5HTGA

Structure of apo p1 form of candida albicans fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 27
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5htgA00
1FKGA 4IPXA 1NSGA 2RURA 4NNRA 2JZVA 3JYJA 2KGJA 1FD9A 5B8IC 3TDBA 1F8AB 1ZK6A 3KABA 2RSEA 3UI6A 2DG4A 1JVWA 2ZR4A 4JFMA 3NI6A 3RFWA 1FKSA 2ZR5A 3GPKA 1FJDA 1FAPA 5HWBA 3KADA 1B6CA 1QPFA 1U79A 4ITZA 1EQ3A 4MGVA 3PA7A 4GIVA 2MF9A 2LPVA 2N87A 5DITA 1J6YA 1L1PA 1Y0OA 1JNTA 4TYOA 2KO7A 2DG9A 2LJ4A 2PV2A 4IQCA 2ZQTA 2MNTA 3O5IA 3UF8A 5HTGA 5J6EA 3O5LA 4JFLA 2FKEA 1D6OA 2ITKA 1TCOC 3KCEA 1PINA 1FKLA 2XP5A 3IKDA 2IF4A 5HT1A 5DIUA 4TNSA 3MDYB 3UQIA 1F40A 1J4RA 4BF8A 5HW6A 4DRMA 4DRJA 4DRPA 2D9FA 4LAVA 3ODKA 1J4IA 3O5JA 1KT1A 4IQ2A 4JFKA 4QT2A 3PRDA 3TC5A 5HKGA 3JXVA 1FKJA 4ODKA 4JFIA 2XP4A 2VN1A 3LUOA 4G50A 3IHZA 1N1AA 1ROTA 3KACA 3O5QA 2M1IA 3OOBA 3O5FA 2OFNA 3O5DA 1T11A 3RGCA 4N19A 3H9RB 4J4NA 2XP9A 1EYMA 4U85A 2PBCA 3IK8A 3O5OA 5HUAA 2M08A 4W9OA 3UQBA 2F21A 1J4HA 2XPBA 4LAWA 3TCZA 2XP7A 3UI4A 2KE0A 1FKBA 2PPNA 5HWCA 4FN2A 3O5GA 4QT3A 4ODNA 1Q1CA 3NRKA 1Q6IA 1FKIA 2FAPA 2ZQVA 2L2SA 3JYMA 2MPHA 4DH0A 3O5PA 1NMVA 4JFJA 4ODLA 2KR7A 3NTPA 4O2TA 2ZQSA 4W9PA 3WH0A 4DZ2A 2DG3A 3PRBA 2F2DA 1QZ2A 1Q6HA 1YW5A 2MLYA 1KT0A 2PPPA 5HW8A 4QIBA 1JNSA 4DRKA 4DRHA 2XPAA 2AWGA 4J4OA 1FKTA 4MSPA 1FKRA 3KAGA 1D7HA 4ODQA 4W9QA 1Q6UA 3UI5A 1FKKA 1HXVA 4LAYA 4GGQA 3I6CA 4U86A 5I98A 4DIPA 1P5QA 2RQSA 1FKHA 2ZR6A 3FAPA 4ODMA 2UZ5A 4ODOA 4DRQA 4DT4A 4DRIA 2MLZA 2XP8A 2RUQA 4JYSA 2PPOA 2ZQUA 4LAXA 3UQAA 5BXJA 2Y78A 4DROA 1D7IA 3KAIA 3O5EA 2PV1A 1BL4A 2XP6A 3KAHA 4TW7A 1D7JA 5GPGA 4G2PA 4DRNA 2Q5AA 1C9HA 1YATA 2XP3A 4R0XA 4U84A 2RUCA 4C02B 2MLXA 1W26A 1ROUA 3VAWA 1R9HA 4DZ3A 1BKFA 1ZCNA 3CGNA 5HW7A 3O5MA 2KI3A 1M5YA 3CGMA 3IKGA 3O5RA 4ODPA 4TW6A 2KFWA 4ODRA 4TX0A 2LGOA 1FKDA 2VCDA 3KZ7A 2K8IA 3O5KA 4FAPA 1QPLA 2PV3A 1FKFA 3EY6A 3B7XA 1A7XA 5D75A 4TW8A 2M2AA 5DIVA 1PBKA 2RUDA 1NMWA 2F4EA 3KAFA 2LKNA
chains in the Genus database with same CATH superfamily
1FKGA 3PRAA 2RURA 1NWUA 1ZK6A 3KABA 1VF8A 3UI6A 2DG4A 4WJXA 3RFWA 2B5UB 3RM8A 3KADA 4ITZA 1QPFA 3PA7A 3WD3A 1E6PA 2YBUA 2A3EA 3OA5A 1LL6A 4TYOA 4IQCA 2PV2A 5J6EA 5HTGA 3UF8A 3O5IA 2P4VA 4MNMA 4IT4A 1X6NA 3IKDA 1NWTA 5DIUA 1LJYA 4NZCA 1W9UA 1E6NA 3B8SA 4XAKA 1ZBVA 3AS0A 4MNLA 3QOKA 3ODKA 3TC5A 3PRDA 3WD2A 1FFRA 3JXVA 4Z2GA 3LUOA 4G50A 2WK2A 2M1IA 1ZBWA 3O5FA 1T11A 4MNKA 2OLHA 2F23A 1GOIA 4J4NA 3B9EA 3O5OA 3IK8A 5HUAA 2XP7A 2DT0A 5HWCA 4FN2A 3O5GA 4HBEA 4ODNA 1FKIA 1W9VA 2MPHA 3O5PA 1NMVA 4MPKA 3BXWA 3WH0A 2ZQSA 4Q7NA 3PRBA 2DT2A 1QZ2A 1HKKA 2MLYA 1K9TA 2PPPA 5HW8A 3WQVA 3CH9A 1FKTA 4W9QA 3B9DA 1EHNA 3UI5A 4LAYA 4U86A 1P5QA 2DSUA 1WNOA 1ZL1A 4HARA 2ZQUA 4DROA 1D7IA 3KAIA 3O5EA 4DRNA 1BL4A 3KAHA 4WKAA 4U84A 2XP3A 1YATA 4R0XA 3CHFA 4LGXA 4C02B 1R9HA 3AROA 3IKGA 4IT6A 4TX0A 3G6MA 2K8IA 2O9OA 1JCHB 3CHEA 1FKFA 5D75A 2M2AA 1ZU8A 1SYTA 4JFKA 2F4EA 1GUVA 2DSWA 2LKNA 4WKHA 5JH8A 4QZVB 3W4RA 3RM9A 2WLYA 1LG2A 2KGJA 2ETNA 1F8AB 3ARXA 3WKZA 4NSBA 3NI6A 2ZR5A 4PTMA 4P8XA 3ARPA 3FXYA 1FAPA 5HWBA 3GU0A 1U79A 1LL7A 4MGVA 4GIVA 1J6YA 2N87A 5DITA 1L1PA 2DG9A 3O5LA 3CHCA 1TCOC 1PINA 1EDQA 1F40A 4DRMA 4DWSA 3G6LA 1KFWA 1J4IA 3O5JA 4IQ2A 4QT2A 5HKGA 1FKJA 4JFIA 2XP4A 1UR9A 3IHZA 3WIJA 3AS3A 3KACA 1ZBKA 3OOBA 3ALGA 3H9RB 1HKIA 1TFVA 5DEZA 2M08A 2F21A 4LAWA 2KE0A 2PPNA 4DWSD 2G41A 3CZ8A 4O2TA 1E44A 1E15A 4DZ2A 2F2DA 2QF8A 3WD0A 1KT0A 4DRKA 4DRHA 3ARUA 3BMBA 1D2KA 1W1YA 2WM0A 1ZB5A 3ALFA 1HJXA 1D7HA 1Q6UA 5I98A 4DIPA 5DF0A 4DRQA 2UZ5A 4Z2KA 4UDMA 4JYSA 2XP6A 1D7JA 4G2PA 1C9HA 4L72B 2RUCA 3FY1A 2MLXA 4Z2JA 3VAWA 1XHGA 4WK9A 3O5MA 4TW6A 4ODPA 4Q22A 2A3AA 1QPLA 2PV3A 4KQZA 2RUDA 1RD6A 4IPXA 4P8VA 2A3BA 1FD9A 5B8IC 3TDBA 4S3KA 3RMEA 2RSEA 1JVWA 1FKSA 3ARZA 3GPKA 1B6CA 1EQ3A 4DWSB 3WD1A 1UR8A 2MF9A 4ML4A 2B31A 2KO7A 4R5EA 2ZQTA 2MNTA 2FKEA 1NWSA 3ARSA 1FKLA 2IF4A 3ARTA 4TNSA 3MDYB 3UQIA 1LQ0A 4DRJA 4DRPA 3AS1A 2DSZA 4ZPVR 4KR0B 1KT1A 4Z2IA 4ODKA 5GPRA 1ROTA 4MAVA 4N19A 1ZBCA 1EYMA 4W9OA 3UQBA 2WLZA 2DSVA 1J4HA 2XPBA 3TCZA 3UI4A 1FKBA 1LL4A 4ZS6A 1XRVA 1Q6IA 1JNEA 2L2SA 3JYMA 4DH0A 1WB0A 4JFJA 2KR7A 2O92A 2DG3A 4URIA 1EIBA 2PN0A 3AQUA 4J4OA 1FKRA 3AS2A 1GPFA 4P8WA 4HBOA 1FKKA 2G8ZA 1HXVA 3I6CA 2RQSA 1FKHA 2ZR6A 3FAPA 4ODMA 4ODOA 1NWRA 4DRIA 2MLZA 2XP8A 2RUQA 2PPOA 1OGGA 3UQAA 2Y78A 3CHDA 3RM4A 1ZCNA 1OGBA 1O6IA 3O5RA 4ODRA 2YBTA 1W1PA 3KZ7A 3O5KA 4FAPA 2EULA 3EY6A 5DIVA 3WL1A 1PBKA 1NMWA 3KAFA 3RGCA 1NSGA 4Z2LA 4NNRA 2JZVA 3ARQA 3JYJA 1H0GA 2A3CA 2ZR4A 4JFMA 1FJDA 1E9LA 3ARWA 1W1VA 3WD4A 4WKFA 2DPEA 2LPVA 1HKJA 1Y0OA 1JNTA 2LJ4A 4Z2HA 4JFLA 1D6OA 2ITKA 3KCEA 1W1TA 2DT3A 2XP5A 5HT1A 1H0IA 1J4RA 4BF8A 1GRJA 5HW6A 4MTVA 2PI6A 1SR0A 1OWQA 2D9FA 4LAVA 1JNDA 2VN1A 3B9AA 1N1AA 1HJWA 3O5QA 2OFNA 3O5DA 4ZPWR 3WQWA 5GQBA 4W5UA 2XP9A 3EIPA 4U85A 2PBCA 1W9PA 1HJVA 1CTNA 4QT3A 2AOSA 1Q1CA 3NRKA 2FAPA 2IUZA 2ZQVA 4L3NA 2ESCA 4ODLA 3NTPA 4P8UA 4W9PA 1Q6HA 1YW5A 1LG1A 2DT1A 4QIBA 4AY1A 2XPAA 1WAWA 2AWGA 4MSPA 3ARRA 3KAGA 3ARVA 3WL0A 4DWSC 4GGQA 1ITXA 4DT4A 2FDMA 1E6ZA 4LAXA 3PR9A 5BXJA 1E6RA 4WIWA 3ARYA 4TW7A 2PV1A 5GPGA 1JNSA 2Q5AA 1HKMA 3GTYX 1NH6A 1W26A 1ROUA 4DZ3A 1BKFA 3CGNA 4MNJA 4S3JA 5HW7A 2KI3A 1M5YA 3CGMA 1FFQA 1IX5A 4ZPTR 2KFWA 1X6LA 2LGOA 1FKDA 2VCDA 5HBFA 3B7XA 1A7XA 4TW8A 5DO2A 4ODQA
chains in the Genus database with same CATH topology
1FKGA 3PRAA 2RURA 1NWUA 1ZK6A 3KABA 1VF8A 3UI6A 2DG4A 4WJXA 3RFWA 3RM8A 3KADA 4ITZA 1QPFA 3PA7A 3WD3A 1E6PA 2YBUA 2A3EA 3OA5A 1LL6A 4TYOA 4IQCA 2PV2A 5J6EA 5HTGA 3UF8A 3O5IA 4MNMA 4IT4A 1X6NA 3IKDA 1NWTA 5DIUA 1LJYA 4NZCA 1W9UA 1E6NA 3B8SA 4XAKA 1ZBVA 3AS0A 4MNLA 3QOKA 3ODKA 3TC5A 3PRDA 3WD2A 1FFRA 3JXVA 4Z2GA 3LUOA 4G50A 2WK2A 2M1IA 1ZBWA 3O5FA 1T11A 4MNKA 2OLHA 4J4NA 1GOIA 3B9EA 3O5OA 3IK8A 5HUAA 2XP7A 2DT0A 5HWCA 4FN2A 3O5GA 4HBEA 4ODNA 1FKIA 1W9VA 2MPHA 3O5PA 1NMVA 4MPKA 3BXWA 3WH0A 2ZQSA 4Q7NA 3PRBA 2DT2A 1QZ2A 1HKKA 2MLYA 1K9TA 2PPPA 5HW8A 3WQVA 3CH9A 1FKTA 4W9QA 3B9DA 1EHNA 3UI5A 4LAYA 4U86A 1P5QA 2DSUA 1WNOA 1ZL1A 4HARA 2ZQUA 4DROA 1D7IA 3KAIA 3O5EA 4DRNA 1BL4A 3KAHA 4WKAA 4U84A 2XP3A 1YATA 4R0XA 3CHFA 4LGXA 4C02B 1R9HA 3AROA 3IKGA 4IT6A 4TX0A 3G6MA 2K8IA 2O9OA 3CHEA 1FKFA 5D75A 2M2AA 1ZU8A 1SYTA 4JFKA 2F4EA 1GUVA 2DSWA 2LKNA 4WKHA 5JH8A 4QZVB 3W4RA 3RM9A 2WLYA 1LG2A 2KGJA 1F8AB 3ARXA 3WKZA 4NSBA 3NI6A 2ZR5A 4PTMA 4P8XA 3ARPA 3FXYA 1FAPA 5HWBA 1U79A 1LL7A 4MGVA 4GIVA 1J6YA 2N87A 5DITA 1L1PA 2DG9A 3O5LA 3CHCA 1TCOC 1PINA 1EDQA 1F40A 4DRMA 4DWSA 3G6LA 1KFWA 1J4IA 3O5JA 4IQ2A 4QT2A 5HKGA 1FKJA 4JFIA 2XP4A 1UR9A 3IHZA 3WIJA 3AS3A 3KACA 1ZBKA 3OOBA 3ALGA 3H9RB 1HKIA 1TFVA 5DEZA 2M08A 2F21A 4LAWA 2KE0A 2PPNA 4DWSD 2G41A 3CZ8A 4O2TA 1E15A 4DZ2A 2F2DA 2QF8A 3WD0A 1KT0A 4DRKA 4DRHA 3ARUA 1D2KA 1W1YA 2WM0A 1ZB5A 3ALFA 1HJXA 1D7HA 1Q6UA 5I98A 4DIPA 5DF0A 4DRQA 2UZ5A 4Z2KA 4JYSA 2XP6A 1D7JA 4G2PA 1C9HA 4L72B 2RUCA 3FY1A 2MLXA 4Z2JA 3VAWA 1XHGA 4WK9A 3O5MA 4TW6A 4ODPA 4Q22A 2A3AA 1QPLA 2PV3A 4KQZA 2RUDA 1RD6A 4IPXA 4P8VA 2A3BA 1FD9A 5B8IC 3TDBA 4S3KA 3RMEA 2RSEA 1JVWA 1FKSA 3ARZA 3GPKA 1B6CA 1EQ3A 4DWSB 3WD1A 1UR8A 2MF9A 4ML4A 2B31A 2KO7A 4R5EA 2ZQTA 2MNTA 2FKEA 1NWSA 3ARSA 1FKLA 2IF4A 3ARTA 4TNSA 3MDYB 3UQIA 1LQ0A 4DRJA 4DRPA 3AS1A 2DSZA 4ZPVR 4KR0B 1KT1A 4Z2IA 4ODKA 5GPRA 1ROTA 4MAVA 4N19A 1ZBCA 1EYMA 4W9OA 3UQBA 2WLZA 2DSVA 1J4HA 2XPBA 3TCZA 3UI4A 1FKBA 1LL4A 4ZS6A 1XRVA 1Q6IA 1JNEA 2L2SA 3JYMA 4DH0A 1WB0A 4JFJA 2KR7A 2O92A 2DG3A 4URIA 1EIBA 3AQUA 4J4OA 1FKRA 3AS2A 1GPFA 4P8WA 4HBOA 1FKKA 2G8ZA 1HXVA 3I6CA 2RQSA 1FKHA 2ZR6A 3FAPA 4ODMA 4ODOA 1NWRA 4DRIA 2MLZA 2XP8A 2RUQA 2PPOA 1OGGA 3UQAA 2Y78A 3CHDA 3RM4A 1ZCNA 1OGBA 1O6IA 3O5RA 4ODRA 2YBTA 1W1PA 3KZ7A 3O5KA 4FAPA 3EY6A 5DIVA 3WL1A 1PBKA 1NMWA 3KAFA 3RGCA 1NSGA 4Z2LA 4NNRA 2JZVA 3ARQA 3JYJA 1H0GA 2A3CA 2ZR4A 4JFMA 1FJDA 1E9LA 3ARWA 1W1VA 3WD4A 4WKFA 2DPEA 2LPVA 1HKJA 1Y0OA 1JNTA 2LJ4A 4Z2HA 4JFLA 1D6OA 2ITKA 3KCEA 1W1TA 2DT3A 2XP5A 5HT1A 1H0IA 1J4RA 4BF8A 5HW6A 4MTVA 2PI6A 1SR0A 1OWQA 2D9FA 4LAVA 1JNDA 2VN1A 3B9AA 1N1AA 1HJWA 3O5QA 2OFNA 3O5DA 4ZPWR 3WQWA 5GQBA 4W5UA 2XP9A 4U85A 2PBCA 1W9PA 1HJVA 1CTNA 4QT3A 2AOSA 1Q1CA 3NRKA 2FAPA 2IUZA 2ZQVA 4L3NA 2ESCA 4ODLA 3NTPA 4P8UA 4W9PA 1Q6HA 1YW5A 1LG1A 2DT1A 4QIBA 4AY1A 2XPAA 1WAWA 2AWGA 4MSPA 3ARRA 3KAGA 3ARVA 3WL0A 4DWSC 4GGQA 1ITXA 4DT4A 2FDMA 1E6ZA 4LAXA 3PR9A 5BXJA 1E6RA 4WIWA 3ARYA 4TW7A 2PV1A 5GPGA 1JNSA 2Q5AA 1HKMA 1NH6A 1W26A 1ROUA 4DZ3A 1BKFA 3CGNA 4MNJA 4S3JA 5HW7A 2KI3A 1M5YA 3CGMA 1FFQA 1IX5A 4ZPTR 2KFWA 1X6LA 2LGOA 1FKDA 2VCDA 5HBFA 3B7XA 1A7XA 4TW8A 5DO2A 4ODQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKG A;  4IPX A;  1NSG A;  2RUR A;  4NNR A;  2JZV A;  3JYJ A;  2KGJ A;  1FD9 A;  5B8I C;  3TDB A;  1F8A B;  1ZK6 A;  3KAB A;  2RSE A;  3UI6 A;  2DG4 A;  1JVW A;  2ZR4 A;  4JFM A;  3NI6 A;  3RFW A;  1FKS A;  2ZR5 A;  3GPK A;  1FJD A;  1FAP A;  5HWB A;  3KAD A;  1B6C A;  1QPF A;  1U79 A;  4ITZ A;  1EQ3 A;  4MGV A;  3PA7 A;  4GIV A;  2MF9 A;  2LPV A;  2N87 A;  5DIT A;  1J6Y A;  1L1P A;  1Y0O A;  1JNT A;  4TYO A;  2KO7 A;  2DG9 A;  2LJ4 A;  2PV2 A;  4IQC A;  2ZQT A;  2MNT A;  3O5I A;  3UF8 A;  5HTG A;  5J6E A;  3O5L A;  4JFL A;  2FKE A;  1D6O A;  2ITK A;  1TCO C;  3KCE A;  1PIN A;  1FKL A;  2XP5 A;  3IKD A;  2IF4 A;  5HT1 A;  5DIU A;  4TNS A;  3MDY B;  3UQI A;  1F40 A;  1J4R A;  4BF8 A;  5HW6 A;  4DRM A;  4DRJ A;  4DRP A;  2D9F A;  4LAV A;  3ODK A;  1J4I A;  3O5J A;  1KT1 A;  4IQ2 A;  4JFK A;  4QT2 A;  3PRD A;  3TC5 A;  5HKG A;  3JXV A;  1FKJ A;  4ODK A;  4JFI A;  2XP4 A;  2VN1 A;  3LUO A;  4G50 A;  3IHZ A;  1N1A A;  1ROT A;  3KAC A;  3O5Q A;  2M1I A;  3OOB A;  3O5F A;  2OFN A;  3O5D A;  1T11 A;  3RGC A;  4N19 A;  3H9R B;  4J4N A;  2XP9 A;  1EYM A;  4U85 A;  2PBC A;  3IK8 A;  3O5O A;  5HUA A;  2M08 A;  4W9O A;  3UQB A;  2F21 A;  1J4H A;  2XPB A;  4LAW A;  3TCZ A;  2XP7 A;  3UI4 A;  2KE0 A;  1FKB A;  2PPN A;  5HWC A;  4FN2 A;  3O5G A;  4QT3 A;  4ODN A;  1Q1C A;  3NRK A;  1Q6I A;  1FKI A;  2FAP A;  2ZQV A;  2L2S A;  3JYM A;  2MPH A;  4DH0 A;  3O5P A;  1NMV A;  4JFJ A;  4ODL A;  2KR7 A;  3NTP A;  4O2T A;  2ZQS A;  4W9P A;  3WH0 A;  4DZ2 A;  2DG3 A;  3PRB A;  2F2D A;  1QZ2 A;  1Q6H A;  1YW5 A;  2MLY A;  1KT0 A;  2PPP A;  5HW8 A;  4QIB A;  1JNS A;  4DRK A;  4DRH A;  2XPA A;  2AWG A;  4J4O A;  1FKT A;  4MSP A;  1FKR A;  3KAG A;  1D7H A;  4ODQ A;  4W9Q A;  1Q6U A;  3UI5 A;  1FKK A;  1HXV A;  4LAY A;  4GGQ A;  3I6C A;  4U86 A;  5I98 A;  4DIP A;  1P5Q A;  2RQS A;  1FKH A;  2ZR6 A;  3FAP A;  4ODM A;  2UZ5 A;  4ODO A;  4DRQ A;  4DT4 A;  4DRI A;  2MLZ A;  2XP8 A;  2RUQ A;  4JYS A;  2PPO A;  2ZQU A;  4LAX A;  3UQA A;  5BXJ A;  2Y78 A;  4DRO A;  1D7I A;  3KAI A;  3O5E A;  2PV1 A;  1BL4 A;  2XP6 A;  3KAH A;  4TW7 A;  1D7J A;  5GPG A;  4G2P A;  4DRN A;  2Q5A A;  1C9H A;  1YAT A;  2XP3 A;  4R0X A;  4U84 A;  2RUC A;  4C02 B;  2MLX A;  1W26 A;  1ROU A;  3VAW A;  1R9H A;  4DZ3 A;  1BKF A;  1ZCN A;  3CGN A;  5HW7 A;  3O5M A;  2KI3 A;  1M5Y A;  3CGM A;  3IKG A;  3O5R A;  4ODP A;  4TW6 A;  2KFW A;  4ODR A;  4TX0 A;  2LGO A;  1FKD A;  2VCD A;  3KZ7 A;  2K8I A;  3O5K A;  4FAP A;  1QPL A;  2PV3 A;  1FKF A;  3EY6 A;  3B7X A;  1A7X A;  5D75 A;  4TW8 A;  2M2A A;  5DIV A;  1PBK A;  2RUD A;  1NMW A;  2F4E A;  3KAF A;  2LKN A; 
#chains in the Genus database with same CATH topology
 1FKG A;  3PRA A;  2RUR A;  1NWU A;  1ZK6 A;  3KAB A;  1VF8 A;  3UI6 A;  2DG4 A;  4WJX A;  3RFW A;  2B5U B;  3RM8 A;  3KAD A;  4ITZ A;  1QPF A;  3PA7 A;  3WD3 A;  1E6P A;  2YBU A;  2A3E A;  3OA5 A;  1LL6 A;  4TYO A;  4IQC A;  2PV2 A;  5J6E A;  5HTG A;  3UF8 A;  3O5I A;  2P4V A;  4MNM A;  4IT4 A;  1X6N A;  3IKD A;  1NWT A;  5DIU A;  1LJY A;  4NZC A;  1W9U A;  1E6N A;  3B8S A;  4XAK A;  1ZBV A;  3AS0 A;  4MNL A;  3QOK A;  3ODK A;  3TC5 A;  3PRD A;  3WD2 A;  1FFR A;  3JXV A;  4Z2G A;  3LUO A;  4G50 A;  2WK2 A;  2M1I A;  1ZBW A;  3O5F A;  1T11 A;  4MNK A;  2OLH A;  2F23 A;  1GOI A;  4J4N A;  3B9E A;  3O5O A;  3IK8 A;  5HUA A;  2XP7 A;  2DT0 A;  5HWC A;  4FN2 A;  3O5G A;  4HBE A;  4ODN A;  1FKI A;  1W9V A;  2MPH A;  3O5P A;  1NMV A;  4MPK A;  3BXW A;  3WH0 A;  2ZQS A;  4Q7N A;  3PRB A;  2DT2 A;  1QZ2 A;  1HKK A;  2MLY A;  1K9T A;  2PPP A;  5HW8 A;  3WQV A;  3CH9 A;  1FKT A;  4W9Q A;  3B9D A;  1EHN A;  3UI5 A;  4LAY A;  4U86 A;  1P5Q A;  2DSU A;  1WNO A;  1ZL1 A;  4HAR A;  2ZQU A;  4DRO A;  1D7I A;  3KAI A;  3O5E A;  4DRN A;  1BL4 A;  3KAH A;  4WKA A;  4U84 A;  2XP3 A;  1YAT A;  4R0X A;  3CHF A;  4LGX A;  4C02 B;  1R9H A;  3ARO A;  3IKG A;  4IT6 A;  4TX0 A;  3G6M A;  2K8I A;  2O9O A;  1JCH B;  3CHE A;  1FKF A;  5D75 A;  2M2A A;  1ZU8 A;  1SYT A;  4JFK A;  2F4E A;  1GUV A;  2DSW A;  2LKN A;  4WKH A;  5JH8 A;  4QZV B;  3W4R A;  3RM9 A;  2WLY A;  1LG2 A;  2KGJ A;  2ETN A;  1F8A B;  3ARX A;  3WKZ A;  4NSB A;  3NI6 A;  2ZR5 A;  4PTM A;  4P8X A;  3ARP A;  3FXY A;  1FAP A;  5HWB A;  3GU0 A;  1U79 A;  1LL7 A;  4MGV A;  4GIV A;  1J6Y A;  2N87 A;  5DIT A;  1L1P A;  2DG9 A;  3O5L A;  3CHC A;  1TCO C;  1PIN A;  1EDQ A;  1F40 A;  4DRM A;  4DWS A;  3G6L A;  1KFW A;  1J4I A;  3O5J A;  4IQ2 A;  4QT2 A;  5HKG A;  1FKJ A;  4JFI A;  2XP4 A;  1UR9 A;  3IHZ A;  3WIJ A;  3AS3 A;  3KAC A;  1ZBK A;  3OOB A;  3ALG A;  3H9R B;  1HKI A;  1TFV A;  5DEZ A;  2M08 A;  2F21 A;  4LAW A;  2KE0 A;  2PPN A;  4DWS D;  2G41 A;  3CZ8 A;  4O2T A;  1E44 A;  1E15 A;  4DZ2 A;  2F2D A;  2QF8 A;  3WD0 A;  1KT0 A;  4DRK A;  4DRH A;  3ARU A;  3BMB A;  1D2K A;  1W1Y A;  2WM0 A;  1ZB5 A;  3ALF A;  1HJX A;  1D7H A;  1Q6U A;  5I98 A;  4DIP A;  5DF0 A;  4DRQ A;  2UZ5 A;  4Z2K A;  4UDM A;  4JYS A;  2XP6 A;  1D7J A;  4G2P A;  1C9H A;  4L72 B;  2RUC A;  3FY1 A;  2MLX A;  4Z2J A;  3VAW A;  1XHG A;  4WK9 A;  3O5M A;  4TW6 A;  4ODP A;  4Q22 A;  2A3A A;  1QPL A;  2PV3 A;  4KQZ A;  2RUD A;  1RD6 A;  4IPX A;  4P8V A;  2A3B A;  1FD9 A;  5B8I C;  3TDB A;  4S3K A;  3RME A;  2RSE A;  1JVW A;  1FKS A;  3ARZ A;  3GPK A;  1B6C A;  1EQ3 A;  4DWS B;  3WD1 A;  1UR8 A;  2MF9 A;  4ML4 A;  2B31 A;  2KO7 A;  4R5E A;  2ZQT A;  2MNT A;  2FKE A;  1NWS A;  3ARS A;  1FKL A;  2IF4 A;  3ART A;  4TNS A;  3MDY B;  3UQI A;  1LQ0 A;  4DRJ A;  4DRP A;  3AS1 A;  2DSZ A;  4ZPV R;  4KR0 B;  1KT1 A;  4Z2I A;  4ODK A;  5GPR A;  1ROT A;  4MAV A;  4N19 A;  1ZBC A;  1EYM A;  4W9O A;  3UQB A;  2WLZ A;  2DSV A;  1J4H A;  2XPB A;  3TCZ A;  3UI4 A;  1FKB A;  1LL4 A;  4ZS6 A;  1XRV A;  1Q6I A;  1JNE A;  2L2S A;  3JYM A;  4DH0 A;  1WB0 A;  4JFJ A;  2KR7 A;  2O92 A;  2DG3 A;  4URI A;  1EIB A;  2PN0 A;  3AQU A;  4J4O A;  1FKR A;  3AS2 A;  1GPF A;  4P8W A;  4HBO A;  1FKK A;  2G8Z A;  1HXV A;  3I6C A;  2RQS A;  1FKH A;  2ZR6 A;  3FAP A;  4ODM A;  4ODO A;  1NWR A;  4DRI A;  2MLZ A;  2XP8 A;  2RUQ A;  2PPO A;  1OGG A;  3UQA A;  2Y78 A;  3CHD A;  3RM4 A;  1ZCN A;  1OGB A;  1O6I A;  3O5R A;  4ODR A;  2YBT A;  1W1P A;  3KZ7 A;  3O5K A;  4FAP A;  2EUL A;  3EY6 A;  5DIV A;  3WL1 A;  1PBK A;  1NMW A;  3KAF A;  3RGC A;  1NSG A;  4Z2L A;  4NNR A;  2JZV A;  3ARQ A;  3JYJ A;  1H0G A;  2A3C A;  2ZR4 A;  4JFM A;  1FJD A;  1E9L A;  3ARW A;  1W1V A;  3WD4 A;  4WKF A;  2DPE A;  2LPV A;  1HKJ A;  1Y0O A;  1JNT A;  2LJ4 A;  4Z2H A;  4JFL A;  1D6O A;  2ITK A;  3KCE A;  1W1T A;  2DT3 A;  2XP5 A;  5HT1 A;  1H0I A;  1J4R A;  4BF8 A;  1GRJ A;  5HW6 A;  4MTV A;  2PI6 A;  1SR0 A;  1OWQ A;  2D9F A;  4LAV A;  1JND A;  2VN1 A;  3B9A A;  1N1A A;  1HJW A;  3O5Q A;  2OFN A;  3O5D A;  4ZPW R;  3WQW A;  5GQB A;  4W5U A;  2XP9 A;  3EIP A;  4U85 A;  2PBC A;  1W9P A;  1HJV A;  1CTN A;  4QT3 A;  2AOS A;  1Q1C A;  3NRK A;  2FAP A;  2IUZ A;  2ZQV A;  4L3N A;  2ESC A;  4ODL A;  3NTP A;  4P8U A;  4W9P A;  1Q6H A;  1YW5 A;  1LG1 A;  2DT1 A;  4QIB A;  4AY1 A;  2XPA A;  1WAW A;  2AWG A;  4MSP A;  3ARR A;  3KAG A;  3ARV A;  3WL0 A;  4DWS C;  4GGQ A;  1ITX A;  4DT4 A;  2FDM A;  1E6Z A;  4LAX A;  3PR9 A;  5BXJ A;  1E6R A;  4WIW A;  3ARY A;  4TW7 A;  2PV1 A;  5GPG A;  1JNS A;  2Q5A A;  1HKM A;  3GTY X;  1NH6 A;  1W26 A;  1ROU A;  4DZ3 A;  1BKF A;  3CGN A;  4MNJ A;  4S3J A;  5HW7 A;  2KI3 A;  1M5Y A;  3CGM A;  1FFQ A;  1IX5 A;  4ZPT R;  2KFW A;  1X6L A;  2LGO A;  1FKD A;  2VCD A;  5HBF A;  3B7X A;  1A7X A;  4TW8 A;  5DO2 A;  4ODQ A; 
#chains in the Genus database with same CATH homology
 1FKG A;  3PRA A;  2RUR A;  1NWU A;  1ZK6 A;  3KAB A;  1VF8 A;  3UI6 A;  2DG4 A;  4WJX A;  3RFW A;  3RM8 A;  3KAD A;  4ITZ A;  1QPF A;  3PA7 A;  3WD3 A;  1E6P A;  2YBU A;  2A3E A;  3OA5 A;  1LL6 A;  4TYO A;  4IQC A;  2PV2 A;  5J6E A;  5HTG A;  3UF8 A;  3O5I A;  4MNM A;  4IT4 A;  1X6N A;  3IKD A;  1NWT A;  5DIU A;  1LJY A;  4NZC A;  1W9U A;  1E6N A;  3B8S A;  4XAK A;  1ZBV A;  3AS0 A;  4MNL A;  3QOK A;  3ODK A;  3TC5 A;  3PRD A;  3WD2 A;  1FFR A;  3JXV A;  4Z2G A;  3LUO A;  4G50 A;  2WK2 A;  2M1I A;  1ZBW A;  3O5F A;  1T11 A;  4MNK A;  2OLH A;  4J4N A;  1GOI A;  3B9E A;  3O5O A;  3IK8 A;  5HUA A;  2XP7 A;  2DT0 A;  5HWC A;  4FN2 A;  3O5G A;  4HBE A;  4ODN A;  1FKI A;  1W9V A;  2MPH A;  3O5P A;  1NMV A;  4MPK A;  3BXW A;  3WH0 A;  2ZQS A;  4Q7N A;  3PRB A;  2DT2 A;  1QZ2 A;  1HKK A;  2MLY A;  1K9T A;  2PPP A;  5HW8 A;  3WQV A;  3CH9 A;  1FKT A;  4W9Q A;  3B9D A;  1EHN A;  3UI5 A;  4LAY A;  4U86 A;  1P5Q A;  2DSU A;  1WNO A;  1ZL1 A;  4HAR A;  2ZQU A;  4DRO A;  1D7I A;  3KAI A;  3O5E A;  4DRN A;  1BL4 A;  3KAH A;  4WKA A;  4U84 A;  2XP3 A;  1YAT A;  4R0X A;  3CHF A;  4LGX A;  4C02 B;  1R9H A;  3ARO A;  3IKG A;  4IT6 A;  4TX0 A;  3G6M A;  2K8I A;  2O9O A;  3CHE A;  1FKF A;  5D75 A;  2M2A A;  1ZU8 A;  1SYT A;  4JFK A;  2F4E A;  1GUV A;  2DSW A;  2LKN A;  4WKH A;  5JH8 A;  4QZV B;  3W4R A;  3RM9 A;  2WLY A;  1LG2 A;  2KGJ A;  1F8A B;  3ARX A;  3WKZ A;  4NSB A;  3NI6 A;  2ZR5 A;  4PTM A;  4P8X A;  3ARP A;  3FXY A;  1FAP A;  5HWB A;  1U79 A;  1LL7 A;  4MGV A;  4GIV A;  1J6Y A;  2N87 A;  5DIT A;  1L1P A;  2DG9 A;  3O5L A;  3CHC A;  1TCO C;  1PIN A;  1EDQ A;  1F40 A;  4DRM A;  4DWS A;  3G6L A;  1KFW A;  1J4I A;  3O5J A;  4IQ2 A;  4QT2 A;  5HKG A;  1FKJ A;  4JFI A;  2XP4 A;  1UR9 A;  3IHZ A;  3WIJ A;  3AS3 A;  3KAC A;  1ZBK A;  3OOB A;  3ALG A;  3H9R B;  1HKI A;  1TFV A;  5DEZ A;  2M08 A;  2F21 A;  4LAW A;  2KE0 A;  2PPN A;  4DWS D;  2G41 A;  3CZ8 A;  4O2T A;  1E15 A;  4DZ2 A;  2F2D A;  2QF8 A;  3WD0 A;  1KT0 A;  4DRK A;  4DRH A;  3ARU A;  1D2K A;  1W1Y A;  2WM0 A;  1ZB5 A;  3ALF A;  1HJX A;  1D7H A;  1Q6U A;  5I98 A;  4DIP A;  5DF0 A;  4DRQ A;  2UZ5 A;  4Z2K A;  4JYS A;  2XP6 A;  1D7J A;  4G2P A;  1C9H A;  4L72 B;  2RUC A;  3FY1 A;  2MLX A;  4Z2J A;  3VAW A;  1XHG A;  4WK9 A;  3O5M A;  4TW6 A;  4ODP A;  4Q22 A;  2A3A A;  1QPL A;  2PV3 A;  4KQZ A;  2RUD A;  1RD6 A;  4IPX A;  4P8V A;  2A3B A;  1FD9 A;  5B8I C;  3TDB A;  4S3K A;  3RME A;  2RSE A;  1JVW A;  1FKS A;  3ARZ A;  3GPK A;  1B6C A;  1EQ3 A;  4DWS B;  3WD1 A;  1UR8 A;  2MF9 A;  4ML4 A;  2B31 A;  2KO7 A;  4R5E A;  2ZQT A;  2MNT A;  2FKE A;  1NWS A;  3ARS A;  1FKL A;  2IF4 A;  3ART A;  4TNS A;  3MDY B;  3UQI A;  1LQ0 A;  4DRJ A;  4DRP A;  3AS1 A;  2DSZ A;  4ZPV R;  4KR0 B;  1KT1 A;  4Z2I A;  4ODK A;  5GPR A;  1ROT A;  4MAV A;  4N19 A;  1ZBC A;  1EYM A;  4W9O A;  3UQB A;  2WLZ A;  2DSV A;  1J4H A;  2XPB A;  3TCZ A;  3UI4 A;  1FKB A;  1LL4 A;  4ZS6 A;  1XRV A;  1Q6I A;  1JNE A;  2L2S A;  3JYM A;  4DH0 A;  1WB0 A;  4JFJ A;  2KR7 A;  2O92 A;  2DG3 A;  4URI A;  1EIB A;  3AQU A;  4J4O A;  1FKR A;  3AS2 A;  1GPF A;  4P8W A;  4HBO A;  1FKK A;  2G8Z A;  1HXV A;  3I6C A;  2RQS A;  1FKH A;  2ZR6 A;  3FAP A;  4ODM A;  4ODO A;  1NWR A;  4DRI A;  2MLZ A;  2XP8 A;  2RUQ A;  2PPO A;  1OGG A;  3UQA A;  2Y78 A;  3CHD A;  3RM4 A;  1ZCN A;  1OGB A;  1O6I A;  3O5R A;  4ODR A;  2YBT A;  1W1P A;  3KZ7 A;  3O5K A;  4FAP A;  3EY6 A;  5DIV A;  3WL1 A;  1PBK A;  1NMW A;  3KAF A;  3RGC A;  1NSG A;  4Z2L A;  4NNR A;  2JZV A;  3ARQ A;  3JYJ A;  1H0G A;  2A3C A;  2ZR4 A;  4JFM A;  1FJD A;  1E9L A;  3ARW A;  1W1V A;  3WD4 A;  4WKF A;  2DPE A;  2LPV A;  1HKJ A;  1Y0O A;  1JNT A;  2LJ4 A;  4Z2H A;  4JFL A;  1D6O A;  2ITK A;  3KCE A;  1W1T A;  2DT3 A;  2XP5 A;  5HT1 A;  1H0I A;  1J4R A;  4BF8 A;  5HW6 A;  4MTV A;  2PI6 A;  1SR0 A;  1OWQ A;  2D9F A;  4LAV A;  1JND A;  2VN1 A;  3B9A A;  1N1A A;  1HJW A;  3O5Q A;  2OFN A;  3O5D A;  4ZPW R;  3WQW A;  5GQB A;  4W5U A;  2XP9 A;  4U85 A;  2PBC A;  1W9P A;  1HJV A;  1CTN A;  4QT3 A;  2AOS A;  1Q1C A;  3NRK A;  2FAP A;  2IUZ A;  2ZQV A;  4L3N A;  2ESC A;  4ODL A;  3NTP A;  4P8U A;  4W9P A;  1Q6H A;  1YW5 A;  1LG1 A;  2DT1 A;  4QIB A;  4AY1 A;  2XPA A;  1WAW A;  2AWG A;  4MSP A;  3ARR A;  3KAG A;  3ARV A;  3WL0 A;  4DWS C;  4GGQ A;  1ITX A;  4DT4 A;  2FDM A;  1E6Z A;  4LAX A;  3PR9 A;  5BXJ A;  1E6R A;  4WIW A;  3ARY A;  4TW7 A;  2PV1 A;  5GPG A;  1JNS A;  2Q5A A;  1HKM A;  1NH6 A;  1W26 A;  1ROU A;  4DZ3 A;  1BKF A;  3CGN A;  4MNJ A;  4S3J A;  5HW7 A;  2KI3 A;  1M5Y A;  3CGM A;  1FFQ A;  1IX5 A;  4ZPT R;  2KFW A;  1X6L A;  2LGO A;  1FKD A;  2VCD A;  5HBF A;  3B7X A;  1A7X A;  4TW8 A;  5DO2 A;  4ODQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...