4MNMA 2DT2A 2N87A 1OGBA 2IF4A 5HWCA 1LQ0A 4FAPA 4LAXA 3O5OA 2Y78A 2DSZA 1JNSA 3UI6A 1Q6UA 4TX0A 3ARQA 4QT2A 2DSUA 4NZCA 4WIWA 5I98A 1ZBKA 1NWUA 1W9PA 4HBEA 4DIPA 3WKZA 4WKFA 1Q6IA 1ITXA 3TDBA 1HKJA 1X6LA 1ZBVA 4QIBA 3FXYA 1LL4A 2YBUA 1YW5A 3KABA 3QOKA 5GQBA 2WLYA 5B8IC 1QZ2A 3AQUA 1D6OA 1VF8A 1QPFA 4O2TA 3CHCA 4DRHA 3O5EA 3ARVA 5HUAA 5GPGA 3WQWA 3CZ8A 4ZS6A 1FKFA 1FD9A 4U86A 3BXWA 2LKNA 3RM4A 1FKSA 2M1IA 4WKHA 1FKLA 1FKKA 3O5JA 4MNLA 1LG1A 1L1PA 1F8AB 3WD1A 3B9DA 1ROTA 2G41A 3O5PA 1CTNA 3KAFA 4JFIA 3NRKA 2MLZA 4DRJA 3UI4A 2PPOA 5HBFA 2L2SA 1E6ZA 1O6IA 1E6NA 4QZVB 4ODKA 1W1VA 1J4IA 4TYOA 3JXVA 3PRAA 1HKMA 3UQIA 4P8WA 4DH0A 1NWTA 1KFWA 1FJDA 3WL1A 4DRIA 3PA7A 1JNEA 2RQSA 3UQBA 3W4RA 2PPPA 3CGNA 2DT0A 2F21A 3ALFA 3O5RA 4WK9A 3ARPA 5DITA 4DRMA 3KAGA 2YBTA 3ODKA 1FKBA 4MSPA 4JFJA 1FKHA 2RUCA 4DRPA 4ZPWR 2A3BA 1J4HA 4JFLA 4ODQA 1E15A 1LL7A 4W9OA 1BKFA 1WB0A 3CH9A 2RUDA 4ODOA 4TW6A 3WD0A 2PV2A 2WK2A 4ZPVR 2LGOA 3JYMA 4DWSA 4QT3A 4ITZA 2F2DA 2PV1A 3AS2A 2ESCA 3O5LA 3WIJA 1HJVA 4ODRA 4Z2HA 1WAWA 2KGJA 2A3CA 4W9QA 4IT4A 4U84A 3O5FA 4XAKA 1KT0A 1U79A 2WLZA 2ZQSA 1ZCNA 4MNKA 3NTPA 3B9AA 1JVWA 3CHFA 4HARA 1PINA 5D75A 2PPNA 3TC5A 2LPVA 1HJWA 4NSBA 2MF9A 4LGXA 3PR9A 3JYJA 2DT3A 1F40A 1E9LA 1PBKA 1Q6HA 2ITKA 2A3AA 1J6YA 4P8VA 4W5UA 1ZBCA 1W9UA 5HW7A 4W9PA 4P8XA 2MLXA 4ODPA 4ML4A 4P8UA 2MLYA 4DROA 4IQ2A 4C02B 1QPLA 4S3JA 4FN2A 1ROUA 4URIA 3WD2A 3KADA 2PI6A 4GIVA 3KZ7A 3RM9A 4G2PA 1FAPA 2LJ4A 1KT1A 4MNJA 2ZR6A 4L72B 3RGCA 1JNTA 1TCOC 1HXVA 1SYTA 1ZBWA 4KR0B 2FAPA 4Q22A 2ZQTA 3WD4A 2D9FA 2M08A 3VAWA 1NWRA 5DEZA 4PTMA 2XP7A 1RD6A 2KO7A 4LAWA 3LUOA 1FKGA 1W1YA 2DSVA 3ARRA 3FAPA 1W1PA 4JYSA 2DG3A 2PBCA 1NWSA 5HWBA 1D7HA 3TCZA 4Z2LA 4JFKA 2A3EA 4MAVA 4L3NA 2ZR4A 1EQ3A 4IQCA 4GGQA 3AS3A 2AWGA 1OWQA 3KAHA 1NSGA 1ZL1A 3WQVA 4MTVA 4Z2IA 1GUVA 3I6CA 4KQZA 3OA5A 3IKGA 2UZ5A 1EHNA 3RFWA 3KAIA 4Z2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D6O A;  4J4O A;  2LPV A;  1Y0O A;  1QPF A;  2RSE A;  3O5K A;  4O2T A;  2KR7 A;  3EY6 A;  5HTG A;  1YAT A;  4DRH A;  2KI3 A;  3IK8 A;  3O5E A;  2XP3 A;  4MGV A;  3PRB A;  2MF9 A;  4DRQ A;  5HUA A;  1R9H A;  5GPG A;  2XPB A;  1A7X A;  3O5G A;  4IPX A;  3JYJ A;  1FKF A;  2ZQV A;  4ODL A;  1F40 A;  1FD9 A;  4DZ3 A;  4U86 A;  1PBK A;  2XP9 A;  2M2A A;  2LKN A;  1FKD A;  1FKS A;  1Q6H A;  2ITK A;  2M1I A;  4R0X A;  1J6Y A;  1FKL A;  5HW6 A;  1FKK A;  4N19 A;  5BXJ A;  1BL4 A;  4TW8 A;  3O5J A;  2ZR5 A;  2KE0 A;  5HW7 A;  3OOB A;  1L1P A;  4W9P A;  1F8A B;  2MPH A;  1ROT A;  2MLX A;  3O5P A;  2DG9 A;  4ODP A;  1B6C A;  4BF8 A;  3KAF A;  4JFI A;  3NRK A;  1J4R A;  2MLY A;  2MLZ A;  3KCE A;  4DRJ A;  4IQ2 A;  3CGM A;  2XP5 A;  3UI4 A;  2PPO A;  4TW7 A;  1QPL A;  4C02 B;  2L2S A;  4FN2 A;  3B7X A;  3H9R B;  1ROU A;  4LAV A;  3UI5 A;  1NMW A;  2KFW A;  4ODK A;  2DG4 A;  1T11 A;  1FKI A;  1J4I A;  3KAD A;  4J4N A;  4TNS A;  4GIV A;  3PRD A;  4DZ2 A;  3KZ7 A;  3JXV A;  4TYO A;  3IKD A;  4G2P A;  5DIU A;  1FAP A;  3UQI A;  2LJ4 A;  1EYM A;  2XP6 A;  3KAI A;  4DH0 A;  2XP8 A;  4DRN A;  3GPK A;  1KT1 A;  3IHZ A;  3O5Q A;  2ZQU A;  1ZK6 A;  5HT1 A;  1W26 A;  1NMV A;  2ZR6 A;  4ODN A;  4DT4 A;  4U85 A;  1FJD A;  1FKR A;  4DRI A;  3RGC A;  3PA7 A;  1JNT A;  1FKJ A;  2VN1 A;  2RQS A;  3MDY B;  4G50 A;  1TCO C;  4LAY A;  3UQB A;  1HXV A;  2PPP A;  2FAP A;  4NNR A;  2ZQT A;  3O5M A;  3CGN A;  1C9H A;  3UF8 A;  2D9F A;  2F21 A;  3O5R A;  5DIT A;  3O5D A;  2M08 A;  2XPA A;  3VAW A;  4DRM A;  3KAG A;  1P5Q A;  2XP7 A;  1FKT A;  2RUQ A;  2KO7 A;  3ODK A;  2Q5A A;  4DRK A;  1FKB A;  4MSP A;  4LAW A;  4JFJ A;  1FKH A;  3LUO A;  1FKG A;  2RUC A;  1D7J A;  4DRP A;  3WH0 A;  3O5I A;  1J4H A;  2N87 A;  4JFL A;  4ODQ A;  4W9O A;  1BKF A;  3FAP A;  2IF4 A;  5HWC A;  4JYS A;  2RUD A;  4ODO A;  4FAP A;  4LAX A;  2K8I A;  2Y78 A;  3O5O A;  4TW6 A;  2DG3 A;  1JNS A;  2F4E A;  2PV2 A;  2PBC A;  5HKG A;  2LGO A;  3JYM A;  3UI6 A;  4QT3 A;  1Q6U A;  4ITZ A;  2F2D A;  5HWB A;  4ODM A;  1D7H A;  4TX0 A;  3TCZ A;  2MNT A;  2OFN A;  2PV1 A;  4QT2 A;  2PV3 A;  4JFK A;  5I98 A;  3O5L A;  1EQ3 A;  2ZR4 A;  1M5Y A;  4ODR A;  4DIP A;  4W9Q A;  2KGJ A;  4IQC A;  5J6E A;  4U84 A;  4GGQ A;  2VCD A;  1Q6I A;  2RUR A;  3O5F A;  1KT0 A;  1Q1C A;  1U79 A;  3TDB A;  5HW8 A;  2AWG A;  2JZV A;  2ZQS A;  4QIB A;  1ZCN A;  3KAH A;  2XP4 A;  3NTP A;  4JFM A;  1NSG A;  1YW5 A;  3KAB A;  2FKE A;  3UQA A;  3I6C A;  3KAC A;  3IKG A;  4DRO A;  1JVW A;  1N1A A;  2UZ5 A;  5B8I C;  1PIN A;  3RFW A;  5D75 A;  2PPN A;  3NI6 A;  1QZ2 A;  3TC5 A;  5DIV A;  1D7I A; 
#chains in the Genus database with same CATH topology
 1Y0O A;  4Z2J A;  3O5K A;  2KR7 A;  1YAT A;  3RME A;  3GU0 A;  2XP3 A;  1GPF A;  1UR9 A;  2XPB A;  3O5G A;  3RM8 A;  2O92 A;  1X6N A;  2ZQV A;  4ODL A;  2M2A A;  1FKD A;  4R0X A;  4Z2G A;  5HW6 A;  3ARW A;  1LJY A;  5BXJ A;  1BL4 A;  4TW8 A;  2ZR5 A;  2KE0 A;  4HBO A;  3G6M A;  1EDQ A;  1NH6 A;  1W9V A;  2DG9 A;  1B6C A;  4BF8 A;  4ZPT R;  1WNO A;  1J4R A;  3CGM A;  4AY1 A;  2P4V A;  3B8S A;  3G6L A;  3H9R B;  4LAV A;  5GPR A;  1NMW A;  2KFW A;  4R5E A;  2IUZ A;  2G8Z A;  1K9T A;  4J4N A;  1H0I A;  1EIB A;  5DIU A;  2XP6 A;  4DRN A;  1FFR A;  3O5Q A;  4DT4 A;  1ZK6 A;  1W26 A;  3ARY A;  4DWS C;  4U85 A;  1FKR A;  1SR0 A;  1FKJ A;  2VN1 A;  3MDY B;  4G50 A;  4MPK A;  1FFQ A;  1C9H A;  3UF8 A;  3O5D A;  5DF0 A;  2DT1 A;  4WKA A;  1E6R A;  1XHG A;  2RUQ A;  4DRK A;  1HJX A;  1D7J A;  3CHD A;  1HKI A;  3WH0 A;  3O5I A;  3CHE A;  2K8I A;  2F4E A;  2O9O A;  5HKG A;  4ODM A;  1W1T A;  1E6P A;  2MNT A;  2OFN A;  2PV3 A;  3WD3 A;  2DSW A;  3ALG A;  1M5Y A;  3ARS A;  1OGG A;  3B9E A;  2B31 A;  5J6E A;  1ZB5 A;  2VCD A;  2RUR A;  1Q1C A;  5HW8 A;  1GOI A;  2JZV A;  1HKK A;  2AOS A;  2XP4 A;  4JFM A;  2FKE A;  3UQA A;  3KAC A;  1N1A A;  4WJX A;  3NI6 A;  5DIV A;  1D7I A;  4DWS D;  1H0G A;  4J4O A;  1IX5 A;  2RSE A;  4DWS B;  3EY6 A;  1XRV A;  5HTG A;  1ZU8 A;  2KI3 A;  3IK8 A;  4MGV A;  3PRB A;  4IT6 A;  4DRQ A;  1R9H A;  3ARZ A;  1A7X A;  4IPX A;  3AS0 A;  3ARO A;  3WL0 A;  4S3K A;  4DZ3 A;  2XP9 A;  4N19 A;  3OOB A;  2MPH A;  3ART A;  2PN0 A;  5JH8 A;  3KCE A;  3FY1 A;  2XP5 A;  4TW7 A;  2OLH A;  3B7X A;  1TFV A;  3UI5 A;  2FDM A;  4Q7N A;  2DPE A;  2DG4 A;  1T11 A;  1FKI A;  4DZ2 A;  4TNS A;  3PRD A;  1D2K A;  3IKD A;  1EYM A;  3ARU A;  1LG2 A;  2XP8 A;  3GPK A;  3IHZ A;  2ZQU A;  5HT1 A;  1NMV A;  4ODN A;  1LL6 A;  2WM0 A;  2QF8 A;  3ARX A;  3AS1 A;  4LAY A;  4NNR A;  3O5M A;  1JND A;  3GTY X;  1UR8 A;  2XPA A;  5DO2 A;  1P5Q A;  1FKT A;  2Q5A A;  4MNM A;  2DT2 A;  2N87 A;  1OGB A;  2IF4 A;  5HWC A;  1LQ0 A;  4FAP A;  4LAX A;  3O5O A;  2Y78 A;  3EIP A;  2DSZ A;  1JNS A;  3UI6 A;  1Q6U A;  4TX0 A;  3ARQ A;  4QT2 A;  2DSU A;  4NZC A;  4WIW A;  5I98 A;  1ZBK A;  1NWU A;  1W9P A;  4HBE A;  4DIP A;  3WKZ A;  4WKF A;  1Q6I A;  1ITX A;  3TDB A;  1HKJ A;  1X6L A;  1ZBV A;  4QIB A;  3FXY A;  1LL4 A;  2ETN A;  2YBU A;  1YW5 A;  3KAB A;  3QOK A;  5GQB A;  2WLY A;  5B8I C;  1QZ2 A;  3AQU A;  1D6O A;  1VF8 A;  3BMB A;  1QPF A;  4O2T A;  1GRJ A;  3CHC A;  4DRH A;  3O5E A;  3ARV A;  5HUA A;  5GPG A;  3WQW A;  3CZ8 A;  4ZS6 A;  1FKF A;  1FD9 A;  4U86 A;  3BXW A;  2LKN A;  3RM4 A;  1FKS A;  2M1I A;  4WKH A;  1FKL A;  1FKK A;  3O5J A;  4MNL A;  1LG1 A;  1L1P A;  1F8A B;  3WD1 A;  3B9D A;  1ROT A;  2G41 A;  3O5P A;  1CTN A;  3KAF A;  4JFI A;  3NRK A;  2MLZ A;  4DRJ A;  3UI4 A;  2PPO A;  5HBF A;  2L2S A;  1E6Z A;  1O6I A;  1E6N A;  4QZV B;  4ODK A;  1W1V A;  1J4I A;  4TYO A;  3JXV A;  3PRA A;  1HKM A;  3UQI A;  4P8W A;  4DH0 A;  1NWT A;  1KFW A;  1FJD A;  3WL1 A;  4DRI A;  3PA7 A;  1JNE A;  2RQS A;  3UQB A;  3W4R A;  2PPP A;  3CGN A;  2DT0 A;  2F21 A;  3ALF A;  3O5R A;  4WK9 A;  3ARP A;  5DIT A;  4DRM A;  3KAG A;  2YBT A;  3ODK A;  1FKB A;  4MSP A;  4JFJ A;  1FKH A;  2RUC A;  4DRP A;  4ZPW R;  2A3B A;  1J4H A;  4JFL A;  4ODQ A;  1E15 A;  1LL7 A;  4W9O A;  1BKF A;  1WB0 A;  3CH9 A;  2RUD A;  4ODO A;  4TW6 A;  3WD0 A;  2PV2 A;  2WK2 A;  4ZPV R;  2LGO A;  3JYM A;  4DWS A;  4QT3 A;  4ITZ A;  2F2D A;  2PV1 A;  3AS2 A;  2ESC A;  3O5L A;  3WIJ A;  1HJV A;  4ODR A;  1JCH B;  1WAW A;  2KGJ A;  2A3C A;  4W9Q A;  4IT4 A;  4U84 A;  4Z2H A;  3O5F A;  4XAK A;  1KT0 A;  1U79 A;  2WLZ A;  2ZQS A;  1ZCN A;  4MNK A;  3NTP A;  3B9A A;  1JVW A;  3CHF A;  4HAR A;  1PIN A;  5D75 A;  2PPN A;  3TC5 A;  2EUL A;  2LPV A;  1HJW A;  4NSB A;  2MF9 A;  4LGX A;  3PR9 A;  3JYJ A;  1E44 A;  2DT3 A;  1F40 A;  1E9L A;  1PBK A;  1Q6H A;  2ITK A;  2A3A A;  1J6Y A;  4P8V A;  4W5U A;  1ZBC A;  1W9U A;  5HW7 A;  4W9P A;  4P8X A;  2MLX A;  4ODP A;  4ML4 A;  4P8U A;  2MLY A;  4DRO A;  4IQ2 A;  4C02 B;  1QPL A;  4S3J A;  4FN2 A;  1ROU A;  4URI A;  3WD2 A;  3KAD A;  2PI6 A;  4GIV A;  3KZ7 A;  3RM9 A;  4G2P A;  1FAP A;  2LJ4 A;  1KT1 A;  4MNJ A;  2ZR6 A;  4L72 B;  3RGC A;  1JNT A;  1TCO C;  1HXV A;  1SYT A;  1ZBW A;  4KR0 B;  2FAP A;  4Q22 A;  2ZQT A;  3WD4 A;  2D9F A;  2M08 A;  3VAW A;  1NWR A;  5DEZ A;  4PTM A;  2XP7 A;  2F23 A;  1RD6 A;  2KO7 A;  4UDM A;  4LAW A;  3LUO A;  1FKG A;  1W1Y A;  2DSV A;  3ARR A;  3FAP A;  1W1P A;  4JYS A;  2DG3 A;  2PBC A;  1NWS A;  5HWB A;  1D7H A;  3TCZ A;  4Z2L A;  4JFK A;  2A3E A;  4MAV A;  4L3N A;  2ZR4 A;  1EQ3 A;  4IQC A;  4GGQ A;  3AS3 A;  2B5U B;  2AWG A;  1OWQ A;  3KAH A;  1NSG A;  1ZL1 A;  3WQV A;  4MTV A;  4Z2I A;  1GUV A;  3I6C A;  4KQZ A;  3OA5 A;  3IKG A;  2UZ5 A;  1EHN A;  3RFW A;  3KAI A;  4Z2K A; 
#chains in the Genus database with same CATH homology
 1Y0O A;  4Z2J A;  3O5K A;  2KR7 A;  1YAT A;  3RME A;  2XP3 A;  1GPF A;  1UR9 A;  2XPB A;  3O5G A;  3RM8 A;  2O92 A;  1X6N A;  2ZQV A;  4ODL A;  2M2A A;  1FKD A;  4R0X A;  4Z2G A;  5HW6 A;  3ARW A;  1LJY A;  5BXJ A;  1BL4 A;  4TW8 A;  2ZR5 A;  2KE0 A;  4HBO A;  3G6M A;  1EDQ A;  1NH6 A;  1W9V A;  2DG9 A;  1B6C A;  4BF8 A;  4ZPT R;  1WNO A;  1J4R A;  3CGM A;  4AY1 A;  3B8S A;  3G6L A;  3H9R B;  4LAV A;  5GPR A;  1NMW A;  2KFW A;  4R5E A;  2IUZ A;  2G8Z A;  1K9T A;  4J4N A;  1H0I A;  1EIB A;  5DIU A;  2XP6 A;  4DRN A;  3O5Q A;  1FFR A;  4DT4 A;  1ZK6 A;  1W26 A;  3ARY A;  4DWS C;  4U85 A;  1FKR A;  1SR0 A;  1FKJ A;  2VN1 A;  3MDY B;  4G50 A;  4MPK A;  1FFQ A;  1C9H A;  3UF8 A;  3O5D A;  5DF0 A;  2DT1 A;  4WKA A;  1E6R A;  1XHG A;  2RUQ A;  4DRK A;  1HJX A;  1D7J A;  3CHD A;  1HKI A;  3WH0 A;  3O5I A;  3CHE A;  2K8I A;  2F4E A;  2O9O A;  5HKG A;  4ODM A;  1W1T A;  1E6P A;  2MNT A;  2OFN A;  2PV3 A;  3WD3 A;  2DSW A;  3ALG A;  1M5Y A;  3ARS A;  1OGG A;  3B9E A;  2B31 A;  5J6E A;  1ZB5 A;  2VCD A;  2RUR A;  1Q1C A;  5HW8 A;  1GOI A;  2JZV A;  1HKK A;  2AOS A;  2XP4 A;  4JFM A;  2FKE A;  3UQA A;  3KAC A;  1N1A A;  4WJX A;  3NI6 A;  5DIV A;  1D7I A;  4DWS D;  1H0G A;  4J4O A;  1IX5 A;  2RSE A;  4DWS B;  3EY6 A;  1XRV A;  5HTG A;  1ZU8 A;  2KI3 A;  3IK8 A;  4MGV A;  3PRB A;  4IT6 A;  4DRQ A;  1R9H A;  3ARZ A;  1A7X A;  4IPX A;  3AS0 A;  3ARO A;  3WL0 A;  4S3K A;  4DZ3 A;  2XP9 A;  4N19 A;  3OOB A;  2MPH A;  3ART A;  5JH8 A;  3KCE A;  3FY1 A;  2XP5 A;  4TW7 A;  2OLH A;  3B7X A;  1TFV A;  3UI5 A;  2FDM A;  4Q7N A;  2DPE A;  2DG4 A;  1T11 A;  1FKI A;  4DZ2 A;  4TNS A;  3PRD A;  1D2K A;  3IKD A;  1EYM A;  3ARU A;  1LG2 A;  2XP8 A;  3GPK A;  3IHZ A;  2ZQU A;  5HT1 A;  1NMV A;  4ODN A;  1LL6 A;  2WM0 A;  2QF8 A;  3ARX A;  3AS1 A;  4LAY A;  4NNR A;  3O5M A;  1JND A;  1UR8 A;  2XPA A;  5DO2 A;  1P5Q A;  1FKT A;  2Q5A A;  4MNM A;  2DT2 A;  2N87 A;  1OGB A;  2IF4 A;  5HWC A;  1LQ0 A;  4FAP A;  4LAX A;  3O5O A;  2Y78 A;  2DSZ A;  1JNS A;  3UI6 A;  1Q6U A;  4TX0 A;  3ARQ A;  4QT2 A;  2DSU A;  4NZC A;  4WIW A;  5I98 A;  1ZBK A;  1NWU A;  1W9P A;  4HBE A;  4DIP A;  3WKZ A;  4WKF A;  1Q6I A;  1ITX A;  3TDB A;  1HKJ A;  1X6L A;  1ZBV A;  4QIB A;  3FXY A;  1LL4 A;  2YBU A;  1YW5 A;  3KAB A;  3QOK A;  5GQB A;  2WLY A;  5B8I C;  1QZ2 A;  3AQU A;  1D6O A;  1VF8 A;  1QPF A;  4O2T A;  3CHC A;  4DRH A;  3O5E A;  3ARV A;  5HUA A;  5GPG A;  3WQW A;  3CZ8 A;  4ZS6 A;  1FKF A;  1FD9 A;  4U86 A;  3BXW A;  2LKN A;  3RM4 A;  1FKS A;  2M1I A;  4WKH A;  1FKL A;  1FKK A;  3O5J A;  4MNL A;  1LG1 A;  1L1P A;  1F8A B;  3WD1 A;  3B9D A;  1ROT A;  2G41 A;  3O5P A;  1CTN A;  3KAF A;  4JFI A;  3NRK A;  2MLZ A;  4DRJ A;  3UI4 A;  2PPO A;  5HBF A;  2L2S A;  1E6Z A;  1O6I A;  1E6N A;  4QZV B;  4ODK A;  1W1V A;  1J4I A;  4TYO A;  3JXV A;  3PRA A;  1HKM A;  3UQI A;  4P8W A;  4DH0 A;  1NWT A;  1KFW A;  1FJD A;  3WL1 A;  4DRI A;  3PA7 A;  1JNE A;  2RQS A;  3UQB A;  3W4R A;  2PPP A;  3CGN A;  2DT0 A;  2F21 A;  3ALF A;  3O5R A;  4WK9 A;  3ARP A;  5DIT A;  4DRM A;  3KAG A;  2YBT A;  3ODK A;  1FKB A;  4MSP A;  4JFJ A;  1FKH A;  2RUC A;  4DRP A;  4ZPW R;  2A3B A;  1J4H A;  4JFL A;  4ODQ A;  1E15 A;  1LL7 A;  4W9O A;  1BKF A;  1WB0 A;  3CH9 A;  2RUD A;  4ODO A;  4TW6 A;  3WD0 A;  2PV2 A;  2WK2 A;  4ZPV R;  2LGO A;  3JYM A;  4DWS A;  4QT3 A;  4ITZ A;  2F2D A;  2PV1 A;  3AS2 A;  2ESC A;  3O5L A;  3WIJ A;  1HJV A;  4ODR A;  4Z2H A;  1WAW A;  2KGJ A;  2A3C A;  4W9Q A;  4IT4 A;  4U84 A;  3O5F A;  4XAK A;  1KT0 A;  1U79 A;  2WLZ A;  2ZQS A;  1ZCN A;  4MNK A;  3NTP A;  3B9A A;  1JVW A;  3CHF A;  4HAR A;  1PIN A;  5D75 A;  2PPN A;  3TC5 A;  2LPV A;  1HJW A;  4NSB A;  2MF9 A;  4LGX A;  3PR9 A;  3JYJ A;  2DT3 A;  1F40 A;  1E9L A;  1PBK A;  1Q6H A;  2ITK A;  2A3A A;  1J6Y A;  4P8V A;  4W5U A;  1ZBC A;  1W9U A;  5HW7 A;  4W9P A;  4P8X A;  2MLX A;  4ODP A;  4ML4 A;  4P8U A;  2MLY A;  4DRO A;  4IQ2 A;  4C02 B;  1QPL A;  4S3J A;  4FN2 A;  1ROU A;  4URI A;  3WD2 A;  3KAD A;  2PI6 A;  4GIV A;  3KZ7 A;  3RM9 A;  4G2P A;  1FAP A;  2LJ4 A;  1KT1 A;  4MNJ A;  2ZR6 A;  4L72 B;  3RGC A;  1JNT A;  1TCO C;  1HXV A;  1SYT A;  1ZBW A;  4KR0 B;  2FAP A;  4Q22 A;  2ZQT A;  3WD4 A;  2D9F A;  2M08 A;  3VAW A;  1NWR A;  5DEZ A;  4PTM A;  2XP7 A;  1RD6 A;  2KO7 A;  4LAW A;  3LUO A;  1FKG A;  1W1Y A;  2DSV A;  3ARR A;  3FAP A;  1W1P A;  4JYS A;  2DG3 A;  2PBC A;  1NWS A;  5HWB A;  1D7H A;  3TCZ A;  4Z2L A;  4JFK A;  2A3E A;  4MAV A;  4L3N A;  2ZR4 A;  1EQ3 A;  4IQC A;  4GGQ A;  3AS3 A;  2AWG A;  1OWQ A;  3KAH A;  1NSG A;  1ZL1 A;  3WQV A;  4MTV A;  4Z2I A;  1GUV A;  3I6C A;  4KQZ A;  3OA5 A;  3IKG A;  2UZ5 A;  1EHN A;  3RFW A;  3KAI A;  4Z2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...