5HTGA

Structure of apo p1 form of candida albicans fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 1
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
total genus 27
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5htgA00
3O5OA 5DITA 5DIUA 2PV2A 1J6YA 2M1IA 2XP5A 2RSEA 2LGOA 4ODPA 4ODLA 4U85A 1J4IA 2AWGA 3O5GA 2KE0A 2RUCA 4DRJA 1NMVA 1Q6IA 4JFIA 2XP8A 4IPXA 2Q5AA 4NNRA 5D75A 1FJDA 2ZR6A 1EYMA 3WH0A 1U79A 2OFNA 2IF4A 3GPKA 3KAIA 4ODNA 3RFWA 2DG3A 2RURA 1QZ2A 2XP7A 3JXVA 4G2PA 2ITKA 2KI3A 2KO7A 2XP3A 4BF8A 2XP6A 3KZ7A 1F8AB 1FKIA 1R9HA 3KAHA 3OOBA 2FAPA 2UZ5A 4ODKA 1TCOC 2FKEA 4TYOA 2ZR4A 3I6CA 3KCEA 4QT2A 4R0XA 3O5IA 2M08A 1FKGA 2PBCA 2XPBA 2DG4A 3KACA 1M5YA 2ZR5A 5HWBA 3UQBA 2RUDA 5B8IC 2PPNA 4FAPA 1KT0A 4JFLA 1N1AA 2VCDA 2ZQTA 3FAPA 1JNSA 1C9HA 1YW5A 2DG9A 2LJ4A 2MLZA 1B6CA 2M2AA 4ODMA 3RGCA 4DROA 4C02B 1QPFA 1EQ3A 4TX0A 5GPGA 2K8IA 1FD9A 3IHZA 2PV1A 1FAPA 1J4RA 3LUOA 3O5QA 4JFMA 1W26A 1Y0OA 2MLXA 5HW6A 1HXVA 5DIVA 1D7HA 1JNTA 3H9RB 5BXJA 1JVWA 2KR7A 2RQSA 1NSGA 1ZCNA 3CGNA 1Q6HA 4IQ2A 3TCZA 5I98A 3IKDA 4U84A 2MPHA 3O5EA 1Q1CA 4FN2A 4TW8A 4DRHA 4DZ3A 2PV3A 4JFKA 2F2DA 1KT1A 4O2TA 1A7XA 4DRPA 1FKBA 2VN1A 1D7JA 2D9FA 1YATA 2XP9A 3NI6A 1ROUA 3PRBA 5HT1A 3UQIA 3KAGA 3O5PA 1D7IA 4TNSA 4ITZA 3PA7A 2Y78A 2ZQUA 4ODQA 4W9QA 4LAWA 3IK8A 5J6EA 3EY6A 3KADA 1T11A 3IKGA 4DRIA 3NRKA 4LAVA 4U86A 5HUAA 1FKDA 4J4NA 1FKFA 2LKNA 3MDYB 4QT3A 3O5KA 5HWCA 3KAFA 3JYJA 1ZK6A 4DZ2A 4TW6A 2XP4A 3NTPA 3O5MA 4JFJA 4MGVA 3TC5A 3UI4A 3VAWA 1FKLA 5HKGA 4DRMA 4J4OA 1J4HA 4JYSA 4ODOA 2LPVA 4DT4A 3JYMA 4QIBA 3TDBA 5HW7A 4MSPA 2MLYA 1F40A 4ODRA 3O5LA 1ROTA 1Q6UA 2L2SA 4GIVA 1FKJA 3PRDA 4N19A 3UI6A 2MF9A 2F21A 1BKFA 1PBKA 3CGMA 2PPOA 4GGQA 1FKKA 1BL4A 1FKHA 1FKTA 3ODKA 4DRKA 3KABA 3O5RA 3O5DA 4W9PA 3B7XA 4DH0A 2N87A 2PPPA 5HTGA 2ZQSA 2XPAA 1P5QA 2JZVA 2F4EA 2KFWA 3O5JA 3O5FA 4G50A 3UF8A 4DRQA 1L1PA 4TW7A 2RUQA 4LAYA 4W9OA 2MNTA 1PINA 1QPLA 4IQCA 2ZQVA 4LAXA 3UQAA 2KGJA 1NMWA 4DIPA 1FKSA 1FKRA 5HW8A 4DRNA 3UI5A 1D6OA
chains in the Genus database with same CATH superfamily
3O5OA 4MPKA 4DWSB 2RSEA 2LGOA 4ZPWR 4JFIA 2XP8A 4IPXA 3RMEA 5D75A 4WKHA 1U79A 3WH0A 3RFWA 3JXVA 2ITKA 2ETNA 4MNJA 1F8AB 3KAHA 1HJWA 4WKFA 4ODKA 2A3CA 3KCEA 4QT2A 2PBCA 4Q22A 2DG4A 1JCHB 4WKAA 4HBOA 1JNDA 3UQBA 1NWRA 4JFLA 2VCDA 3FAPA 1JNSA 3WQVA 1IX5A 1C9HA 4IT4A 2M2AA 1EQ3A 3B9AA 1EIBA 4TX0A 4P8XA 2OLHA 2PV1A 1FAPA 1GPFA 4NZCA 1Y0OA 2MLXA 1LL6A 1SR0A 2YBUA 1JVWA 2RQSA 5I98A 4FN2A 4TW8A 3WIJA 2DSWA 2DSZA 2VN1A 2D9FA 3NI6A 2AOSA 3KAGA 2PI6A 3ARTA 4QZVB 4Z2KA 2ZQUA 4W9QA 5J6EA 3KADA 3NRKA 3PRAA 4LAVA 4U86A 2LKNA 3O5KA 2A3AA 3KAFA 1ZK6A 2XP4A 3GU0A 1FKLA 3CHDA 1W9UA 4J4OA 1J4HA 4QIBA 5HW7A 1ROTA 3ARQA 2L2SA 3ARVA 3PRDA 2B31A 4UDMA 1BL4A 1ZBWA 2N87A 1NWTA 4G50A 2ESCA 4TW7A 2RUQA 4W9OA 2WLZA 3AS3A 1H0GA 4IQCA 4LAXA 3FY1A 1GOIA 5HW8A 4DRNA 3UI5A 2PV2A 3RM8A 2M1IA 3B9EA 2DT3A 4LGXA 2KE0A 4P8WA 1NMVA 1W1YA 1FFRA 1FJDA 4Z2JA 2ZR6A 5HWCA 3GPKA 1NH6A 3CH9A 4ODNA 2XP7A 1QZ2A 4BF8A 2XP3A 2A3EA 3OOBA 2FAPA 4DWSA 2ZR4A 1H0IA 1OGGA 1E44A 1FKGA 1W1TA 3KACA 5HWBA 1ZBCA 1SYTA 2P4VA 1YW5A 3B8SA 2DG9A 1LJYA 2LJ4A 2MLZA 1FD9A 3IHZA 4Z2IA 4XAKA 1J4RA 4MNKA 3WD4A 3O5QA 3ARZA 1W26A 5HW6A 5DIVA 1HKKA 3H9RB 1O6IA 1NSGA 3QOKA 3ARSA 4NSBA 1KT1A 1EDQA 2A3BA 3ARXA 4O2TA 1FKBA 3WD2A 4KR0B 1HKMA 4ITZA 3PA7A 4ODQA 4Z2LA 4LAWA 1CTNA 3AS0A 4W5UA 2FDMA 3MDYB 3PR9A 4TW6A 4MGVA 3O5MA 3UI4A 3AS2A 2LPVA 5DEZA 4DT4A 1EHNA 3AS1A 3TDBA 4P8UA 1Q6UA 5HBFA 4GIVA 4N19A 3AROA 2MF9A 1PBKA 4GGQA 1LQ0A 1FKHA 3ODKA 4ZS6A 1E6NA 3O5RA 3GTYX 5HTGA 2XPAA 1WNOA 3UF8A 1WAWA 4LAYA 3WL1A 1JNEA 1QPLA 2EULA 3ARRA 1W9PA 1FKSA 1XHGA 5DITA 5DIUA 1E6PA 2XP5A 2DSVA 2AWGA 4DRJA 2IUZA 1EYMA 2OFNA 2IF4A 2DG3A 4G2PA 4WK9A 2XP6A 1KFWA 2G8ZA 3KZ7A 1WB0A 1TCOC 2FKEA 2G41A 4R0XA 2M08A 1GUVA 5DF0A 2RUDA 5B8IC 2DSUA 2DPEA 2ZQTA 4Z2GA 4L3NA 1NWSA 1B6CA 3RGCA 4DROA 1ZBVA 2K8IA 4MNLA 3LUOA 1OWQA 4JFMA 1JNTA 2KR7A 2F23A 4ML4A 4S3KA 3WD0A 4IQ2A 3TCZA 1UR8A 4DZ3A 4U84A 2MPHA 3O5EA 4DRHA 4DWSC 2QF8A 2F2DA 1A7XA 2YBTA 4R5EA 2PN0A 1D7JA 1YATA 2XP9A 3PRBA 1D7IA 4TNSA 1LL7A 2Y78A 3RM9A 3IK8A 1T11A 3IKGA 4DRIA 1LG2A 1FFQA 3ARPA 1FKDA 1FKFA 5GQBA 3WD1A 3JYJA 4ZPVR 3NTPA 3VAWA 1ZBKA 3TC5A 5HKGA 3W4RA 4ODOA 3JYMA 4MSPA 2MLYA 4ODRA 3O5LA 1FKJA 3UI6A 4P8VA 4HBEA 1BKFA 1E15A 3CHEA 1FKKA 1FKTA 3BXWA 1LG1A 3B7XA 4Q7NA 2JZVA 2F4EA 2KFWA 3O5JA 2WLYA 4DRQA 1L1PA 2ZQVA 3UQAA 1NMWA 1FKRA 1D2KA 1GRJA 1NWUA 3I6CA 3WD3A 1J6YA 4KQZA 2B5UB 1X6NA 4ODPA 4ODLA 4U85A 1J4IA 3O5GA 2RUCA 1Q6IA 2Q5AA 4NNRA 1TFVA 3KAIA 2RURA 2KI3A 4MNMA 2KO7A 2DT1A 4ZPTR 1R9HA 1FKIA 4MTVA 4HARA 2UZ5A 3WL0A 1E6RA 4TYOA 5JH8A 3O5IA 5DO2A 2XPBA 1M5YA 1W1VA 4MAVA 2ZR5A 1LL4A 4PTMA 2PPNA 4FAPA 1KT0A 1N1AA 4IT6A 4ODMA 4C02B 1QPFA 1UR9A 1VF8A 5GPGA 3WKZA 1HXVA 1D7HA 1W9VA 2WM0A 4URIA 4DWSD 1X6LA 5BXJA 3AQUA 3CGNA 1ZCNA 3EIPA 1Q6HA 3ARWA 3IKDA 2DT0A 1Q1CA 2PV3A 4JFKA 4WJXA 3BMBA 1HJVA 4DRPA 2WK2A 1E6ZA 1ROUA 5HT1A 3RM4A 3UQIA 3O5PA 2O92A 1W1PA 2DT2A 4L72B 1HKJA 3EY6A 3CHCA 1ZB5A 3FXYA 5HUAA 1XRVA 4J4NA 4QT3A 4DZ2A 4JFJA 3B9DA 4DRMA 4JYSA 3ALFA 3OA5A 3G6LA 1ZL1A 1F40A 1RD6A 3CZ8A 1ZU8A 4Z2HA 3CHFA 5GPRA 2F21A 3ARYA 3CGMA 2PPOA 3G6MA 1ITXA 4DRKA 3KABA 3O5DA 4W9PA 4DH0A 2PPPA 2ZQSA 4WIWA 1P5QA 1HKIA 3O5FA 1K9TA 2O9OA 1OGBA 1HJXA 4S3JA 2MNTA 1E9LA 1PINA 3ARUA 2KGJA 4AY1A 3ALGA 4DIPA 3WQWA 1D6OA
chains in the Genus database with same CATH topology
3O5OA 4MPKA 4DWSB 2RSEA 2LGOA 4ZPWR 4JFIA 2XP8A 4IPXA 3RMEA 5D75A 4WKHA 1U79A 3WH0A 3RFWA 3JXVA 2ITKA 4MNJA 1F8AB 3KAHA 1HJWA 4WKFA 4ODKA 2A3CA 3KCEA 4QT2A 2PBCA 4Q22A 2DG4A 4WKAA 4HBOA 1JNDA 3UQBA 1NWRA 4JFLA 2VCDA 3FAPA 1JNSA 3WQVA 1IX5A 1C9HA 4IT4A 2M2AA 1EQ3A 3B9AA 1EIBA 4TX0A 4P8XA 2OLHA 2PV1A 1FAPA 1GPFA 4NZCA 1Y0OA 2MLXA 1LL6A 1SR0A 2YBUA 1JVWA 2RQSA 5I98A 4FN2A 4TW8A 3WIJA 2DSWA 2DSZA 2VN1A 2D9FA 3NI6A 2AOSA 3KAGA 2PI6A 3ARTA 4QZVB 4Z2KA 2ZQUA 4W9QA 5J6EA 3KADA 3NRKA 3PRAA 4LAVA 4U86A 2LKNA 3O5KA 2A3AA 3KAFA 1ZK6A 2XP4A 1FKLA 3CHDA 1W9UA 4J4OA 1J4HA 4QIBA 5HW7A 1ROTA 3ARQA 2L2SA 3ARVA 3PRDA 2B31A 1BL4A 1ZBWA 2N87A 1NWTA 4G50A 2ESCA 4TW7A 2RUQA 4W9OA 2WLZA 3AS3A 1H0GA 4IQCA 4LAXA 3FY1A 1GOIA 5HW8A 4DRNA 3UI5A 2PV2A 3RM8A 2M1IA 3B9EA 2DT3A 4LGXA 2KE0A 4P8WA 1NMVA 1W1YA 1FFRA 1FJDA 4Z2JA 2ZR6A 5HWCA 3GPKA 1NH6A 3CH9A 4ODNA 2XP7A 1QZ2A 4BF8A 2XP3A 2A3EA 3OOBA 2FAPA 4DWSA 2ZR4A 1H0IA 1OGGA 1FKGA 1W1TA 3KACA 5HWBA 1ZBCA 1SYTA 3B8SA 1YW5A 2DG9A 1LJYA 2LJ4A 2MLZA 1FD9A 3IHZA 4Z2IA 4XAKA 1J4RA 4MNKA 3WD4A 3O5QA 3ARZA 1W26A 5HW6A 5DIVA 1HKKA 3H9RB 1O6IA 1NSGA 3QOKA 3ARSA 4NSBA 1KT1A 1EDQA 2A3BA 3ARXA 4O2TA 1FKBA 3WD2A 4KR0B 1HKMA 4ITZA 3PA7A 4ODQA 4Z2LA 4LAWA 1CTNA 3AS0A 4W5UA 2FDMA 3MDYB 3PR9A 4TW6A 4MGVA 3O5MA 3UI4A 3AS2A 2LPVA 5DEZA 4DT4A 1EHNA 3AS1A 3TDBA 4P8UA 1Q6UA 5HBFA 4GIVA 4N19A 3AROA 2MF9A 1PBKA 4GGQA 1LQ0A 1FKHA 3ODKA 4ZS6A 1E6NA 3O5RA 5HTGA 2XPAA 1WNOA 3UF8A 1WAWA 4LAYA 3WL1A 1JNEA 1QPLA 3ARRA 1W9PA 1FKSA 1XHGA 5DITA 5DIUA 1E6PA 2XP5A 2DSVA 2AWGA 4DRJA 2IUZA 1EYMA 2OFNA 2IF4A 2DG3A 4G2PA 4WK9A 2XP6A 1KFWA 2G8ZA 3KZ7A 1WB0A 1TCOC 2FKEA 2G41A 4R0XA 2M08A 1GUVA 5DF0A 2RUDA 5B8IC 2DSUA 2DPEA 2ZQTA 4Z2GA 4L3NA 1NWSA 1B6CA 3RGCA 4DROA 1ZBVA 2K8IA 4MNLA 3LUOA 1OWQA 4JFMA 1JNTA 2KR7A 4ML4A 4S3KA 3WD0A 4IQ2A 3TCZA 1UR8A 4DZ3A 4U84A 2MPHA 3O5EA 4DRHA 4DWSC 2QF8A 2F2DA 1A7XA 2YBTA 4R5EA 1D7JA 1YATA 2XP9A 3PRBA 1D7IA 4TNSA 1LL7A 2Y78A 3RM9A 3IK8A 1T11A 3IKGA 4DRIA 1LG2A 1FFQA 3ARPA 1FKDA 1FKFA 5GQBA 3WD1A 3JYJA 4ZPVR 3NTPA 3VAWA 1ZBKA 3TC5A 5HKGA 3W4RA 4ODOA 3JYMA 4MSPA 2MLYA 4ODRA 3O5LA 1FKJA 3UI6A 4P8VA 4HBEA 1BKFA 1E15A 3CHEA 1FKKA 1FKTA 3BXWA 1LG1A 3B7XA 4Q7NA 2JZVA 2F4EA 2KFWA 3O5JA 2WLYA 4DRQA 1L1PA 2ZQVA 3UQAA 1NMWA 1FKRA 1D2KA 1NWUA 3I6CA 3WD3A 1J6YA 4KQZA 1X6NA 4ODPA 4ODLA 4U85A 1J4IA 3O5GA 2RUCA 1Q6IA 2Q5AA 4NNRA 1TFVA 3KAIA 2RURA 2KI3A 4MNMA 2KO7A 2DT1A 4ZPTR 1R9HA 1FKIA 4MTVA 4HARA 2UZ5A 3WL0A 1E6RA 4TYOA 5JH8A 3O5IA 5DO2A 2XPBA 1M5YA 1W1VA 4MAVA 2ZR5A 1LL4A 4PTMA 2PPNA 4FAPA 1KT0A 1N1AA 4IT6A 4ODMA 4C02B 1QPFA 1UR9A 1VF8A 5GPGA 3WKZA 1HXVA 1D7HA 1W9VA 2WM0A 4URIA 4DWSD 1X6LA 5BXJA 3AQUA 3CGNA 1ZCNA 1Q6HA 3ARWA 3IKDA 2DT0A 1Q1CA 2PV3A 4JFKA 4WJXA 1HJVA 4DRPA 2WK2A 1E6ZA 1ROUA 5HT1A 3RM4A 3UQIA 3O5PA 2O92A 1W1PA 2DT2A 4L72B 1HKJA 3EY6A 3CHCA 1ZB5A 3FXYA 5HUAA 1XRVA 4J4NA 4QT3A 4DZ2A 4JFJA 3B9DA 4DRMA 4JYSA 3ALFA 3OA5A 3G6LA 1ZL1A 1F40A 1RD6A 3CZ8A 1ZU8A 4Z2HA 3CHFA 5GPRA 2F21A 3ARYA 3CGMA 2PPOA 3G6MA 1ITXA 4DRKA 3KABA 3O5DA 4W9PA 4DH0A 2PPPA 2ZQSA 4WIWA 1P5QA 1HKIA 3O5FA 1K9TA 2O9OA 1OGBA 1HJXA 4S3JA 2MNTA 1E9LA 1PINA 3ARUA 2KGJA 4AY1A 3ALGA 4DIPA 3WQWA 1D6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5O A;  5DIT A;  5DIU A;  2PV2 A;  1J6Y A;  2M1I A;  2XP5 A;  2RSE A;  2LGO A;  4ODP A;  4ODL A;  4U85 A;  1J4I A;  2AWG A;  3O5G A;  2KE0 A;  2RUC A;  4DRJ A;  1NMV A;  1Q6I A;  4JFI A;  2XP8 A;  4IPX A;  2Q5A A;  4NNR A;  5D75 A;  1FJD A;  2ZR6 A;  1EYM A;  3WH0 A;  1U79 A;  2OFN A;  2IF4 A;  3GPK A;  3KAI A;  4ODN A;  3RFW A;  2DG3 A;  2RUR A;  1QZ2 A;  2XP7 A;  3JXV A;  4G2P A;  2ITK A;  2KI3 A;  2KO7 A;  2XP3 A;  4BF8 A;  2XP6 A;  3KZ7 A;  1F8A B;  1FKI A;  1R9H A;  3KAH A;  3OOB A;  2FAP A;  2UZ5 A;  4ODK A;  1TCO C;  2FKE A;  4TYO A;  2ZR4 A;  3I6C A;  3KCE A;  4QT2 A;  4R0X A;  3O5I A;  2M08 A;  1FKG A;  2PBC A;  2XPB A;  2DG4 A;  3KAC A;  1M5Y A;  2ZR5 A;  5HWB A;  3UQB A;  2RUD A;  5B8I C;  2PPN A;  4FAP A;  1KT0 A;  4JFL A;  1N1A A;  2VCD A;  2ZQT A;  3FAP A;  1JNS A;  1C9H A;  1YW5 A;  2DG9 A;  2LJ4 A;  2MLZ A;  1B6C A;  2M2A A;  4ODM A;  3RGC A;  4DRO A;  4C02 B;  1QPF A;  1EQ3 A;  4TX0 A;  5GPG A;  2K8I A;  1FD9 A;  3IHZ A;  2PV1 A;  1FAP A;  1J4R A;  3LUO A;  3O5Q A;  4JFM A;  1W26 A;  1Y0O A;  2MLX A;  5HW6 A;  1HXV A;  5DIV A;  1D7H A;  1JNT A;  3H9R B;  5BXJ A;  1JVW A;  2KR7 A;  2RQS A;  1NSG A;  1ZCN A;  3CGN A;  1Q6H A;  4IQ2 A;  3TCZ A;  5I98 A;  3IKD A;  4U84 A;  2MPH A;  3O5E A;  1Q1C A;  4FN2 A;  4TW8 A;  4DRH A;  4DZ3 A;  2PV3 A;  4JFK A;  2F2D A;  1KT1 A;  4O2T A;  1A7X A;  4DRP A;  1FKB A;  2VN1 A;  1D7J A;  2D9F A;  1YAT A;  2XP9 A;  3NI6 A;  1ROU A;  3PRB A;  5HT1 A;  3UQI A;  3KAG A;  3O5P A;  1D7I A;  4TNS A;  4ITZ A;  3PA7 A;  2Y78 A;  2ZQU A;  4ODQ A;  4W9Q A;  4LAW A;  3IK8 A;  5J6E A;  3EY6 A;  3KAD A;  1T11 A;  3IKG A;  4DRI A;  3NRK A;  4LAV A;  4U86 A;  5HUA A;  1FKD A;  4J4N A;  1FKF A;  2LKN A;  3MDY B;  4QT3 A;  3O5K A;  5HWC A;  3KAF A;  3JYJ A;  1ZK6 A;  4DZ2 A;  4TW6 A;  2XP4 A;  3NTP A;  3O5M A;  4JFJ A;  4MGV A;  3TC5 A;  3UI4 A;  3VAW A;  1FKL A;  5HKG A;  4DRM A;  4J4O A;  1J4H A;  4JYS A;  4ODO A;  2LPV A;  4DT4 A;  3JYM A;  4QIB A;  3TDB A;  5HW7 A;  4MSP A;  2MLY A;  1F40 A;  4ODR A;  3O5L A;  1ROT A;  1Q6U A;  2L2S A;  4GIV A;  1FKJ A;  3PRD A;  4N19 A;  3UI6 A;  2MF9 A;  2F21 A;  1BKF A;  1PBK A;  3CGM A;  2PPO A;  4GGQ A;  1FKK A;  1BL4 A;  1FKH A;  1FKT A;  3ODK A;  4DRK A;  3KAB A;  3O5R A;  3O5D A;  4W9P A;  3B7X A;  4DH0 A;  2N87 A;  2PPP A;  5HTG A;  2ZQS A;  2XPA A;  1P5Q A;  2JZV A;  2F4E A;  2KFW A;  3O5J A;  3O5F A;  4G50 A;  3UF8 A;  4DRQ A;  1L1P A;  4TW7 A;  2RUQ A;  4LAY A;  4W9O A;  2MNT A;  1PIN A;  1QPL A;  4IQC A;  2ZQV A;  4LAX A;  3UQA A;  2KGJ A;  1NMW A;  4DIP A;  1FKS A;  1FKR A;  5HW8 A;  4DRN A;  3UI5 A;  1D6O A; 
#chains in the Genus database with same CATH topology
 3O5O A;  4MPK A;  4DWS B;  2RSE A;  2LGO A;  4ZPW R;  4JFI A;  2XP8 A;  4IPX A;  3RME A;  5D75 A;  4WKH A;  1U79 A;  3WH0 A;  3RFW A;  3JXV A;  2ITK A;  2ETN A;  4MNJ A;  1F8A B;  3KAH A;  1HJW A;  4WKF A;  4ODK A;  2A3C A;  3KCE A;  4QT2 A;  2PBC A;  4Q22 A;  2DG4 A;  1JCH B;  4WKA A;  4HBO A;  1JND A;  3UQB A;  1NWR A;  4JFL A;  2VCD A;  3FAP A;  1JNS A;  3WQV A;  1IX5 A;  1C9H A;  4IT4 A;  2M2A A;  1EQ3 A;  3B9A A;  1EIB A;  4TX0 A;  4P8X A;  2OLH A;  2PV1 A;  1FAP A;  1GPF A;  4NZC A;  1Y0O A;  2MLX A;  1LL6 A;  1SR0 A;  2YBU A;  1JVW A;  2RQS A;  5I98 A;  4FN2 A;  4TW8 A;  3WIJ A;  2DSW A;  2DSZ A;  2VN1 A;  2D9F A;  3NI6 A;  2AOS A;  3KAG A;  2PI6 A;  3ART A;  4QZV B;  4Z2K A;  2ZQU A;  4W9Q A;  5J6E A;  3KAD A;  3NRK A;  3PRA A;  4LAV A;  4U86 A;  2LKN A;  3O5K A;  2A3A A;  3KAF A;  1ZK6 A;  2XP4 A;  3GU0 A;  1FKL A;  3CHD A;  1W9U A;  4J4O A;  1J4H A;  4QIB A;  5HW7 A;  1ROT A;  3ARQ A;  2L2S A;  3ARV A;  3PRD A;  2B31 A;  4UDM A;  1BL4 A;  1ZBW A;  2N87 A;  1NWT A;  4G50 A;  2ESC A;  4TW7 A;  2RUQ A;  4W9O A;  2WLZ A;  3AS3 A;  1H0G A;  4IQC A;  4LAX A;  3FY1 A;  1GOI A;  5HW8 A;  4DRN A;  3UI5 A;  2PV2 A;  3RM8 A;  2M1I A;  3B9E A;  2DT3 A;  4LGX A;  2KE0 A;  4P8W A;  1NMV A;  1W1Y A;  1FFR A;  1FJD A;  4Z2J A;  2ZR6 A;  5HWC A;  3GPK A;  1NH6 A;  3CH9 A;  4ODN A;  2XP7 A;  1QZ2 A;  4BF8 A;  2XP3 A;  2A3E A;  3OOB A;  2FAP A;  4DWS A;  2ZR4 A;  1H0I A;  1OGG A;  1E44 A;  1FKG A;  1W1T A;  3KAC A;  5HWB A;  1ZBC A;  1SYT A;  2P4V A;  1YW5 A;  3B8S A;  2DG9 A;  1LJY A;  2LJ4 A;  2MLZ A;  1FD9 A;  3IHZ A;  4Z2I A;  4XAK A;  1J4R A;  4MNK A;  3WD4 A;  3O5Q A;  3ARZ A;  1W26 A;  5HW6 A;  5DIV A;  1HKK A;  3H9R B;  1O6I A;  1NSG A;  3QOK A;  3ARS A;  4NSB A;  1KT1 A;  1EDQ A;  2A3B A;  3ARX A;  4O2T A;  1FKB A;  3WD2 A;  4KR0 B;  1HKM A;  4ITZ A;  3PA7 A;  4ODQ A;  4Z2L A;  4LAW A;  1CTN A;  3AS0 A;  4W5U A;  2FDM A;  3MDY B;  3PR9 A;  4TW6 A;  4MGV A;  3O5M A;  3UI4 A;  3AS2 A;  2LPV A;  5DEZ A;  4DT4 A;  1EHN A;  3AS1 A;  3TDB A;  4P8U A;  1Q6U A;  5HBF A;  4GIV A;  4N19 A;  3ARO A;  2MF9 A;  1PBK A;  4GGQ A;  1LQ0 A;  1FKH A;  3ODK A;  4ZS6 A;  1E6N A;  3O5R A;  3GTY X;  5HTG A;  2XPA A;  1WNO A;  3UF8 A;  1WAW A;  4LAY A;  3WL1 A;  1JNE A;  1QPL A;  2EUL A;  3ARR A;  1W9P A;  1FKS A;  1XHG A;  5DIT A;  5DIU A;  1E6P A;  2XP5 A;  2DSV A;  2AWG A;  4DRJ A;  2IUZ A;  1EYM A;  2OFN A;  2IF4 A;  2DG3 A;  4G2P A;  4WK9 A;  2XP6 A;  1KFW A;  2G8Z A;  3KZ7 A;  1WB0 A;  1TCO C;  2FKE A;  2G41 A;  4R0X A;  2M08 A;  1GUV A;  5DF0 A;  2RUD A;  5B8I C;  2DSU A;  2DPE A;  2ZQT A;  4Z2G A;  4L3N A;  1NWS A;  1B6C A;  3RGC A;  4DRO A;  1ZBV A;  2K8I A;  4MNL A;  3LUO A;  1OWQ A;  4JFM A;  1JNT A;  2KR7 A;  2F23 A;  4ML4 A;  4S3K A;  3WD0 A;  4IQ2 A;  3TCZ A;  1UR8 A;  4DZ3 A;  4U84 A;  2MPH A;  3O5E A;  4DRH A;  4DWS C;  2QF8 A;  2F2D A;  1A7X A;  2YBT A;  4R5E A;  2PN0 A;  1D7J A;  1YAT A;  2XP9 A;  3PRB A;  1D7I A;  4TNS A;  1LL7 A;  2Y78 A;  3RM9 A;  3IK8 A;  1T11 A;  3IKG A;  4DRI A;  1LG2 A;  1FFQ A;  3ARP A;  1FKD A;  1FKF A;  5GQB A;  3WD1 A;  3JYJ A;  4ZPV R;  3NTP A;  3VAW A;  1ZBK A;  3TC5 A;  5HKG A;  3W4R A;  4ODO A;  3JYM A;  4MSP A;  2MLY A;  4ODR A;  3O5L A;  1FKJ A;  3UI6 A;  4P8V A;  4HBE A;  1BKF A;  1E15 A;  3CHE A;  1FKK A;  1FKT A;  3BXW A;  1LG1 A;  3B7X A;  4Q7N A;  2JZV A;  2F4E A;  2KFW A;  3O5J A;  2WLY A;  4DRQ A;  1L1P A;  2ZQV A;  3UQA A;  1NMW A;  1FKR A;  1D2K A;  1GRJ A;  1NWU A;  3I6C A;  3WD3 A;  1J6Y A;  4KQZ A;  2B5U B;  1X6N A;  4ODP A;  4ODL A;  4U85 A;  1J4I A;  3O5G A;  2RUC A;  1Q6I A;  2Q5A A;  4NNR A;  1TFV A;  3KAI A;  2RUR A;  2KI3 A;  4MNM A;  2KO7 A;  2DT1 A;  4ZPT R;  1R9H A;  1FKI A;  4MTV A;  4HAR A;  2UZ5 A;  3WL0 A;  1E6R A;  4TYO A;  5JH8 A;  3O5I A;  5DO2 A;  2XPB A;  1M5Y A;  1W1V A;  4MAV A;  2ZR5 A;  1LL4 A;  4PTM A;  2PPN A;  4FAP A;  1KT0 A;  1N1A A;  4IT6 A;  4ODM A;  4C02 B;  1QPF A;  1UR9 A;  1VF8 A;  5GPG A;  3WKZ A;  1HXV A;  1D7H A;  1W9V A;  2WM0 A;  4URI A;  4DWS D;  1X6L A;  5BXJ A;  3AQU A;  3CGN A;  1ZCN A;  3EIP A;  1Q6H A;  3ARW A;  3IKD A;  2DT0 A;  1Q1C A;  2PV3 A;  4JFK A;  4WJX A;  3BMB A;  1HJV A;  4DRP A;  2WK2 A;  1E6Z A;  1ROU A;  5HT1 A;  3RM4 A;  3UQI A;  3O5P A;  2O92 A;  1W1P A;  2DT2 A;  4L72 B;  1HKJ A;  3EY6 A;  3CHC A;  1ZB5 A;  3FXY A;  5HUA A;  1XRV A;  4J4N A;  4QT3 A;  4DZ2 A;  4JFJ A;  3B9D A;  4DRM A;  4JYS A;  3ALF A;  3OA5 A;  3G6L A;  1ZL1 A;  1F40 A;  1RD6 A;  3CZ8 A;  1ZU8 A;  4Z2H A;  3CHF A;  5GPR A;  2F21 A;  3ARY A;  3CGM A;  2PPO A;  3G6M A;  1ITX A;  4DRK A;  3KAB A;  3O5D A;  4W9P A;  4DH0 A;  2PPP A;  2ZQS A;  4WIW A;  1P5Q A;  1HKI A;  3O5F A;  1K9T A;  2O9O A;  1OGB A;  1HJX A;  4S3J A;  2MNT A;  1E9L A;  1PIN A;  3ARU A;  2KGJ A;  4AY1 A;  3ALG A;  4DIP A;  3WQW A;  1D6O A; 
#chains in the Genus database with same CATH homology
 3O5O A;  4MPK A;  4DWS B;  2RSE A;  2LGO A;  4ZPW R;  4JFI A;  2XP8 A;  4IPX A;  3RME A;  5D75 A;  4WKH A;  1U79 A;  3WH0 A;  3RFW A;  3JXV A;  2ITK A;  4MNJ A;  1F8A B;  3KAH A;  1HJW A;  4WKF A;  4ODK A;  2A3C A;  3KCE A;  4QT2 A;  2PBC A;  4Q22 A;  2DG4 A;  4WKA A;  4HBO A;  1JND A;  3UQB A;  1NWR A;  4JFL A;  2VCD A;  3FAP A;  1JNS A;  3WQV A;  1IX5 A;  1C9H A;  4IT4 A;  2M2A A;  1EQ3 A;  3B9A A;  1EIB A;  4TX0 A;  4P8X A;  2OLH A;  2PV1 A;  1FAP A;  1GPF A;  4NZC A;  1Y0O A;  2MLX A;  1LL6 A;  1SR0 A;  2YBU A;  1JVW A;  2RQS A;  5I98 A;  4FN2 A;  4TW8 A;  3WIJ A;  2DSW A;  2DSZ A;  2VN1 A;  2D9F A;  3NI6 A;  2AOS A;  3KAG A;  2PI6 A;  3ART A;  4QZV B;  4Z2K A;  2ZQU A;  4W9Q A;  5J6E A;  3KAD A;  3NRK A;  3PRA A;  4LAV A;  4U86 A;  2LKN A;  3O5K A;  2A3A A;  3KAF A;  1ZK6 A;  2XP4 A;  1FKL A;  3CHD A;  1W9U A;  4J4O A;  1J4H A;  4QIB A;  5HW7 A;  1ROT A;  3ARQ A;  2L2S A;  3ARV A;  3PRD A;  2B31 A;  1BL4 A;  1ZBW A;  2N87 A;  1NWT A;  4G50 A;  2ESC A;  4TW7 A;  2RUQ A;  4W9O A;  2WLZ A;  3AS3 A;  1H0G A;  4IQC A;  4LAX A;  3FY1 A;  1GOI A;  5HW8 A;  4DRN A;  3UI5 A;  2PV2 A;  3RM8 A;  2M1I A;  3B9E A;  2DT3 A;  4LGX A;  2KE0 A;  4P8W A;  1NMV A;  1W1Y A;  1FFR A;  1FJD A;  4Z2J A;  2ZR6 A;  5HWC A;  3GPK A;  1NH6 A;  3CH9 A;  4ODN A;  2XP7 A;  1QZ2 A;  4BF8 A;  2XP3 A;  2A3E A;  3OOB A;  2FAP A;  4DWS A;  2ZR4 A;  1H0I A;  1OGG A;  1FKG A;  1W1T A;  3KAC A;  5HWB A;  1ZBC A;  1SYT A;  3B8S A;  1YW5 A;  2DG9 A;  1LJY A;  2LJ4 A;  2MLZ A;  1FD9 A;  3IHZ A;  4Z2I A;  4XAK A;  1J4R A;  4MNK A;  3WD4 A;  3O5Q A;  3ARZ A;  1W26 A;  5HW6 A;  5DIV A;  1HKK A;  3H9R B;  1O6I A;  1NSG A;  3QOK A;  3ARS A;  4NSB A;  1KT1 A;  1EDQ A;  2A3B A;  3ARX A;  4O2T A;  1FKB A;  3WD2 A;  4KR0 B;  1HKM A;  4ITZ A;  3PA7 A;  4ODQ A;  4Z2L A;  4LAW A;  1CTN A;  3AS0 A;  4W5U A;  2FDM A;  3MDY B;  3PR9 A;  4TW6 A;  4MGV A;  3O5M A;  3UI4 A;  3AS2 A;  2LPV A;  5DEZ A;  4DT4 A;  1EHN A;  3AS1 A;  3TDB A;  4P8U A;  1Q6U A;  5HBF A;  4GIV A;  4N19 A;  3ARO A;  2MF9 A;  1PBK A;  4GGQ A;  1LQ0 A;  1FKH A;  3ODK A;  4ZS6 A;  1E6N A;  3O5R A;  5HTG A;  2XPA A;  1WNO A;  3UF8 A;  1WAW A;  4LAY A;  3WL1 A;  1JNE A;  1QPL A;  3ARR A;  1W9P A;  1FKS A;  1XHG A;  5DIT A;  5DIU A;  1E6P A;  2XP5 A;  2DSV A;  2AWG A;  4DRJ A;  2IUZ A;  1EYM A;  2OFN A;  2IF4 A;  2DG3 A;  4G2P A;  4WK9 A;  2XP6 A;  1KFW A;  2G8Z A;  3KZ7 A;  1WB0 A;  1TCO C;  2FKE A;  2G41 A;  4R0X A;  2M08 A;  1GUV A;  5DF0 A;  2RUD A;  5B8I C;  2DSU A;  2DPE A;  2ZQT A;  4Z2G A;  4L3N A;  1NWS A;  1B6C A;  3RGC A;  4DRO A;  1ZBV A;  2K8I A;  4MNL A;  3LUO A;  1OWQ A;  4JFM A;  1JNT A;  2KR7 A;  4ML4 A;  4S3K A;  3WD0 A;  4IQ2 A;  3TCZ A;  1UR8 A;  4DZ3 A;  4U84 A;  2MPH A;  3O5E A;  4DRH A;  4DWS C;  2QF8 A;  2F2D A;  1A7X A;  2YBT A;  4R5E A;  1D7J A;  1YAT A;  2XP9 A;  3PRB A;  1D7I A;  4TNS A;  1LL7 A;  2Y78 A;  3RM9 A;  3IK8 A;  1T11 A;  3IKG A;  4DRI A;  1LG2 A;  1FFQ A;  3ARP A;  1FKD A;  1FKF A;  5GQB A;  3WD1 A;  3JYJ A;  4ZPV R;  3NTP A;  3VAW A;  1ZBK A;  3TC5 A;  5HKG A;  3W4R A;  4ODO A;  3JYM A;  4MSP A;  2MLY A;  4ODR A;  3O5L A;  1FKJ A;  3UI6 A;  4P8V A;  4HBE A;  1BKF A;  1E15 A;  3CHE A;  1FKK A;  1FKT A;  3BXW A;  1LG1 A;  3B7X A;  4Q7N A;  2JZV A;  2F4E A;  2KFW A;  3O5J A;  2WLY A;  4DRQ A;  1L1P A;  2ZQV A;  3UQA A;  1NMW A;  1FKR A;  1D2K A;  1NWU A;  3I6C A;  3WD3 A;  1J6Y A;  4KQZ A;  1X6N A;  4ODP A;  4ODL A;  4U85 A;  1J4I A;  3O5G A;  2RUC A;  1Q6I A;  2Q5A A;  4NNR A;  1TFV A;  3KAI A;  2RUR A;  2KI3 A;  4MNM A;  2KO7 A;  2DT1 A;  4ZPT R;  1R9H A;  1FKI A;  4MTV A;  4HAR A;  2UZ5 A;  3WL0 A;  1E6R A;  4TYO A;  5JH8 A;  3O5I A;  5DO2 A;  2XPB A;  1M5Y A;  1W1V A;  4MAV A;  2ZR5 A;  1LL4 A;  4PTM A;  2PPN A;  4FAP A;  1KT0 A;  1N1A A;  4IT6 A;  4ODM A;  4C02 B;  1QPF A;  1UR9 A;  1VF8 A;  5GPG A;  3WKZ A;  1HXV A;  1D7H A;  1W9V A;  2WM0 A;  4URI A;  4DWS D;  1X6L A;  5BXJ A;  3AQU A;  3CGN A;  1ZCN A;  1Q6H A;  3ARW A;  3IKD A;  2DT0 A;  1Q1C A;  2PV3 A;  4JFK A;  4WJX A;  1HJV A;  4DRP A;  2WK2 A;  1E6Z A;  1ROU A;  5HT1 A;  3RM4 A;  3UQI A;  3O5P A;  2O92 A;  1W1P A;  2DT2 A;  4L72 B;  1HKJ A;  3EY6 A;  3CHC A;  1ZB5 A;  3FXY A;  5HUA A;  1XRV A;  4J4N A;  4QT3 A;  4DZ2 A;  4JFJ A;  3B9D A;  4DRM A;  4JYS A;  3ALF A;  3OA5 A;  3G6L A;  1ZL1 A;  1F40 A;  1RD6 A;  3CZ8 A;  1ZU8 A;  4Z2H A;  3CHF A;  5GPR A;  2F21 A;  3ARY A;  3CGM A;  2PPO A;  3G6M A;  1ITX A;  4DRK A;  3KAB A;  3O5D A;  4W9P A;  4DH0 A;  2PPP A;  2ZQS A;  4WIW A;  1P5Q A;  1HKI A;  3O5F A;  1K9T A;  2O9O A;  1OGB A;  1HJX A;  4S3J A;  2MNT A;  1E9L A;  1PIN A;  3ARU A;  2KGJ A;  4AY1 A;  3ALG A;  4DIP A;  3WQW A;  1D6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...