5HTGA

Structure of apo p1 form of candida albicans fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
122
structure length
122
Chain Sequence
EELPQIEIVQEGDNTTFAKPGDTVTIHYDGKLTNGKEFDSSRKRGKPFTCTVGVGQVIKGWDISLTNNYGKGGANLPKISKGTKAILTIPPNLAYGPRGIPPIIGPNETLVFEVELLGVNGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
pubmed doi rcsb
source organism Candida albicans (strain sc5314 / atcc mya-2876)
molecule tags Isomerase
molecule keywords FK506-binding protein 1
total genus 27
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2016-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5htgA00
4U85A 4TYOA 1FKIA 3O5RA 5J6EA 4DT4A 2FKEA 1NMVA 2OFNA 3KAGA 2XPBA 1F8AB 1KT1A 1FKSA 2FAPA 1C9HA 2RUDA 4ODRA 2XP8A 4ODQA 2MF9A 2LJ4A 2AWGA 4TW6A 5GPGA 2ZQTA 3O5QA 4ITZA 3PRBA 1FKTA 4GIVA 4ODKA 4J4NA 3NTPA 3IKDA 3KADA 4W9QA 2DG3A 3KZ7A 2VN1A 4ODLA 2UZ5A 4LAWA 4FAPA 3O5EA 3IK8A 3MDYB 2PV2A 2LPVA 4J4OA 2VCDA 1L1PA 1EYMA 3JYMA 4TX0A 4DRHA 2XP4A 1NMWA 4DRPA 3KAHA 5HWCA 1ROTA 1KT0A 2DG4A 1J4RA 2K8IA 3RFWA 4DZ2A 4QIBA 1FKKA 1PBKA 2XP5A 3JXVA 3PRDA 2KO7A 4IQ2A 1N1AA 1EQ3A 5DITA 1BKFA 5DIUA 2LGOA 3FAPA 3O5IA 4LAXA 4IPXA 5DIVA 4U86A 1T11A 5HT1A 2ZR6A 1Q6UA 4U84A 5B8IC 3IHZA 1P5QA 1Q6HA 1QZ2A 4MSPA 2XP3A 3IKGA 2ZQUA 1J4HA 3O5LA 1FKFA 2MPHA 4W9OA 1FKHA 1YW5A 2M1IA 4JFKA 2RSEA 2ZQVA 4JFLA 1FKRA 5HW6A 3GPKA 3O5FA 3KCEA 2PPPA 3TCZA 1J4IA 3UF8A 2MLYA 3EY6A 4N19A 3RGCA 1U79A 4DRMA 1B6CA 2F2DA 1D7JA 1R9HA 4G2PA 1Q6IA 1FKJA 2XP6A 3H9RB 3O5MA 4MGVA 5HTGA 2Y78A 3PA7A 4ODMA 5D75A 2F21A 4ODNA 2PPOA 2DG9A 2KI3A 4JYSA 3B7XA 4BF8A 4W9PA 4DH0A 5BXJA 4GGQA 4ODOA 4DIPA 1QPLA 5HWBA 1ROUA 1NSGA 2D9FA 4G50A 5I98A 1M5YA 1FJDA 1JNTA 3UQAA 3UI4A 4IQCA 4C02B 4DRJA 5HW7A 2RQSA 1BL4A 2L2SA 4DRKA 2KGJA 4QT3A 2N87A 4TW7A 1ZCNA 1TCOC 4DRNA 1YATA 4QT2A 3O5DA 4DROA 2MLZA 2F4EA 2ZQSA 3O5OA 4DRIA 1J6YA 2XPAA 2LKNA 4DRQA 2M08A 4R0XA 2PV1A 3TDBA 2M2AA 5HUAA 1FKLA 1Y0OA 2MLXA 4NNRA 3UQIA 1A7XA 3VAWA 3WH0A 3KAIA 2PBCA 3OOBA 4JFIA 3O5KA 5HKGA 1D7HA 2ITKA 1D7IA 3NI6A 1PINA 3O5JA 3KABA 3O5GA 3ODKA 3KAFA 1JVWA 3I6CA 3LUOA 3JYJA 4O2TA 4TNSA 1HXVA 3TC5A 1QPFA 4JFMA 2MNTA 1ZK6A 4LAVA 4LAYA 3NRKA 2PV3A 4DZ3A 4JFJA 3O5PA 4ODPA 3UQBA 2XP7A 1FKBA 5HW8A 1JNSA 2IF4A 1Q1CA 1FD9A 2RUCA 2XP9A 2ZR5A 3KACA 2RURA 1W26A 2JZVA 2KFWA 1FAPA 2PPNA 2Q5AA 2RUQA 1FKDA 1FKGA 2ZR4A 3UI6A 1D6OA 3UI5A 2KR7A 4TW8A 3CGNA 1F40A 4FN2A 3CGMA 2KE0A
chains in the Genus database with same CATH superfamily
3AS0A 4U85A 3WD4A 4TYOA 1FKIA 3O5RA 4HBOA 2FKEA 1TFVA 1F8AB 1FKSA 2XP8A 4IT4A 2AWGA 3AS2A 3WD0A 1EIBA 2G8ZA 2YBUA 1ZU8A 2UZ5A 4FAPA 1WB0A 3IK8A 3MDYB 2PV2A 1LL7A 2LPVA 1E44A 4AY1A 2VCDA 3CHEA 1EYMA 3JYMA 1L1PA 2XP4A 2DSZA 5HWCA 2B31A 1H0GA 1CTNA 2EULA 2O92A 1NWUA 3G6LA 3FAPA 3O5IA 3WL0A 4U86A 1T11A 3ARYA 2ZR6A 4U84A 1Q6HA 4HBEA 4S3JA 3ARUA 1FKFA 1FKHA 2M1IA 4JFKA 3GPKA 3B9EA 3KCEA 2PPPA 3TCZA 3UF8A 1U79A 1B6CA 2F2DA 1E6PA 1GRJA 4QZVB 4Z2GA 3PA7A 4ODMA 2F21A 2PPOA 1ZBWA 2DT3A 4DH0A 4URIA 4DWSA 4DWSB 4WK9A 2D9FA 5I98A 1HJVA 3UI4A 4IQCA 4DRJA 2YBTA 2RQSA 1IX5A 1NH6A 4TW7A 4DRNA 2G41A 4QT2A 1HJXA 2ZQSA 4DRIA 4Z2KA 2LKNA 4DRQA 3ARVA 1LL6A 1Y0OA 3VAWA 1XRVA 4MTVA 1UR9A 2PBCA 3OOBA 3O5KA 4JFIA 5HKGA 3O5JA 3KABA 4Z2LA 3KAFA 3I6CA 4Z2IA 1LG2A 4TNSA 5DO2A 2XP7A 3FXYA 1FKBA 5HW8A 1H0IA 5B8IC 2XP9A 4ODOA 2RURA 1W26A 1EQ3A 2Q5AA 1KFWA 2PPNA 3UI6A 1E15A 1D6OA 1K9TA 4Q22A 2KE0A 2ESCA 3AS3A 5DEZA 2OFNA 3KAGA 4P8WA 4Q7NA 3G6MA 5HBFA 4ODQA 4ODRA 2MF9A 2LJ4A 4TW6A 3O5QA 3KADA 1VF8A 3KZ7A 4LAWA 4UDMA 3O5EA 1NWRA 4J4OA 3WL1A 4L3NA 4DRPA 1W9PA 1ROTA 2DG4A 3OA5A 3RFWA 4DZ2A 1FKKA 1PBKA 3B9DA 3JXVA 5DIUA 1ITXA 1E6RA 1HKMA 1QZ2A 4MSPA 2XP3A 3EIPA 2ZQUA 1J4HA 3WD2A 1X6NA 3CHDA 2A3CA 4JFLA 1FKRA 3O5FA 3CH9A 1NWSA 1J4IA 2MLYA 3EY6A 4DRMA 1W1YA 4WJXA 3RM4A 1Q6IA 2XP6A 3ARTA 4MGVA 2O9OA 5D75A 2DSUA 2FDMA 2DG9A 2KI3A 4JYSA 3B7XA 4BF8A 1HKJA 3AROA 1HKIA 1E6ZA 1QPLA 2WLYA 4DIPA 4NZCA 2B5UB 4KQZA 5HWBA 1ROUA 1FJDA 1JNTA 3WQWA 1W1VA 2OLHA 1BL4A 2KGJA 4Z2JA 2N87A 1LJYA 1ZCNA 1TCOC 4DROA 5JH8A 1OGGA 2XPAA 4R0XA 2M2AA 1FKLA 1A7XA 3WD1A 3KAIA 3ARQA 3O5GA 1ZB5A 2DT0A 4P8XA 3CHFA 1JVWA 1E6NA 3LUOA 4O2TA 2MNTA 4DWSC 3NRKA 4JFJA 3ARXA 4HARA 1ZBCA 1JNSA 1FD9A 2RUCA 2ZR4A 2DSWA 2RUQA 2KFWA 2DT2A 1FKDA 3CGNA 1NMVA 3WIJA 3WQVA 3GU0A 4WKHA 4DT4A 1ZL1A 2XPBA 1FFRA 2F23A 4ZS6A 4DWSD 1C9HA 3B8SA 2DT1A 2ZQTA 4GIVA 4ODKA 4R5EA 3NTPA 3IKDA 2DG3A 2VN1A 4ODLA 1LL4A 4WKFA 4DRHA 4L72B 1NMWA 3KAHA 4ZPVR 1KT0A 1J4RA 2K8IA 2PN0A 5GQBA 2QF8A 2KO7A 1N1AA 3RM9A 2DPEA 5DITA 1W9VA 4LAXA 4IPXA 5HT1A 1Q6UA 3IHZA 3CHCA 4P8VA 1LG1A 1W1TA 1HJWA 3B9AA 4PTMA 1ZBVA 3O5LA 3ALFA 4W9OA 1YW5A 1WAWA 3BXWA 5HW6A 3RMEA 1XHGA 3AQUA 1D7JA 1R9HA 4G2PA 1HKKA 3H9RB 5HTGA 2WK2A 1WNOA 4XAKA 2WLZA 3PRAA 5BXJA 4GGQA 4WIWA 5GPRA 1D2KA 4Z2HA 3ARZA 1M5YA 3UQAA 1EHNA 5HW7A 4NSBA 1E9LA 1SYTA 1JCHB 4QT3A 2WM0A 3O5DA 2MLZA 2F4EA 1W1PA 3O5OA 2M08A 3TDBA 2PV1A 4S3KA 5HUAA 4KR0B 3ARRA 4ZPTR 1X6LA 1D7HA 2ITKA 2IUZA 1PINA 1ZBKA 3WKZA 3JYJA 2ETNA 1EDQA 1NWTA 4JFMA 4LAYA 1JNEA 4LAVA 4WKAA 3O5PA 1GPFA 3UQBA 3AS1A 2IF4A 1Q1CA 3KACA 2P4VA 1FAPA 1FKGA 2KR7A 3CGMA 5J6EA 3ARWA 2A3EA 1KT1A 2FAPA 2RUDA 5GPGA 1O6IA 1OGBA 3PRBA 1FKTA 4MPKA 4J4NA 4W9QA 4ZPWR 3CZ8A 4LGXA 4TX0A 1W9UA 4MNKA 4QIBA 2XP5A 3PRDA 4IQ2A 1OWQA 1BKFA 2LGOA 5DIVA 4W5UA 2A3AA 1P5QA 3WD3A 3GTYX 3BMBA 3QOKA 4ML4A 3IKGA 1FFQA 3FY1A 2MPHA 3RM8A 2RSEA 2ZQVA 3ALGA 5DF0A 3ARSA 3RGCA 4N19A 2A3BA 1FKJA 4IT6A 1RD6A 3O5MA 2Y78A 4ODNA 1GOIA 4MNMA 1GUVA 2AOSA 4MNLA 1NSGA 4G50A 4P8UA 4C02B 4DRKA 2L2SA 1YATA 1J6YA 2DSVA 1JNDA 4NNRA 2MLXA 3UQIA 3WH0A 3PR9A 3ARPA 1UR8A 3NI6A 1D7IA 4MAVA 3ODKA 3W4RA 1HXVA 3TC5A 1QPFA 1ZK6A 2PI6A 2PV3A 4DZ3A 4ODPA 1SR0A 1LQ0A 2ZR5A 4ITZA 2JZVA 4MNJA 3UI5A 4TW8A 1F40A 4FN2A 4W9PA
chains in the Genus database with same CATH topology
3AS0A 4U85A 3WD4A 4TYOA 1FKIA 3O5RA 4HBOA 2FKEA 1TFVA 1F8AB 1FKSA 2XP8A 4IT4A 2AWGA 3AS2A 3WD0A 1EIBA 2G8ZA 2YBUA 1ZU8A 2UZ5A 4FAPA 1WB0A 3IK8A 3MDYB 2PV2A 1LL7A 2LPVA 4AY1A 2VCDA 3CHEA 1EYMA 3JYMA 1L1PA 2XP4A 2DSZA 5HWCA 2B31A 1H0GA 1CTNA 2O92A 1NWUA 3G6LA 3FAPA 3O5IA 3WL0A 4U86A 1T11A 3ARYA 2ZR6A 4U84A 1Q6HA 4HBEA 4S3JA 3ARUA 1FKFA 1FKHA 2M1IA 4JFKA 3GPKA 3B9EA 3KCEA 2PPPA 3TCZA 3UF8A 1U79A 1B6CA 2F2DA 1E6PA 4QZVB 4Z2GA 3PA7A 4ODMA 2F21A 2PPOA 1ZBWA 2DT3A 4DH0A 4URIA 4DWSA 4DWSB 4WK9A 2D9FA 5I98A 1HJVA 3UI4A 4IQCA 4DRJA 2YBTA 2RQSA 1IX5A 1NH6A 4TW7A 4DRNA 2G41A 4QT2A 1HJXA 2ZQSA 4DRIA 4Z2KA 2LKNA 4DRQA 3ARVA 1LL6A 1Y0OA 3VAWA 1XRVA 4MTVA 1UR9A 2PBCA 3OOBA 3O5KA 4JFIA 5HKGA 3O5JA 3KABA 4Z2LA 3KAFA 3I6CA 4Z2IA 1LG2A 4TNSA 5DO2A 2XP7A 3FXYA 1FKBA 5HW8A 1H0IA 5B8IC 2XP9A 4ODOA 2RURA 1W26A 1EQ3A 2Q5AA 1KFWA 2PPNA 3UI6A 1E15A 1D6OA 1K9TA 4Q22A 2KE0A 2ESCA 3AS3A 5DEZA 2OFNA 3KAGA 4P8WA 4Q7NA 3G6MA 5HBFA 4ODQA 4ODRA 2MF9A 2LJ4A 4TW6A 3O5QA 3KADA 1VF8A 3KZ7A 4LAWA 3O5EA 1NWRA 4J4OA 3WL1A 4L3NA 4DRPA 1W9PA 1ROTA 2DG4A 3OA5A 3RFWA 4DZ2A 1FKKA 1PBKA 3B9DA 3JXVA 5DIUA 1ITXA 1E6RA 1HKMA 1QZ2A 4MSPA 2XP3A 2ZQUA 1J4HA 3WD2A 1X6NA 3CHDA 2A3CA 4JFLA 1FKRA 3O5FA 3CH9A 1NWSA 1J4IA 2MLYA 3EY6A 4DRMA 1W1YA 4WJXA 3RM4A 1Q6IA 2XP6A 3ARTA 4MGVA 2O9OA 5D75A 2DSUA 2FDMA 2DG9A 2KI3A 4JYSA 3B7XA 4BF8A 1HKJA 3AROA 1HKIA 1E6ZA 1QPLA 2WLYA 4DIPA 4NZCA 4KQZA 5HWBA 1ROUA 1FJDA 1JNTA 3WQWA 1W1VA 2OLHA 1BL4A 2KGJA 4Z2JA 2N87A 1LJYA 1ZCNA 1TCOC 4DROA 5JH8A 1OGGA 2XPAA 4R0XA 2M2AA 1FKLA 1A7XA 3WD1A 3KAIA 3ARQA 3O5GA 1ZB5A 2DT0A 4P8XA 3CHFA 1JVWA 1E6NA 3LUOA 4O2TA 2MNTA 4DWSC 3NRKA 4JFJA 3ARXA 4HARA 1ZBCA 1JNSA 1FD9A 2RUCA 2ZR4A 2DSWA 2RUQA 2KFWA 2DT2A 1FKDA 3CGNA 1NMVA 3WIJA 3WQVA 4WKHA 4DT4A 1ZL1A 2XPBA 1FFRA 4ZS6A 4DWSD 1C9HA 3B8SA 2DT1A 2ZQTA 4GIVA 4ODKA 4R5EA 3NTPA 3IKDA 2DG3A 2VN1A 4ODLA 1LL4A 4WKFA 4DRHA 4L72B 1NMWA 3KAHA 4ZPVR 1KT0A 1J4RA 2K8IA 5GQBA 2QF8A 2KO7A 1N1AA 3RM9A 2DPEA 5DITA 1W9VA 4LAXA 4IPXA 5HT1A 1Q6UA 3IHZA 3CHCA 4P8VA 1LG1A 1W1TA 1HJWA 3B9AA 4PTMA 1ZBVA 3O5LA 3ALFA 4W9OA 1YW5A 1WAWA 3BXWA 5HW6A 3RMEA 1XHGA 3AQUA 1D7JA 1R9HA 4G2PA 1HKKA 3H9RB 5HTGA 2WK2A 1WNOA 4XAKA 2WLZA 3PRAA 5BXJA 4GGQA 4WIWA 5GPRA 1D2KA 4Z2HA 3ARZA 1M5YA 3UQAA 1EHNA 5HW7A 4NSBA 1E9LA 1SYTA 4QT3A 2WM0A 3O5DA 2MLZA 2F4EA 1W1PA 3O5OA 2M08A 3TDBA 2PV1A 4S3KA 5HUAA 4KR0B 3ARRA 4ZPTR 1X6LA 1D7HA 2ITKA 2IUZA 1PINA 1ZBKA 3WKZA 3JYJA 1EDQA 1NWTA 4JFMA 4LAYA 1JNEA 4LAVA 4WKAA 3O5PA 1GPFA 3UQBA 3AS1A 2IF4A 1Q1CA 3KACA 1FAPA 1FKGA 2KR7A 3CGMA 5J6EA 3ARWA 2A3EA 1KT1A 2FAPA 2RUDA 5GPGA 1O6IA 1OGBA 3PRBA 1FKTA 4MPKA 4J4NA 4W9QA 4ZPWR 3CZ8A 4LGXA 4TX0A 1W9UA 4MNKA 4QIBA 2XP5A 3PRDA 4IQ2A 1OWQA 1BKFA 2LGOA 5DIVA 4W5UA 2A3AA 1P5QA 3WD3A 3QOKA 4ML4A 3IKGA 1FFQA 3FY1A 2MPHA 3RM8A 2RSEA 2ZQVA 3ALGA 5DF0A 3ARSA 3RGCA 4N19A 2A3BA 1FKJA 4IT6A 1RD6A 3O5MA 2Y78A 4ODNA 1GOIA 4MNMA 1GUVA 2AOSA 4MNLA 1NSGA 4G50A 4P8UA 4C02B 4DRKA 2L2SA 1YATA 1J6YA 2DSVA 1JNDA 4NNRA 2MLXA 3UQIA 3WH0A 3PR9A 3ARPA 1UR8A 3NI6A 1D7IA 4MAVA 3ODKA 3W4RA 1HXVA 3TC5A 1QPFA 1ZK6A 2PI6A 2PV3A 4DZ3A 4ODPA 1SR0A 1LQ0A 2ZR5A 4ITZA 2JZVA 4MNJA 3UI5A 4TW8A 1F40A 4FN2A 4W9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U85 A;  4TYO A;  1FKI A;  3O5R A;  5J6E A;  4DT4 A;  2FKE A;  1NMV A;  2OFN A;  3KAG A;  2XPB A;  1F8A B;  1KT1 A;  1FKS A;  2FAP A;  1C9H A;  2RUD A;  4ODR A;  2XP8 A;  4ODQ A;  2MF9 A;  2LJ4 A;  2AWG A;  4TW6 A;  5GPG A;  2ZQT A;  3O5Q A;  4ITZ A;  3PRB A;  1FKT A;  4GIV A;  4ODK A;  4J4N A;  3NTP A;  3IKD A;  3KAD A;  4W9Q A;  2DG3 A;  3KZ7 A;  2VN1 A;  4ODL A;  2UZ5 A;  4LAW A;  4FAP A;  3O5E A;  3IK8 A;  3MDY B;  2PV2 A;  2LPV A;  4J4O A;  2VCD A;  1L1P A;  1EYM A;  3JYM A;  4TX0 A;  4DRH A;  2XP4 A;  1NMW A;  4DRP A;  3KAH A;  5HWC A;  1ROT A;  1KT0 A;  2DG4 A;  1J4R A;  2K8I A;  3RFW A;  4DZ2 A;  4QIB A;  1FKK A;  1PBK A;  2XP5 A;  3JXV A;  3PRD A;  2KO7 A;  4IQ2 A;  1N1A A;  1EQ3 A;  5DIT A;  1BKF A;  5DIU A;  2LGO A;  3FAP A;  3O5I A;  4LAX A;  4IPX A;  5DIV A;  4U86 A;  1T11 A;  5HT1 A;  2ZR6 A;  1Q6U A;  4U84 A;  5B8I C;  3IHZ A;  1P5Q A;  1Q6H A;  1QZ2 A;  4MSP A;  2XP3 A;  3IKG A;  2ZQU A;  1J4H A;  3O5L A;  1FKF A;  2MPH A;  4W9O A;  1FKH A;  1YW5 A;  2M1I A;  4JFK A;  2RSE A;  2ZQV A;  4JFL A;  1FKR A;  5HW6 A;  3GPK A;  3O5F A;  3KCE A;  2PPP A;  3TCZ A;  1J4I A;  3UF8 A;  2MLY A;  3EY6 A;  4N19 A;  3RGC A;  1U79 A;  4DRM A;  1B6C A;  2F2D A;  1D7J A;  1R9H A;  4G2P A;  1Q6I A;  1FKJ A;  2XP6 A;  3H9R B;  3O5M A;  4MGV A;  5HTG A;  2Y78 A;  3PA7 A;  4ODM A;  5D75 A;  2F21 A;  4ODN A;  2PPO A;  2DG9 A;  2KI3 A;  4JYS A;  3B7X A;  4BF8 A;  4W9P A;  4DH0 A;  5BXJ A;  4GGQ A;  4ODO A;  4DIP A;  1QPL A;  5HWB A;  1ROU A;  1NSG A;  2D9F A;  4G50 A;  5I98 A;  1M5Y A;  1FJD A;  1JNT A;  3UQA A;  3UI4 A;  4IQC A;  4C02 B;  4DRJ A;  5HW7 A;  2RQS A;  1BL4 A;  2L2S A;  4DRK A;  2KGJ A;  4QT3 A;  2N87 A;  4TW7 A;  1ZCN A;  1TCO C;  4DRN A;  1YAT A;  4QT2 A;  3O5D A;  4DRO A;  2MLZ A;  2F4E A;  2ZQS A;  3O5O A;  4DRI A;  1J6Y A;  2XPA A;  2LKN A;  4DRQ A;  2M08 A;  4R0X A;  2PV1 A;  3TDB A;  2M2A A;  5HUA A;  1FKL A;  1Y0O A;  2MLX A;  4NNR A;  3UQI A;  1A7X A;  3VAW A;  3WH0 A;  3KAI A;  2PBC A;  3OOB A;  4JFI A;  3O5K A;  5HKG A;  1D7H A;  2ITK A;  1D7I A;  3NI6 A;  1PIN A;  3O5J A;  3KAB A;  3O5G A;  3ODK A;  3KAF A;  1JVW A;  3I6C A;  3LUO A;  3JYJ A;  4O2T A;  4TNS A;  1HXV A;  3TC5 A;  1QPF A;  4JFM A;  2MNT A;  1ZK6 A;  4LAV A;  4LAY A;  3NRK A;  2PV3 A;  4DZ3 A;  4JFJ A;  3O5P A;  4ODP A;  3UQB A;  2XP7 A;  1FKB A;  5HW8 A;  1JNS A;  2IF4 A;  1Q1C A;  1FD9 A;  2RUC A;  2XP9 A;  2ZR5 A;  3KAC A;  2RUR A;  1W26 A;  2JZV A;  2KFW A;  1FAP A;  2PPN A;  2Q5A A;  2RUQ A;  1FKD A;  1FKG A;  2ZR4 A;  3UI6 A;  1D6O A;  3UI5 A;  2KR7 A;  4TW8 A;  3CGN A;  1F40 A;  4FN2 A;  3CGM A;  2KE0 A; 
#chains in the Genus database with same CATH topology
 3AS0 A;  4U85 A;  3WD4 A;  4TYO A;  1FKI A;  3O5R A;  4HBO A;  2FKE A;  1TFV A;  1F8A B;  1FKS A;  2XP8 A;  4IT4 A;  2AWG A;  3AS2 A;  3WD0 A;  1EIB A;  2G8Z A;  2YBU A;  1ZU8 A;  2UZ5 A;  4FAP A;  1WB0 A;  3IK8 A;  3MDY B;  2PV2 A;  1LL7 A;  2LPV A;  1E44 A;  4AY1 A;  2VCD A;  3CHE A;  1EYM A;  3JYM A;  1L1P A;  2XP4 A;  2DSZ A;  5HWC A;  2B31 A;  1H0G A;  1CTN A;  2EUL A;  2O92 A;  1NWU A;  3G6L A;  3FAP A;  3O5I A;  3WL0 A;  4U86 A;  1T11 A;  3ARY A;  2ZR6 A;  4U84 A;  1Q6H A;  4HBE A;  4S3J A;  3ARU A;  1FKF A;  1FKH A;  2M1I A;  4JFK A;  3GPK A;  3B9E A;  3KCE A;  2PPP A;  3TCZ A;  3UF8 A;  1U79 A;  1B6C A;  2F2D A;  1E6P A;  1GRJ A;  4QZV B;  4Z2G A;  3PA7 A;  4ODM A;  2F21 A;  2PPO A;  1ZBW A;  2DT3 A;  4DH0 A;  4URI A;  4DWS A;  4DWS B;  4WK9 A;  2D9F A;  5I98 A;  1HJV A;  3UI4 A;  4IQC A;  4DRJ A;  2YBT A;  2RQS A;  1IX5 A;  1NH6 A;  4TW7 A;  4DRN A;  2G41 A;  4QT2 A;  1HJX A;  2ZQS A;  4DRI A;  4Z2K A;  2LKN A;  4DRQ A;  3ARV A;  1LL6 A;  1Y0O A;  3VAW A;  1XRV A;  4MTV A;  1UR9 A;  2PBC A;  3OOB A;  3O5K A;  4JFI A;  5HKG A;  3O5J A;  3KAB A;  4Z2L A;  3KAF A;  3I6C A;  4Z2I A;  1LG2 A;  4TNS A;  5DO2 A;  2XP7 A;  3FXY A;  1FKB A;  5HW8 A;  1H0I A;  5B8I C;  2XP9 A;  4ODO A;  2RUR A;  1W26 A;  1EQ3 A;  2Q5A A;  1KFW A;  2PPN A;  3UI6 A;  1E15 A;  1D6O A;  1K9T A;  4Q22 A;  2KE0 A;  2ESC A;  3AS3 A;  5DEZ A;  2OFN A;  3KAG A;  4P8W A;  4Q7N A;  3G6M A;  5HBF A;  4ODQ A;  4ODR A;  2MF9 A;  2LJ4 A;  4TW6 A;  3O5Q A;  3KAD A;  1VF8 A;  3KZ7 A;  4LAW A;  4UDM A;  3O5E A;  1NWR A;  4J4O A;  3WL1 A;  4L3N A;  4DRP A;  1W9P A;  1ROT A;  2DG4 A;  3OA5 A;  3RFW A;  4DZ2 A;  1FKK A;  1PBK A;  3B9D A;  3JXV A;  5DIU A;  1ITX A;  1E6R A;  1HKM A;  1QZ2 A;  4MSP A;  2XP3 A;  3EIP A;  2ZQU A;  1J4H A;  3WD2 A;  1X6N A;  3CHD A;  2A3C A;  4JFL A;  1FKR A;  3O5F A;  3CH9 A;  1NWS A;  1J4I A;  2MLY A;  3EY6 A;  4DRM A;  1W1Y A;  4WJX A;  3RM4 A;  1Q6I A;  2XP6 A;  3ART A;  4MGV A;  2O9O A;  5D75 A;  2DSU A;  2FDM A;  2DG9 A;  2KI3 A;  4JYS A;  3B7X A;  4BF8 A;  1HKJ A;  3ARO A;  1HKI A;  1E6Z A;  1QPL A;  2WLY A;  4DIP A;  4NZC A;  2B5U B;  4KQZ A;  5HWB A;  1ROU A;  1FJD A;  1JNT A;  3WQW A;  1W1V A;  2OLH A;  1BL4 A;  2KGJ A;  4Z2J A;  2N87 A;  1LJY A;  1ZCN A;  1TCO C;  4DRO A;  5JH8 A;  1OGG A;  2XPA A;  4R0X A;  2M2A A;  1FKL A;  1A7X A;  3WD1 A;  3KAI A;  3ARQ A;  3O5G A;  1ZB5 A;  2DT0 A;  4P8X A;  3CHF A;  1JVW A;  1E6N A;  3LUO A;  4O2T A;  2MNT A;  4DWS C;  3NRK A;  4JFJ A;  3ARX A;  4HAR A;  1ZBC A;  1JNS A;  1FD9 A;  2RUC A;  2ZR4 A;  2DSW A;  2RUQ A;  2KFW A;  2DT2 A;  1FKD A;  3CGN A;  1NMV A;  3WIJ A;  3WQV A;  3GU0 A;  4WKH A;  4DT4 A;  1ZL1 A;  2XPB A;  1FFR A;  2F23 A;  4ZS6 A;  4DWS D;  1C9H A;  3B8S A;  2DT1 A;  2ZQT A;  4GIV A;  4ODK A;  4R5E A;  3NTP A;  3IKD A;  2DG3 A;  2VN1 A;  4ODL A;  1LL4 A;  4WKF A;  4DRH A;  4L72 B;  1NMW A;  3KAH A;  4ZPV R;  1KT0 A;  1J4R A;  2K8I A;  2PN0 A;  5GQB A;  2QF8 A;  2KO7 A;  1N1A A;  3RM9 A;  2DPE A;  5DIT A;  1W9V A;  4LAX A;  4IPX A;  5HT1 A;  1Q6U A;  3IHZ A;  3CHC A;  4P8V A;  1LG1 A;  1W1T A;  1HJW A;  3B9A A;  4PTM A;  1ZBV A;  3O5L A;  3ALF A;  4W9O A;  1YW5 A;  1WAW A;  3BXW A;  5HW6 A;  3RME A;  1XHG A;  3AQU A;  1D7J A;  1R9H A;  4G2P A;  1HKK A;  3H9R B;  5HTG A;  2WK2 A;  1WNO A;  4XAK A;  2WLZ A;  3PRA A;  5BXJ A;  4GGQ A;  4WIW A;  5GPR A;  1D2K A;  4Z2H A;  3ARZ A;  1M5Y A;  3UQA A;  1EHN A;  5HW7 A;  4NSB A;  1E9L A;  1SYT A;  1JCH B;  4QT3 A;  2WM0 A;  3O5D A;  2MLZ A;  2F4E A;  1W1P A;  3O5O A;  2M08 A;  3TDB A;  2PV1 A;  4S3K A;  5HUA A;  4KR0 B;  3ARR A;  4ZPT R;  1X6L A;  1D7H A;  2ITK A;  2IUZ A;  1PIN A;  1ZBK A;  3WKZ A;  3JYJ A;  2ETN A;  1EDQ A;  1NWT A;  4JFM A;  4LAY A;  1JNE A;  4LAV A;  4WKA A;  3O5P A;  1GPF A;  3UQB A;  3AS1 A;  2IF4 A;  1Q1C A;  3KAC A;  2P4V A;  1FAP A;  1FKG A;  2KR7 A;  3CGM A;  5J6E A;  3ARW A;  2A3E A;  1KT1 A;  2FAP A;  2RUD A;  5GPG A;  1O6I A;  1OGB A;  3PRB A;  1FKT A;  4MPK A;  4J4N A;  4W9Q A;  4ZPW R;  3CZ8 A;  4LGX A;  4TX0 A;  1W9U A;  4MNK A;  4QIB A;  2XP5 A;  3PRD A;  4IQ2 A;  1OWQ A;  1BKF A;  2LGO A;  5DIV A;  4W5U A;  2A3A A;  1P5Q A;  3WD3 A;  3GTY X;  3BMB A;  3QOK A;  4ML4 A;  3IKG A;  1FFQ A;  3FY1 A;  2MPH A;  3RM8 A;  2RSE A;  2ZQV A;  3ALG A;  5DF0 A;  3ARS A;  3RGC A;  4N19 A;  2A3B A;  1FKJ A;  4IT6 A;  1RD6 A;  3O5M A;  2Y78 A;  4ODN A;  1GOI A;  4MNM A;  1GUV A;  2AOS A;  4MNL A;  1NSG A;  4G50 A;  4P8U A;  4C02 B;  4DRK A;  2L2S A;  1YAT A;  1J6Y A;  2DSV A;  1JND A;  4NNR A;  2MLX A;  3UQI A;  3WH0 A;  3PR9 A;  3ARP A;  1UR8 A;  3NI6 A;  1D7I A;  4MAV A;  3ODK A;  3W4R A;  1HXV A;  3TC5 A;  1QPF A;  1ZK6 A;  2PI6 A;  2PV3 A;  4DZ3 A;  4ODP A;  1SR0 A;  1LQ0 A;  2ZR5 A;  4ITZ A;  2JZV A;  4MNJ A;  3UI5 A;  4TW8 A;  1F40 A;  4FN2 A;  4W9P A; 
#chains in the Genus database with same CATH homology
 3AS0 A;  4U85 A;  3WD4 A;  4TYO A;  1FKI A;  3O5R A;  4HBO A;  2FKE A;  1TFV A;  1F8A B;  1FKS A;  2XP8 A;  4IT4 A;  2AWG A;  3AS2 A;  3WD0 A;  1EIB A;  2G8Z A;  2YBU A;  1ZU8 A;  2UZ5 A;  4FAP A;  1WB0 A;  3IK8 A;  3MDY B;  2PV2 A;  1LL7 A;  2LPV A;  4AY1 A;  2VCD A;  3CHE A;  1EYM A;  3JYM A;  1L1P A;  2XP4 A;  2DSZ A;  5HWC A;  2B31 A;  1H0G A;  1CTN A;  2O92 A;  1NWU A;  3G6L A;  3FAP A;  3O5I A;  3WL0 A;  4U86 A;  1T11 A;  3ARY A;  2ZR6 A;  4U84 A;  1Q6H A;  4HBE A;  4S3J A;  3ARU A;  1FKF A;  1FKH A;  2M1I A;  4JFK A;  3GPK A;  3B9E A;  3KCE A;  2PPP A;  3TCZ A;  3UF8 A;  1U79 A;  1B6C A;  2F2D A;  1E6P A;  4QZV B;  4Z2G A;  3PA7 A;  4ODM A;  2F21 A;  2PPO A;  1ZBW A;  2DT3 A;  4DH0 A;  4URI A;  4DWS A;  4DWS B;  4WK9 A;  2D9F A;  5I98 A;  1HJV A;  3UI4 A;  4IQC A;  4DRJ A;  2YBT A;  2RQS A;  1IX5 A;  1NH6 A;  4TW7 A;  4DRN A;  2G41 A;  4QT2 A;  1HJX A;  2ZQS A;  4DRI A;  4Z2K A;  2LKN A;  4DRQ A;  3ARV A;  1LL6 A;  1Y0O A;  3VAW A;  1XRV A;  4MTV A;  1UR9 A;  2PBC A;  3OOB A;  3O5K A;  4JFI A;  5HKG A;  3O5J A;  3KAB A;  4Z2L A;  3KAF A;  3I6C A;  4Z2I A;  1LG2 A;  4TNS A;  5DO2 A;  2XP7 A;  3FXY A;  1FKB A;  5HW8 A;  1H0I A;  5B8I C;  2XP9 A;  4ODO A;  2RUR A;  1W26 A;  1EQ3 A;  2Q5A A;  1KFW A;  2PPN A;  3UI6 A;  1E15 A;  1D6O A;  1K9T A;  4Q22 A;  2KE0 A;  2ESC A;  3AS3 A;  5DEZ A;  2OFN A;  3KAG A;  4P8W A;  4Q7N A;  3G6M A;  5HBF A;  4ODQ A;  4ODR A;  2MF9 A;  2LJ4 A;  4TW6 A;  3O5Q A;  3KAD A;  1VF8 A;  3KZ7 A;  4LAW A;  3O5E A;  1NWR A;  4J4O A;  3WL1 A;  4L3N A;  4DRP A;  1W9P A;  1ROT A;  2DG4 A;  3OA5 A;  3RFW A;  4DZ2 A;  1FKK A;  1PBK A;  3B9D A;  3JXV A;  5DIU A;  1ITX A;  1E6R A;  1HKM A;  1QZ2 A;  4MSP A;  2XP3 A;  2ZQU A;  1J4H A;  3WD2 A;  1X6N A;  3CHD A;  2A3C A;  4JFL A;  1FKR A;  3O5F A;  3CH9 A;  1NWS A;  1J4I A;  2MLY A;  3EY6 A;  4DRM A;  1W1Y A;  4WJX A;  3RM4 A;  1Q6I A;  2XP6 A;  3ART A;  4MGV A;  2O9O A;  5D75 A;  2DSU A;  2FDM A;  2DG9 A;  2KI3 A;  4JYS A;  3B7X A;  4BF8 A;  1HKJ A;  3ARO A;  1HKI A;  1E6Z A;  1QPL A;  2WLY A;  4DIP A;  4NZC A;  4KQZ A;  5HWB A;  1ROU A;  1FJD A;  1JNT A;  3WQW A;  1W1V A;  2OLH A;  1BL4 A;  2KGJ A;  4Z2J A;  2N87 A;  1LJY A;  1ZCN A;  1TCO C;  4DRO A;  5JH8 A;  1OGG A;  2XPA A;  4R0X A;  2M2A A;  1FKL A;  1A7X A;  3WD1 A;  3KAI A;  3ARQ A;  3O5G A;  1ZB5 A;  2DT0 A;  4P8X A;  3CHF A;  1JVW A;  1E6N A;  3LUO A;  4O2T A;  2MNT A;  4DWS C;  3NRK A;  4JFJ A;  3ARX A;  4HAR A;  1ZBC A;  1JNS A;  1FD9 A;  2RUC A;  2ZR4 A;  2DSW A;  2RUQ A;  2KFW A;  2DT2 A;  1FKD A;  3CGN A;  1NMV A;  3WIJ A;  3WQV A;  4WKH A;  4DT4 A;  1ZL1 A;  2XPB A;  1FFR A;  4ZS6 A;  4DWS D;  1C9H A;  3B8S A;  2DT1 A;  2ZQT A;  4GIV A;  4ODK A;  4R5E A;  3NTP A;  3IKD A;  2DG3 A;  2VN1 A;  4ODL A;  1LL4 A;  4WKF A;  4DRH A;  4L72 B;  1NMW A;  3KAH A;  4ZPV R;  1KT0 A;  1J4R A;  2K8I A;  5GQB A;  2QF8 A;  2KO7 A;  1N1A A;  3RM9 A;  2DPE A;  5DIT A;  1W9V A;  4LAX A;  4IPX A;  5HT1 A;  1Q6U A;  3IHZ A;  3CHC A;  4P8V A;  1LG1 A;  1W1T A;  1HJW A;  3B9A A;  4PTM A;  1ZBV A;  3O5L A;  3ALF A;  4W9O A;  1YW5 A;  1WAW A;  3BXW A;  5HW6 A;  3RME A;  1XHG A;  3AQU A;  1D7J A;  1R9H A;  4G2P A;  1HKK A;  3H9R B;  5HTG A;  2WK2 A;  1WNO A;  4XAK A;  2WLZ A;  3PRA A;  5BXJ A;  4GGQ A;  4WIW A;  5GPR A;  1D2K A;  4Z2H A;  3ARZ A;  1M5Y A;  3UQA A;  1EHN A;  5HW7 A;  4NSB A;  1E9L A;  1SYT A;  4QT3 A;  2WM0 A;  3O5D A;  2MLZ A;  2F4E A;  1W1P A;  3O5O A;  2M08 A;  3TDB A;  2PV1 A;  4S3K A;  5HUA A;  4KR0 B;  3ARR A;  4ZPT R;  1X6L A;  1D7H A;  2ITK A;  2IUZ A;  1PIN A;  1ZBK A;  3WKZ A;  3JYJ A;  1EDQ A;  1NWT A;  4JFM A;  4LAY A;  1JNE A;  4LAV A;  4WKA A;  3O5P A;  1GPF A;  3UQB A;  3AS1 A;  2IF4 A;  1Q1C A;  3KAC A;  1FAP A;  1FKG A;  2KR7 A;  3CGM A;  5J6E A;  3ARW A;  2A3E A;  1KT1 A;  2FAP A;  2RUD A;  5GPG A;  1O6I A;  1OGB A;  3PRB A;  1FKT A;  4MPK A;  4J4N A;  4W9Q A;  4ZPW R;  3CZ8 A;  4LGX A;  4TX0 A;  1W9U A;  4MNK A;  4QIB A;  2XP5 A;  3PRD A;  4IQ2 A;  1OWQ A;  1BKF A;  2LGO A;  5DIV A;  4W5U A;  2A3A A;  1P5Q A;  3WD3 A;  3QOK A;  4ML4 A;  3IKG A;  1FFQ A;  3FY1 A;  2MPH A;  3RM8 A;  2RSE A;  2ZQV A;  3ALG A;  5DF0 A;  3ARS A;  3RGC A;  4N19 A;  2A3B A;  1FKJ A;  4IT6 A;  1RD6 A;  3O5M A;  2Y78 A;  4ODN A;  1GOI A;  4MNM A;  1GUV A;  2AOS A;  4MNL A;  1NSG A;  4G50 A;  4P8U A;  4C02 B;  4DRK A;  2L2S A;  1YAT A;  1J6Y A;  2DSV A;  1JND A;  4NNR A;  2MLX A;  3UQI A;  3WH0 A;  3PR9 A;  3ARP A;  1UR8 A;  3NI6 A;  1D7I A;  4MAV A;  3ODK A;  3W4R A;  1HXV A;  3TC5 A;  1QPF A;  1ZK6 A;  2PI6 A;  2PV3 A;  4DZ3 A;  4ODP A;  1SR0 A;  1LQ0 A;  2ZR5 A;  4ITZ A;  2JZV A;  4MNJ A;  3UI5 A;  4TW8 A;  1F40 A;  4FN2 A;  4W9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...