3RFWA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally-related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
252
structure length
252
Chain Sequence
b'ATVATVNGKSISDTEVSEFFAPMLRGQDFKTLPDNQKKALIQQYIMQDLILQDAKKQNLEKDPLYTKELDRAKDAILVNVYQEKILNTIKIDAAKVKAFYDQNKDKYVKPARVQAKHILVATEKEAKDIINELKGLKGKELDAKFSELAKEKSIDPGSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTTPVKTNFGYHVILKENSQAKGQIKFDEVKQGIENGLKFEEFKKVINQKGQDLLNSAKVEYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell-binding factor 2
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally-related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Chaperone
total genus 77
structure length 252
sequence length 252
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1040 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3rfwA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rfwA03
1TCOC 2XPBA 3EY6A 4U86A 3IKGA 4TNSA 2KGJA 4JYSA 4DT4A 4JFKA 1L1PA 3IHZA 5HTGA 1Q6HA 2ITKA 2LGOA 1N1AA 4JFLA 4ODNA 2KE0A 3O5FA 4DRQA 3O5IA 1Q6IA 4DZ2A 3KCEA 3NRKA 3O5OA 3VAWA 1F8AB 3CGNA 3I6CA 1FD9A 2DG3A 3KACA 5D75A 2XP9A 1FKBA 2AWGA 1QPFA 3O5QA 2XP6A 3O5KA 2DG4A 4FN2A 4MGVA 2D9FA 2DG9A 1D7IA 1FKTA 2PPPA 2PV2A 3O5DA 3ODKA 4W9QA 5HKGA 2XPAA 1QPLA 2F4EA 2ZR5A 4QT2A 4TW6A 4W9OA 3UI4A 4G2PA 5HW7A 1JVWA 4DRJA 5J6EA 4LAVA 4O2TA 1FKDA 4IQ2A 4DRMA 5HW6A 4JFMA 1B6CA 2PPNA 1T11A 4TW8A 2ZQSA 2M1IA 1FKHA 3O5PA 3GPKA 1J4HA 3UI6A 2LJ4A 1Y0OA 1R9HA 3JYJA 1P5QA 2VN1A 2PPOA 3KAIA 4ODLA 3CGMA 1ZCNA 3O5LA 4W9PA 4ODQA 3RGCA 1D7JA 1D6OA 1FKJA 3KAHA 4IPXA 1J4IA 2LPVA 4U84A 5HW8A 3JYMA 4LAWA 4DH0A 2XP3A 2M2AA 4DRKA 1KT0A 1PBKA 4DRHA 5B8IC 1PINA 1QZ2A 1BL4A 3UQAA 2N87A 2MLXA 3KABA 3PA7A 2F2DA 4TW7A 4DZ3A 1Q1CA 3JXVA 1C9HA 4J4OA 3UI5A 5HWBA 3OOBA 1F40A 1JNSA 3O5EA 1NMWA 1FKSA 3KZ7A 4GIVA 5BXJA 4JFJA 3RFWA 3H9RB 2F21A 1U79A 2RUCA 2M08A 2ZR6A 3UQIA 2PV1A 2ZQTA 5HUAA 3TC5A 1FAPA 2JZVA 2VCDA 1BKFA 3FAPA 5DIUA 2MNTA 2PBCA 2ZR4A 3PRDA 4ODMA 1YW5A 3KAFA 2LKNA 4TYOA 4N19A 2Y78A 1EQ3A 2ZQVA 3NTPA 2RSEA 2RUDA 4TX0A 3WH0A 1Q6UA 1NMVA 2XP5A 1J6YA 2KR7A 1JNTA 2FKEA 4IQCA 1M5YA 3UQBA 5HT1A 2RURA 4GGQA 2MF9A 1ROTA 5DITA 3KADA 2FAPA 3IKDA 1W26A 3O5MA 4ITZA 3B7XA 4LAYA 4ODOA 1KT1A 3PRBA 4R0XA 4FAPA 4QIBA 1HXVA 2L2SA 2XP4A 4ODKA 4DRIA 1EYMA 1FKLA 3TDBA 1FJDA 2MPHA 3IK8A 1D7HA 5HWCA 2K8IA 2MLYA 3KAGA 5I98A 2PV3A 4G50A 4BF8A 2UZ5A 2RUQA 3NI6A 3O5GA 2Q5AA 4U85A 1J4RA 4DROA 5DIVA 2MLZA 4JFIA 1ZK6A 2KFWA 4LAXA 1YATA 2IF4A 3UF8A 1FKIA 3O5RA 2KI3A 4ODRA 1FKGA 4DIPA 4QT3A 4DRPA 2RQSA 4ODPA 2OFNA 4DRNA 2ZQUA 3O5JA 1A7XA 4NNRA 1ROUA 2XP8A 4MSPA 5GPGA 3TCZA 1FKKA 3MDYB 4J4NA 2KO7A 4C02B 2XP7A 1FKFA 1NSGA 1FKRA 3LUOA
chains in the Genus database with same CATH superfamily
2EKFA 3GRVA 2DKLA 3GRUA 1TTEA 1D0LA 2IUZA 1L1PA 2R65A 2XH9A 2KNAA 4CHTB 2ITKA 2LGOA 3O5FA 4IBGA 3DOAA 2FE8A 2R0IA 4LJ4A 1HKIA 3AV0A 2H5XA 2K6BA 4JV5M 1QUSA 3ARZA 3WHKA 3W0FA 1XHGA 2PPNA 2ZQSA 3GPKA 4X66M 1P5QA 5EQTA 2DWNA 4REZA 3JYMA 4B7FA 2EO2A 3SHGB 1KT0A 1SXJD 3Q8XA 3UJNA 4J4OA 1C9HA 4LF6M 5KPRA 5JI2E 3U6CA 2DSWA 1IXRC 3VKGA 4MNLA 3DZDA 1FFQA 4PDIA 3KAFA 3W0LB 4WURA 2XGNA 4B3TM 1CTNA 1QDRA 3D8BA 4BBAA 3GRRA 3QYEA 4KHPM 2GNOA 1Z5BA 4L15A 1KFWA 2VIIA 5EP4A 2C98A 2B3TA 3GLFE 5EXSA 3NI6A 2MLZA 4LFAM 4AI6A 5ITYA 3KP0E 4S3KA 1WIVA 2XF3A 4DV0M 2C5RA 2FNAA 2DHYA 4GHAA 1FNNA 3WL0A 3B7NA 5DEZA 3A42A 1IXZA 4OX9M 3K1JA 3RGSA 2A3BA 1MX0A 3AS1A 1NWRA 1Q6IA 4NSOB 1F8AB 3I6CA 1E32A 1RD6A 1LV7A 4LCBA 3EIPA 5EXTA 3CHEA 4I5SA 2PPPA 1OIPA 4QT2A 1QANA 4Q22A 1IN4A 1PJJA 1FKHA 4M9SA 1LL7A 4IBJA 2DAGA 4MNJA 2BWBA 3RGCA 3ZCBB 1FKJA 2DXIA 1J4IA 2ZANA 3RM8A 1IXSA 4GITA 2F5QA 4XGIA 1R2YA 1K9TA 4FCVA 2F2DA 2H1RA 3B9AA 3J7BA 1QDTA 3ARPA 4W5WA 3HX3A 2MH8A 1V33A 4UDMA 1EQ3A 4BB9A 1W9PA 1PJIA 3WD3A 3SAUA 2XP5A 1XNRM 1DV0A 4LRTA 5HT1A 3T1HM 3J2PB 1ZBWA 2LH0A 4L8RC 2O01F 4B7GA 1FJDA 2MPHA 2WLZA 3KAGA 4P8XA 2G8LA 1HNXM 3ARQA 2W82A 1ZK6A 3LVWA 4IBIA 4LF4M 3K9PA 2L2DA 3ARVA 2ZQUA 1A7XA 4MSPA 1G3IA 2GQFA 4CIZA 2P5TA 2XPBA 1SXJB 4S12A 4WW0A 1NHGC 3QAUA 3I01M 2XP9A 4FN2A 2DG9A 3RGPA 1E9SA 1N78A 3SAVA 4AZFA 4JFMA 3AOEC 4ML4A 4DV4M 5JH8A 1J4HA 2L7HA 1IM2A 1HJXA 1Q39A 1K82A 3K9OA 3VKHA 4JI2M 5B8IC 4TUWA 5DF0A 3UQAA 5GPRA 3IECA 2JY7A 1E9LA 4JFJA 2M08A 1IBMM 2VCDA 3L2AA 4NC6A 3GLIB 2ZQVA 2RGHA 3R9XB 4TX0A 1EDQA 4R3DA 2YBUA 3C9PA 1OIZA 4A3VB 5DITA 1V34A 3FTEA 1ROTA 1GJTA 4Z2JA 2X49A 4ITZA 3B7XA 1Z5AA 5GQBA 1N75A 4LGMA 2FOIC 1FKLA 1NY5A 4IIWA 4MGHA 1R5LA 2CFOA 1IX5A 4JFIA 3BOSA 1O6IA 4LAXA 1L1ZA 3FYDA 4ODRA 5ITRA 4QT3A 4DRNA 2C96A 2KDLA 3TCZA 1TH4A 3V76A 4B08A 4DR7M 1GOIA 1NH6A 2CEAA 1Z5CA 1Q02A 1YUBA 2Z3XA 4ZPXA 1HJWA 1SG9A 2R4JA 4DBGB 3LQQA 1QPFA 1TFVA 4JI7M 1T11A 1IN5A 4MTVA 3TWMA 1ORYB 5BR8M 2Z8YM 3J80S 2QF8A 3BMBA 3FUWA 4NRWA 3CZ8A 2J5YA 3CGWA 3HJSA 1Q1CA 4HBOA 1FKSA 3TQSA 3KOZE 3HGIA 4QNRA 2Z7JA 2HL7A 3TC5A 1XMQM 3GP1A 2LTUA 2R6FA 2EULA 1QAOA 2ZR4A 4Q7NA 4N19A 1LG2A 4IQCA 5ITXA 1T6OA 1G59A 4D81A 2DT1A 3F92A 2QZ4A 1QVRA 2V1UA 4R0XA 3CF2A 2QQ8A 1D0KA 1ZL1A 2PI6A 2K8IA 3J81S 2UZ5A 4DR1M 1ZB5A 2IF4A 2KI3A 2JP7A 2JXNA 2FH0A 1NV8A 5DNYA 1PJSA 1EIBA 4AW4A 4Z2LA 3NWLA 2L09A 4LJ9A 2DZNB 4YY3M 3FRIA 1Q6HA 2WM0A 3GLFA 3GPYA 3THGA 4AKIA 3DFZA 4OVZB 3UMMA 2ZBKB 3U6SA 3KACA 2Y0QA 4LJ6A 2CP8A 1FKTA 1NWSA 2PV2A 4W9OA 1ZV1A 1N32M 2CHQA 1ZBVA 3HU3A 1FFRA 2R45A 2OQ4A 3GLGE 4JI3M 4ODLA 3O5LA 4P8VA 5FSWA 2G8ZA 4U84A 2HKJA 5HW8A 1NJGA 3KOXE 2F23A 4IBKA 4FCTA 1XXHB 4DR5M 3G6MA 2VF7A 4GIVA 3U6LA 1U79A 1QYRA 2M60A 1D0MA 3CF6E 2JY8A 5ITTA 1GKIA 1HJVA 4GC9A 3PRBA 4DV7M 3AL0C 4QIBA 3U6QA 2NQ8C 1RU3A 5HWCA 3J27B 5IT9S 2DI0A 1PRBA 1ZBKA 2WK2A 3TWLA 1G8PA 3I51A 3HZJA 1PJQA 4LRSA 5KPTA 2RQSA 4LF8M 3KOWE 3O5JA 1GL7A 1ROUA 4L6V6 3MDYB 2KO7A 3GPXA 5KPZA 4B3RM 2XP7A 4C02B 3LUOA 1FJGM 5FTNA 4Z2GA 3CHFA 3AQUA 1F4IA 2J7OA 1AUAA 3B9EA 4P16A 2BJVA 2DAIA 1QUTA 4JFLA 3ILKA 1HNWM 3WKZA 2DWZB 1JB0F 5D75A 2XZUA 1JCHB 3TL4X 1Z6TA 3O5QA 4LGXA 1E94E 3U6PA 1D7IA 4URIA 3SMPA 1DO0A 1QPLA 2F4EA 1W5SA 3CHCA 3KS8A 4LG2A 3B74A 2RKOA 1Y0OA 1R9HA 4B3SM 3KAIA 2MR9A 3U60A 4UN2B 1D6OA 3ARYA 4DRKA 3NBIA 4PTMA 1GRJA 5IWAM 3FRHA 1L2BA 1OJLA 5KO3A 1TH3A 3VK8A 1NSFA 2CHVA 1KSFX 3UQIA 1G71A 4NOOB 3U6EA 5E6JA 2DT2A 2AHMA 4M0WA 3NTPA 5ITXE 1JNTA 4MPKA 1C1KA 1T43A 3GRYA 1L8QA 3UZUA 4LF7M 2UU9M 4I8OA 1Q3BA 4PT5A 4AG6A 1X6NA 1ZAEA 4BF8A 3B9DA 4XAKA 5JI3E 1OAIA 2KFWA 4F2LA 3FXYA 2F5NA 4QNMA 3UF8A 1S3SA 4Z8XA 4DV3M 3G6LA 1GL6A 4NNRA 4R71A 3MHVC 1FKRA 1LTMA 4KR0B 2OPFA 4L16A 3SYLA 4DUZM 2QENA 1L2CA 3A98B 2ZAMA 1IBKM 4P17A 2O9OA 2D7HA 1NY6A 1Z59A 1NV9A 2D9FA 2MGWA 3MMPA 3UI4A 3ARUA 4DRMA 1WHCA 2WSFF 4NL4H 4TW8A 3AS2A 2M1IA 3O5PA 2R18A 2LJ4A 3UK6A 4R7GA 4G4QA 5DYGA 3GPPA 5C18A 4W9PA 4EIWA 3VDUA 1OTRA 4DH0A 2B31A 3SASA 4DRHA 2N87A 2L4EA 3FUTA 3JXVA 5HWBA 1LQ0A 4D80A 3GQ5A 4MM3B 2G5GX 2G41A 3H9RB 4JN6A 5HUAA 3ZQJA 4B7HA 5L8RF 3L25A 1X37A 4GKKM 1Q6UA 3GTYX 2O92A 4P8WA 2B5UB 1W5TA 2XFTA 4LF9M 1GUVA 2XEPA 4IBFA 2KRUA 3C58A 4HARA 1HXVA 3PNVA 2D7EA 3AKZA 2F5PA 1LJYA 2MLYA 3O5GA 3M7GA 4U85A 1E6ZA 2LVNC 1HQCA 1T3TA 1TH2A 3FTCA 1TDZA 4ZPTR 2VDBB 2CUZA 2QCUA 3WHLA 3U61A 1DGBA 2KZUA 2XLJA 4TNSA 3RM4A 1R4GA 2LNHC 4YHHM 4WKAA 1K3XA 3M0EA 4G4NA 3WQWA 3CGNA 4FWGA 2XP6A 3ODKA 1N33M 4NSBA 4G2PA 3LCVB 5J6EA 2XSZA 3QYBA 5DO2A 1HNZM 2HWJA 3T6PA 4ZPVR 4JI0M 1WXQA 3U5ZB 4RKUF 2QSFX 4GEWA 1BL4A 2MLXA 3W68A 5EP2A 2DAEA 2DHRA 2LHGA 3O5EA 2FDMA 2OLHA 2D7GA 2QBYA 2F21A 4DR3M 1I4WA 3VK7A 1BKFA 1DGHB 3GLGA 1NWUA 1VEJA 1NMVA 4M0DA 3H4JA 3SBJA 4Z2HA 1IQPA 4GGQA 2CRUA 4BLCA 3O5MA 2DT0A 1KYIA 1HR0M 1VEGA 2DSZA 2XFSA 4AQYM 1IY1A 3CH9A 2LXEA 2LVOC 2ZTDA 2X8AA 3W67A 4HLQA 4G4OA 1JR3A 3T38A 1HQYE 4DWSA 1GLNA 1N36M 4FCWA 1XNQM 2JZ0A 2FS1A 3OA5A 3IHZA 1WJ7A 1OAOC 3J7AS 4LJAA 1YLAA 2XSZD 3GQ3A 1N1AA 3SMSA 1IY2A 2QPAA 3WQVA 4DUYM 3NRKA 3VAWA 1ZMVA 2OOAA 2DG3A 4KQZA 3EIEA 3FKEA 3NBXX 4JI5M 1K3WA 2LBCA 1DGGA 3O5DA 2KA6B 2DT3A 4LAVA 4PD2A 2VF8A 2UUCM 2QHOB 2F4VM 4RF0A 4LFCM 1HT1E 1XB2B 4IPXA 2LPVA 4G4RA 3HJQA 2JA2A 2KNVA 2R4EA 3GLHE 1QQWA 1IN7A 1JNSA 4LZZA 1N77A 2Q2EB 3ZC7B 5H37D 1WGNA 2I7NA 5GKNA 4ODMA 1EIJA 1UFZA 2LVPC 4DR2M 4Q7JA 2R44A 4KODA 3WD4A 4JI6M 4FAPA 7CATA 2L2SA 4GRIA 1DGFA 2KXEA 1GO5A 1VDLA 3BBZA 2A3AA 2UXBM 4HBEA 3CHDA 1JR3D 2DAMA 4M9ZA 4WJXA 5E26A 1E6PA 3B7QA 4DV2M 2K0BX 2ESCA 1R7RA 3PVSA 3K2LA 4JI1M 3L28A 1FKFA 4IBBA 2DZOB 2RGOA 4FVMA 4MGKE 3SARA 5DYIA 3PRAA 4MGYE 3QWLA 4L72B 1IXSB 3ALFA 2DNAA 3KW6A 4QHSA 4QZVB 1JVWA 1NJFA 3JR4A 5EXXA 4O2TA 2HCBA 1E9RA 2BNKA 2C99A 2JY6B 4AG5A 3R8FA 5FTJA 1W1PA 4X62M 4GIPA 4WK9A 5EP1A 3IG5A 4TW7A 4DZ3A 3FUUA 3U61B 2EJSA 2PV1A 2Z4SA 1FAPA 5DIUA 1MU5A 4Z2KA 2A3CA 1IFYA 1QAQA 4LFBM 1YE9A 4ODOA 2L7IA 3FY1A 5I98A 2DSUA 5ITUA 3HU1A 3RMEA 2YR0A 4G6ZA 4RF1A 1YATA 4MGZE 3RM9A 1JR3E 2BJWA 4GH9A 4I4LA 2QBYB 1NNUC 1TCOC 3FYCA 3K8ZA 3EY6A 1V92A 4IT6A 2KGJA 3GO8A 4PDGA 2V1CA 3I4YA 2JZ1A 4DZ2A 3O5OA 4NXNM 2KW0A 1E15A 1HKKA 1XHBA 2EA0A 2AOSA 4PCZA 5IZ7D 5HW7A 1FKDA 4IQ2A 1A5TA 3HHZA 3U6DA 1B6CA 1SXJA 4JI8M 4ITQA 1GVNA 1XC8A 3AFHA 3KABA 4CGYB 2WZJA 3MK6A 1E6RA 5BPVA 1E6NA 3I04M 2YQZA 3HHYA 3FAPA 4DV1M 2MNTA 2PBCA 4NRVA 2JNHA 2EUCA 1J6YA 2VQEM 4W5UA 3FE3A 2RURA 4LJ7A 3H4MA 1LL4A 1PGYA 3KOYE 5FTKA 1JNEA 3TDBA 4GMQA 1JQJC 3LW5F 3AS3A 3WD2A 2HAKA 3VLFB 1ITXA 2Q5AA 2DPEA 1J4RA 1N34M 3GLIA 5DIVA 1WR1B 4OU7A 2A5YB 2YBTA 3A46A 1FKKA 4IJEA 2Y20A 4MGIE 4JYSA 4DT4A 1MN3A 4GKJM 4DRQA 1G4AE 5F3WA 1W1TA 3FTDA 1FD9A 3ARWA 4KLNA 4D82A 2ZAOA 2APLA 3U6OA 2XPAA 4Z2IA 1J7KA 4AY1A 2OOBA 2JWSA 4MB7A 3B8SA 1OFHA 4ZS6A 4LY6A 2YNMD 3KP1E 4MAVA 1AIPC 2CV0A 3WD0A 1SR0A 1UR9A 1KFVA 4QHTA 1HKJA 3HHWA 5A2QS 4Z6YA 5BXJA 4P8UA 4WKFA 3L27A 4IBEA 3ALGA 4QOSA 1PM5A 3L29A 2Y78A 4WIWA 1TR8A 2C9CA 3GLHA 3WIJA 3FD9A 4IBCA 1GABA 4DV5M 5KQ8A 4FW9A 3GLFB 4DROA 1MJGM 3WD1A 4MNKA 2XP8A 1EE8A 4GHLA 2ZTCA 3KSJA 3UGJA 1LG1A 1G41A 3KSXA 3IKGA 1R6BX 1QZEA 2WLYA 2UUAM 4L3NA 3FUXA 3RE8A 4DV6M 2P4VA 4F1IA 2DG4A 4MGVA 2UXDM 4TW6A 4WKHA 2M5ZA 1SXJE 2I7PA 3FUVA 2CE7A 4B3MM 1ZCNA 2R46A 1D7JA 3SFZA 3KAHA 1OKSA 1VEKA 2X4AA 4OVZA 5EP3A 1UM8A 1ZMWA 2M2AA 2UXCM 1JNDA 1PINA 1TDHA 2YFQA 2C9OA 3OOBA 3HU2A 1Q3CA 4KT0F 3ZH9B 1W9VA 4X64M 2O25A 3C3EA 3PRDA 4CJ6A 3ARSA 2KNZA 2DZLA 1M5YA 3PNYA 2MF9A 4FWDA 4IJFA 1W26A 2UUBM 1KT1A 1XXHA 2DAKA 4S3JA 2XP4A 4ODKA 3I4VA 3IK8A 3C3DA 1VDDA 3KXEC 1R2ZA 4FWHA 3A45A 3IHPA 2RUQA 3GLIE 1SXJC 3GPUA 2JUJA 1OQYA 3ARTA 3HKPA 1HKMA 1IN6A 1L2DA 3O5RA 4L78A 4DRPA 5C1BA 2LVQD 1QZMA 3AROA 3M6AA 3T15A 1IN8A 1L1TA 2DSVA 1NSGA 1VQ1A 3QOKA 1OFIA 4U86A 1TF0B 5HTGA 3AS0A 4XK8F 3U60B 3DA1A 4ODNA 2KE0A 4QOZC 2J7NA 2CV2A 4JXJA 3O5KA 4W9QA 4AKGA 5HKGA 2ZR5A 2KEBA 3E21A 1D2KA 5HW6A 2CWBA 4Y28F 3T1YM 4LZJA 2PPOA 4AKHA 2Y0TA 3CGMA 1NHWC 2QP9X 4DR4M 2RRUA 1XMOM 3PFIA 3KS4A 4R5EA 1NMWA 3RFWA 2ZR6A 2RUCA 3E46A 1SYTA 1OWQA 5KQDA 4TYOA 2LHCA 3VDPA 1J5EM 2RUDA 3WH0A 4M9XA 3LCUA 3GQ4A 2FKEA 1BVSA 3UQBA 3WL1A 4DR6M 1IY0A 4NXMM 3LMMA 3IKDA 1NVMA 2ERCA 2G3QA 1EHNA 3SATA 2DWLA 2DVWB 2DENA 1DO2A 4NSRA 1D7HA 4G50A 5FTMA 3W4RA 2L6OA 2ETNA 3JR5A 4ODPA 4HEOA 3TE6A 4CISA 5GPGA 5IREB 2CHGA 3HWSA 2F5OA 1E44A 3KFUG 2K47A 1W9UA 2L4FA 4JFKA 1ZBCA 3KDSE 3MJ5A 1XRVA 3TPZA 3IG8A 3HHXA 4DWSD 3O5IA 3KCEA 2JY5A 4IBDA 1FKBA 4MH0E 3GLHB 1PJTA 2O5RA 5EJCA 4DRJA 4RNAA 2MROB 3VFDA 3SYKA 4I81A 1EFUB 1HT2E 3UI6A 1H0IA 4FD2A 4LJ5A 1H0GA 1VF8A 2PN0A 3B9PA 3ARRA 4LAWA 1UR8A 2XP3A 1PBKA 3PA7A 2EKKA 4G3OA 3UI5A 2CV1A 4OW0A 1F40A 5HBFA 3KZ7A 2VQFM 1YSYA 2LWXA 5LMUM 4MNMA 3TWKA 1ZU8A 3HY5A 3Q8GA 1YW5A 1Y8GA 1OGGA 4JI4M 2RSEA 3OTOM 2KR7A 1C7YA 1J09A 2WSCF 3KADA 2FAPA 1XXHE 4LAYA 2KZSA 1D2NA 3K92A 2N35A 3U6MA 4DRIA 1EYMA 2K9DA 2PV3A 3BXWA 3SAWA 3ARXA 1GPFA 1X6LA 1HJPA 1FKGA 3E9SA 2OFNA 3PXGA 2ZM6M 4GC5A 1LL6A 1OGBA 1WAWA 2E5LM 5FLXS 4IT4A 5ITQA 1WGLA 1P3QQ 3HJ8A 3LQRA 4XBOA 1QAMA 1XWIA 4JYAM 3PR9A 1CUKA 2AWGA 1GJSA 3LVVA 3FTFA 3AJIB 4HL4A 2XZFA 2Y21A 3EIHA 3B7ZA 1WNOA 4L4UA 1W1VA 3E4RA 3JYJA 2VN1A 3GLGB 4ODQA 3KVWA 4X65M 3CTWB 2R62A 8CATA 5DFLA 3JAMS 1QZ2A 2OO9A 1IBLM 3L26A 1WB0A 4II7A 2HHHM 3B89A 2V6ZM 1ZQ9A 5FTLA 4WP2A 4K0KM 2ZQTA 2JZVA 2A3EA 2LKNA 1TGUA 1I94M 2Z4RA 5EXPA 3U5ZA 3SHFA 1VG5A 4ANRA 4ZPWR 1W1YA 4LGYA 2FFJA 2KHHA 2DWMA 4DWSB 1NO1A 3GU0A 2BWEA 2QNJA 4LF5M 4DWSC 3AOEA 4NZCA 5LMNM 1NWTA 3AOGA 2F5SA 1ZMUA 4KO8A 1H6UA 4LJ8A 3D8LA 1DGHA 2KRKA 1FKIA 4DIPA 2WSEF 3SC3A 2LVAA 1NNJA 3CF0A 4J4NA 2MJ5B
chains in the Genus database with same CATH topology
3GRVA 3GRUA 2IUZA 1L1PA 2R65A 2XH9A 4CHTB 2ITKA 2LGOA 3O5FA 4IBGA 3DOAA 2FE8A 4LJ4A 1HKIA 3AV0A 4JV5M 3ARZA 3WHKA 3W0FA 1XHGA 2PPNA 2ZQSA 3GPKA 4X66M 1P5QA 5EQTA 2DWNA 4REZA 3JYMA 4B7FA 2EO2A 3SHGB 1KT0A 1SXJD 3Q8XA 3UJNA 4J4OA 1C9HA 4LF6M 5KPRA 5JI2E 3U6CA 2DSWA 1IXRC 3VKGA 4MNLA 3DZDA 1FFQA 4PDIA 3KAFA 3W0LB 4WURA 2XGNA 4B3TM 1CTNA 3D8BA 4BBAA 3GRRA 4KHPM 1Z5BA 4L15A 1KFWA 2VIIA 5EP4A 2C98A 5EXSA 3NI6A 2MLZA 4LFAM 4AI6A 5ITYA 3KP0E 4S3KA 2XF3A 4DV0M 2C5RA 2FNAA 4GHAA 1FNNA 3WL0A 5DEZA 3A42A 1IXZA 4OX9M 3K1JA 3RGSA 2A3BA 1MX0A 3AS1A 1NWRA 1Q6IA 4NSOB 1F8AB 3I6CA 1E32A 1RD6A 1LV7A 4LCBA 5EXTA 3CHEA 4I5SA 2PPPA 4QT2A 1QANA 4Q22A 1IN4A 1PJJA 1FKHA 4M9SA 1LL7A 4IBJA 4MNJA 3RGCA 3ZCBB 1FKJA 2DXIA 1J4IA 2ZANA 3RM8A 4GITA 2F5QA 4XGIA 1R2YA 1K9TA 4FCVA 2F2DA 2H1RA 3B9AA 3J7BA 3ARPA 4W5WA 1EQ3A 4BB9A 1W9PA 1PJIA 3WD3A 3SAUA 2XP5A 1XNRM 4LRTA 5HT1A 3T1HM 3J2PB 1ZBWA 2LH0A 4L8RC 4B7GA 1FJDA 2MPHA 2WLZA 3KAGA 4P8XA 2G8LA 1HNXM 3ARQA 2W82A 1ZK6A 3LVWA 4IBIA 4LF4M 3ARVA 2ZQUA 1A7XA 4MSPA 1G3IA 2P5TA 2XPBA 1SXJB 4S12A 4WW0A 1NHGC 3QAUA 2XP9A 4FN2A 2DG9A 3RGPA 1E9SA 1N78A 3SAVA 4AZFA 4JFMA 3AOEC 4ML4A 4DV4M 5JH8A 1J4HA 2L7HA 1IM2A 1HJXA 1Q39A 1K82A 3VKHA 4JI2M 5B8IC 4TUWA 5DF0A 3UQAA 5GPRA 1E9LA 4JFJA 2M08A 1IBMM 2VCDA 3L2AA 3GLIB 2ZQVA 2RGHA 3R9XB 4TX0A 1EDQA 4R3DA 2YBUA 4A3VB 5DITA 3FTEA 1ROTA 4Z2JA 2X49A 4ITZA 5GQBA 1Z5AA 3B7XA 1N75A 4LGMA 2FOIC 1FKLA 1NY5A 4IIWA 4MGHA 2CFOA 1IX5A 4JFIA 3BOSA 1O6IA 4LAXA 1L1ZA 3FYDA 4ODRA 5ITRA 4QT3A 4DRNA 2C96A 3TCZA 1TH4A 4B08A 4DR7M 1GOIA 1NH6A 2CEAA 1Z5CA 1YUBA 2Z3XA 4ZPXA 1HJWA 2R4JA 3LQQA 1QPFA 1TFVA 4JI7M 1T11A 1IN5A 4MTVA 3TWMA 1ORYB 5BR8M 3J80S 2QF8A 3FUWA 4NRWA 3CZ8A 3HJSA 1Q1CA 4HBOA 1FKSA 3TQSA 3KOZE 3HGIA 4QNRA 2Z7JA 2HL7A 3TC5A 1XMQM 3GP1A 4Q7NA 1QAOA 2ZR4A 4N19A 1LG2A 4IQCA 5ITXA 1G59A 4D81A 2DT1A 2V1UA 2QZ4A 1QVRA 4R0XA 3CF2A 1ZL1A 2PI6A 2K8IA 3J81S 2UZ5A 4DR1M 1ZB5A 2IF4A 2KI3A 5DNYA 1EIBA 4AW4A 4Z2LA 3NWLA 2L09A 4LJ9A 2DZNB 4YY3M 1Q6HA 2WM0A 3GLFA 3GPYA 3THGA 4AKIA 3DFZA 4OVZB 3UMMA 2ZBKB 3U6SA 3KACA 2Y0QA 4LJ6A 1FKTA 1NWSA 2PV2A 4W9OA 1N32M 2CHQA 1ZBVA 3HU3A 1FFRA 2R45A 2OQ4A 4JI3M 4ODLA 3O5LA 4P8VA 5FSWA 2G8ZA 4U84A 2HKJA 5HW8A 1NJGA 3KOXE 4IBKA 4FCTA 1XXHB 4DR5M 3G6MA 4GIVA 3U6LA 1U79A 1QYRA 2M60A 3CF6E 5ITTA 1GKIA 1HJVA 4GC9A 3PRBA 4DV7M 3AL0C 4QIBA 3U6QA 2NQ8C 5HWCA 3J27B 5IT9S 1ZBKA 2WK2A 3TWLA 1G8PA 3I51A 4LRSA 5KPTA 2RQSA 4LF8M 3KOWE 3O5JA 1GL7A 1ROUA 3MDYB 2KO7A 3GPXA 5KPZA 4B3RM 2XP7A 4C02B 3LUOA 1FJGM 5FTNA 4Z2GA 3CHFA 3AQUA 2J7OA 3B9EA 4P16A 2BJVA 4JFLA 3ILKA 1HNWM 3WKZA 2DWZB 5D75A 2XZUA 3TL4X 1Z6TA 3O5QA 4LGXA 1E94E 3U6PA 1D7IA 4URIA 3SMPA 1DO0A 1QPLA 2F4EA 1W5SA 3CHCA 3KS8A 4LG2A 2RKOA 1Y0OA 1R9HA 4B3SM 3KAIA 3U60A 1D6OA 3ARYA 4DRKA 3NBIA 4PTMA 5IWAM 1L2BA 1OJLA 5KO3A 1TH3A 3VK8A 1NSFA 2CHVA 1KSFX 3UQIA 4NOOB 3U6EA 5E6JA 2DT2A 2AHMA 4M0WA 3NTPA 5ITXE 1JNTA 4MPKA 1C1KA 3GRYA 1L8QA 3UZUA 4LF7M 2UU9M 4I8OA 1Q3BA 4PT5A 4AG6A 1X6NA 1ZAEA 4BF8A 3B9DA 4XAKA 5JI3E 2KFWA 3FXYA 2F5NA 4QNMA 3UF8A 1S3SA 4Z8XA 4DV3M 3G6LA 1GL6A 4NNRA 3MHVC 1FKRA 4KR0B 2OPFA 4L16A 3SYLA 4DUZM 2QENA 1L2CA 3A98B 2ZAMA 1IBKM 2O9OA 2D7HA 1NY6A 1Z59A 2D9FA 3UI4A 3ARUA 4DRMA 4TW8A 4NL4H 3AS2A 2M1IA 3O5PA 2R18A 2LJ4A 3UK6A 4R7GA 4G4QA 5DYGA 3GPPA 5C18A 4W9PA 4EIWA 3VDUA 4DH0A 2B31A 3SASA 4DRHA 2N87A 3FUTA 3JXVA 5HWBA 1LQ0A 4D80A 3GQ5A 4MM3B 2G5GX 2G41A 3H9RB 4JN6A 5HUAA 4B7HA 3L25A 1X37A 4GKKM 1Q6UA 2O92A 4P8WA 1W5TA 2XFTA 4LF9M 1GUVA 2XEPA 4IBFA 2KRUA 3C58A 4HARA 1HXVA 3PNVA 2D7EA 3AKZA 2F5PA 1LJYA 2MLYA 3O5GA 3M7GA 4U85A 1E6ZA 1HQCA 1T3TA 1TH2A 3FTCA 1TDZA 4ZPTR 2CUZA 2QCUA 3WHLA 3U61A 1DGBA 2KZUA 2XLJA 4TNSA 3RM4A 2LNHC 4YHHM 4WKAA 1K3XA 3M0EA 4G4NA 3WQWA 3CGNA 4FWGA 2XP6A 3ODKA 1N33M 4NSBA 4G2PA 5J6EA 2XSZA 5DO2A 1HNZM 4ZPVR 4JI0M 1WXQA 3U5ZB 1BL4A 2MLXA 5EP2A 2DHRA 3O5EA 2FDMA 2OLHA 2D7GA 2QBYA 2F21A 4DR3M 1I4WA 3VK7A 1BKFA 1DGHB 3GLGA 1NWUA 1NMVA 4M0DA 3SBJA 4Z2HA 1IQPA 4GGQA 4BLCA 3O5MA 2DT0A 1KYIA 1HR0M 2DSZA 2XFSA 4AQYM 1IY1A 3CH9A 2LXEA 2X8AA 4HLQA 4G4OA 1JR3A 3T38A 1HQYE 4DWSA 1GLNA 1N36M 4FCWA 1XNQM 3OA5A 3IHZA 3J7AS 4LJAA 3GQ3A 2XSZD 1N1AA 3SMSA 1IY2A 2QPAA 3WQVA 4DUYM 3NRKA 3VAWA 4KQZA 2DG3A 3EIEA 3FKEA 4JI5M 1K3WA 1DGGA 3O5DA 2KA6B 2DT3A 4LAVA 4PD2A 2UUCM 2F4VM 4RF0A 4LFCM 1HT1E 4IPXA 2LPVA 4G4RA 3HJQA 2JA2A 2R4EA 1QQWA 1IN7A 1JNSA 4LZZA 1N77A 2Q2EB 3ZC7B 5H37D 2I7NA 5GKNA 4ODMA 4DR2M 4KODA 3WD4A 4JI6M 4FAPA 7CATA 2L2SA 4GRIA 1DGFA 2KXEA 2A3AA 2UXBM 4HBEA 3CHDA 1JR3D 4WJXA 4M9ZA 5E26A 1E6PA 4DV2M 2ESCA 1R7RA 3PVSA 3K2LA 4JI1M 3L28A 1FKFA 4IBBA 2DZOB 2RGOA 4FVMA 4MGKE 3SARA 5DYIA 3PRAA 4MGYE 3QWLA 4L72B 1IXSB 3ALFA 3KW6A 4QHSA 4QZVB 1JVWA 1NJFA 3JR4A 5EXXA 4O2TA 2HCBA 1E9RA 2BNKA 2C99A 4AG5A 3R8FA 5FTJA 1W1PA 4X62M 4GIPA 4WK9A 5EP1A 3IG5A 4TW7A 4DZ3A 3FUUA 3U61B 2PV1A 2Z4SA 1FAPA 5DIUA 1MU5A 4Z2KA 2A3CA 1QAQA 4LFBM 1YE9A 4ODOA 2L7IA 3FY1A 5I98A 2DSUA 5ITUA 3HU1A 3RMEA 2YR0A 4G6ZA 4RF1A 1YATA 4MGZE 3RM9A 2BJWA 4GH9A 4I4LA 2QBYB 1NNUC 1TCOC 3FYCA 3K8ZA 3EY6A 4IT6A 2KGJA 3GO8A 4PDGA 2V1CA 3I4YA 4DZ2A 3O5OA 4NXNM 2KW0A 1E15A 1HKKA 1XHBA 2EA0A 2AOSA 4PCZA 5IZ7D 5HW7A 1FKDA 4IQ2A 3HHZA 3U6DA 1B6CA 1SXJA 4JI8M 4ITQA 1GVNA 1XC8A 3AFHA 3KABA 4CGYB 3MK6A 1E6RA 5BPVA 1E6NA 2YQZA 3HHYA 3FAPA 4DV1M 2MNTA 2PBCA 4NRVA 2EUCA 1J6YA 2VQEM 4W5UA 2RURA 4LJ7A 3H4MA 1LL4A 5FTKA 3KOYE 1JNEA 3TDBA 4GMQA 1JQJC 3AS3A 3WD2A 3VLFB 1ITXA 2Q5AA 2DPEA 1J4RA 1N34M 3GLIA 5DIVA 4OU7A 2A5YB 2YBTA 3A46A 1FKKA 4IJEA 2Y20A 4MGIE 4JYSA 4DT4A 4GKJM 4DRQA 1G4AE 5F3WA 1W1TA 3FTDA 1FD9A 3ARWA 4KLNA 4D82A 2ZAOA 3U6OA 2XPAA 4Z2IA 1J7KA 4AY1A 4MB7A 3B8SA 1OFHA 4ZS6A 4LY6A 2YNMD 3KP1E 4MAVA 2CV0A 3WD0A 1SR0A 1UR9A 1KFVA 4QHTA 1HKJA 3HHWA 5A2QS 4Z6YA 5BXJA 4P8UA 4WKFA 3L27A 4IBEA 3ALGA 4QOSA 1PM5A 3L29A 2Y78A 4WIWA 2C9CA 3GLHA 3WIJA 3FD9A 4IBCA 4DV5M 5KQ8A 4FW9A 3GLFB 4DROA 3WD1A 4MNKA 2XP8A 1EE8A 4GHLA 3KSJA 3UGJA 1LG1A 1G41A 3KSXA 3IKGA 1R6BX 2WLYA 2UUAM 4L3NA 3FUXA 3RE8A 4DV6M 2DG4A 4MGVA 2UXDM 4TW6A 4WKHA 2M5ZA 1SXJE 2I7PA 3FUVA 2CE7A 4B3MM 1ZCNA 2R46A 1D7JA 3SFZA 3KAHA 2X4AA 4OVZA 5EP3A 1UM8A 2M2AA 2UXCM 1JNDA 1PINA 1TDHA 2YFQA 2C9OA 3OOBA 3HU2A 1Q3CA 3ZH9B 1W9VA 4X64M 3PRDA 3ARSA 1M5YA 3PNYA 2MF9A 4FWDA 4IJFA 1W26A 2UUBM 1KT1A 1XXHA 4S3JA 2XP4A 4ODKA 3I4VA 3IK8A 1VDDA 3KXEC 1R2ZA 4FWHA 3A45A 2RUQA 1SXJC 3GPUA 3ARTA 3HKPA 1HKMA 1IN6A 1L2DA 3O5RA 4L78A 4DRPA 5C1BA 1QZMA 3AROA 3M6AA 3T15A 1IN8A 1L1TA 2DSVA 1NSGA 3QOKA 1OFIA 4U86A 5HTGA 3AS0A 3U60B 3DA1A 4ODNA 2KE0A 4QOZC 2J7NA 2CV2A 4JXJA 3O5KA 4W9QA 4AKGA 5HKGA 2ZR5A 2KEBA 1D2KA 5HW6A 3T1YM 4LZJA 2PPOA 4AKHA 2Y0TA 3CGMA 1NHWC 2QP9X 4DR4M 1XMOM 3PFIA 3KS4A 4R5EA 1NMWA 3RFWA 2ZR6A 2RUCA 1SYTA 1OWQA 5KQDA 4TYOA 3VDPA 1J5EM 2RUDA 3WH0A 4M9XA 3GQ4A 2FKEA 3UQBA 3WL1A 4DR6M 1IY0A 4NXMM 3LMMA 3IKDA 1NVMA 2ERCA 1EHNA 3SATA 2DWLA 2DVWB 1DO2A 4NSRA 1D7HA 4G50A 5FTMA 3W4RA 2L6OA 3JR5A 4ODPA 3TE6A 4CISA 5GPGA 5IREB 2CHGA 3HWSA 2F5OA 3KFUG 2K47A 1W9UA 4JFKA 1ZBCA 3KDSE 3MJ5A 1XRVA 3TPZA 3IG8A 3HHXA 4DWSD 3O5IA 3KCEA 4IBDA 1FKBA 4MH0E 3GLHB 2O5RA 5EJCA 4DRJA 4RNAA 3VFDA 3SYKA 4I81A 1HT2E 3UI6A 1H0IA 4FD2A 4LJ5A 1H0GA 1VF8A 3B9PA 3ARRA 4LAWA 1UR8A 2XP3A 1PBKA 3PA7A 3UI5A 2CV1A 4OW0A 1F40A 5HBFA 3KZ7A 2VQFM 1YSYA 2LWXA 5LMUM 4MNMA 3TWKA 1ZU8A 1YW5A 1OGGA 4JI4M 2RSEA 3OTOM 2KR7A 1J09A 3KADA 2FAPA 4LAYA 2KZSA 1D2NA 3K92A 3U6MA 4DRIA 1EYMA 2PV3A 3BXWA 3SAWA 3ARXA 1GPFA 1X6LA 1FKGA 3E9SA 2OFNA 3PXGA 2ZM6M 4GC5A 1LL6A 1OGBA 1WAWA 2E5LM 5FLXS 4IT4A 5ITQA 3HJ8A 3LQRA 4XBOA 1QAMA 1XWIA 4JYAM 3PR9A 2AWGA 3LVVA 3FTFA 3AJIB 4HL4A 2XZFA 2Y21A 3EIHA 1WNOA 4L4UA 1W1VA 3E4RA 3JYJA 2VN1A 3GLGB 4ODQA 3KVWA 4X65M 3CTWB 2R62A 8CATA 3JAMS 1QZ2A 1IBLM 3L26A 1WB0A 4II7A 2HHHM 2V6ZM 1ZQ9A 5FTLA 4K0KM 2ZQTA 2JZVA 2A3EA 2LKNA 1TGUA 1I94M 2Z4RA 5EXPA 3U5ZA 3SHFA 4ZPWR 1W1YA 4LGYA 2FFJA 2DWMA 4DWSB 4LF5M 4DWSC 3AOEA 4NZCA 5LMNM 1NWTA 3AOGA 2F5SA 4KO8A 1H6UA 4LJ8A 3D8LA 1DGHA 2KRKA 1FKIA 4DIPA 3SC3A 1NNJA 3CF0A 4J4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TCO C;  2XPB A;  3EY6 A;  4U86 A;  3IKG A;  4TNS A;  2KGJ A;  4JYS A;  4DT4 A;  4JFK A;  1L1P A;  3IHZ A;  5HTG A;  1Q6H A;  2ITK A;  2LGO A;  1N1A A;  4JFL A;  4ODN A;  2KE0 A;  3O5F A;  4DRQ A;  3O5I A;  1Q6I A;  4DZ2 A;  3KCE A;  3NRK A;  3O5O A;  3VAW A;  1F8A B;  3CGN A;  3I6C A;  1FD9 A;  2DG3 A;  3KAC A;  5D75 A;  2XP9 A;  1FKB A;  2AWG A;  1QPF A;  3O5Q A;  2XP6 A;  3O5K A;  2DG4 A;  4FN2 A;  4MGV A;  2D9F A;  2DG9 A;  1D7I A;  1FKT A;  2PPP A;  2PV2 A;  3O5D A;  3ODK A;  4W9Q A;  5HKG A;  2XPA A;  1QPL A;  2F4E A;  2ZR5 A;  4QT2 A;  4TW6 A;  4W9O A;  3UI4 A;  4G2P A;  5HW7 A;  1JVW A;  4DRJ A;  5J6E A;  4LAV A;  4O2T A;  1FKD A;  4IQ2 A;  4DRM A;  5HW6 A;  4JFM A;  1B6C A;  2PPN A;  1T11 A;  4TW8 A;  2ZQS A;  2M1I A;  1FKH A;  3O5P A;  3GPK A;  1J4H A;  3UI6 A;  2LJ4 A;  1Y0O A;  1R9H A;  3JYJ A;  1P5Q A;  2VN1 A;  2PPO A;  3KAI A;  4ODL A;  3CGM A;  1ZCN A;  3O5L A;  4W9P A;  4ODQ A;  3RGC A;  1D7J A;  1D6O A;  1FKJ A;  3KAH A;  4IPX A;  1J4I A;  2LPV A;  4U84 A;  5HW8 A;  3JYM A;  4LAW A;  4DH0 A;  2XP3 A;  2M2A A;  4DRK A;  1KT0 A;  1PBK A;  4DRH A;  5B8I C;  1PIN A;  1QZ2 A;  1BL4 A;  3UQA A;  2N87 A;  2MLX A;  3KAB A;  3PA7 A;  2F2D A;  4TW7 A;  4DZ3 A;  1Q1C A;  3JXV A;  1C9H A;  4J4O A;  3UI5 A;  5HWB A;  3OOB A;  1F40 A;  1JNS A;  3O5E A;  1NMW A;  1FKS A;  3KZ7 A;  4GIV A;  5BXJ A;  4JFJ A;  3RFW A;  3H9R B;  2F21 A;  1U79 A;  2RUC A;  2M08 A;  2ZR6 A;  3UQI A;  2PV1 A;  2ZQT A;  5HUA A;  3TC5 A;  1FAP A;  2JZV A;  2VCD A;  1BKF A;  3FAP A;  5DIU A;  2MNT A;  2PBC A;  2ZR4 A;  3PRD A;  4ODM A;  1YW5 A;  3KAF A;  2LKN A;  4TYO A;  4N19 A;  2Y78 A;  1EQ3 A;  2ZQV A;  3NTP A;  2RSE A;  2RUD A;  4TX0 A;  3WH0 A;  1Q6U A;  1NMV A;  2XP5 A;  1J6Y A;  2KR7 A;  1JNT A;  2FKE A;  4IQC A;  1M5Y A;  3UQB A;  5HT1 A;  2RUR A;  4GGQ A;  2MF9 A;  1ROT A;  5DIT A;  3KAD A;  2FAP A;  3IKD A;  1W26 A;  3O5M A;  4ITZ A;  3B7X A;  4LAY A;  4ODO A;  1KT1 A;  3PRB A;  4R0X A;  4FAP A;  4QIB A;  1HXV A;  2L2S A;  2XP4 A;  4ODK A;  4DRI A;  1EYM A;  1FKL A;  3TDB A;  1FJD A;  2MPH A;  3IK8 A;  1D7H A;  5HWC A;  2K8I A;  2MLY A;  3KAG A;  5I98 A;  2PV3 A;  4G50 A;  4BF8 A;  2UZ5 A;  2RUQ A;  3NI6 A;  3O5G A;  2Q5A A;  4U85 A;  1J4R A;  4DRO A;  5DIV A;  2MLZ A;  4JFI A;  1ZK6 A;  2KFW A;  4LAX A;  1YAT A;  2IF4 A;  3UF8 A;  1FKI A;  3O5R A;  2KI3 A;  4ODR A;  1FKG A;  4DIP A;  4QT3 A;  4DRP A;  2RQS A;  4ODP A;  2OFN A;  4DRN A;  2ZQU A;  3O5J A;  1A7X A;  4NNR A;  1ROU A;  2XP8 A;  4MSP A;  5GPG A;  3TCZ A;  1FKK A;  3MDY B;  4J4N A;  2KO7 A;  4C02 B;  2XP7 A;  1FKF A;  1NSG A;  1FKR A;  3LUO A; 
#chains in the Genus database with same CATH topology
 2EKF A;  3GRV A;  2DKL A;  3GRU A;  1TTE A;  1D0L A;  2IUZ A;  1L1P A;  2R65 A;  2XH9 A;  2KNA A;  4CHT B;  2ITK A;  2LGO A;  3O5F A;  4IBG A;  3DOA A;  2FE8 A;  2R0I A;  4LJ4 A;  1HKI A;  3AV0 A;  2H5X A;  2K6B A;  4JV5 M;  1QUS A;  3ARZ A;  3WHK A;  3W0F A;  1XHG A;  2PPN A;  2ZQS A;  3GPK A;  4X66 M;  1P5Q A;  5EQT A;  2DWN A;  4REZ A;  3JYM A;  4B7F A;  2EO2 A;  3SHG B;  1KT0 A;  1SXJ D;  3Q8X A;  3UJN A;  4J4O A;  1C9H A;  4LF6 M;  5KPR A;  5JI2 E;  3U6C A;  2DSW A;  1IXR C;  3VKG A;  4MNL A;  3DZD A;  1FFQ A;  4PDI A;  3KAF A;  3W0L B;  4WUR A;  2XGN A;  4B3T M;  1CTN A;  1QDR A;  3D8B A;  4BBA A;  3GRR A;  3QYE A;  4KHP M;  2GNO A;  1Z5B A;  4L15 A;  1KFW A;  2VII A;  5EP4 A;  2C98 A;  2B3T A;  3GLF E;  5EXS A;  3NI6 A;  2MLZ A;  4LFA M;  4AI6 A;  5ITY A;  3KP0 E;  4S3K A;  1WIV A;  2XF3 A;  4DV0 M;  2C5R A;  2FNA A;  2DHY A;  4GHA A;  1FNN A;  3WL0 A;  3B7N A;  5DEZ A;  3A42 A;  1IXZ A;  4OX9 M;  3K1J A;  3RGS A;  2A3B A;  1MX0 A;  3AS1 A;  1NWR A;  1Q6I A;  4NSO B;  1F8A B;  3I6C A;  1E32 A;  1RD6 A;  1LV7 A;  4LCB A;  3EIP A;  5EXT A;  3CHE A;  4I5S A;  2PPP A;  1OIP A;  4QT2 A;  1QAN A;  4Q22 A;  1IN4 A;  1PJJ A;  1FKH A;  4M9S A;  1LL7 A;  4IBJ A;  2DAG A;  4MNJ A;  2BWB A;  3RGC A;  3ZCB B;  1FKJ A;  2DXI A;  1J4I A;  2ZAN A;  3RM8 A;  1IXS A;  4GIT A;  2F5Q A;  4XGI A;  1R2Y A;  1K9T A;  4FCV A;  2F2D A;  2H1R A;  3B9A A;  3J7B A;  1QDT A;  3ARP A;  4W5W A;  3HX3 A;  2MH8 A;  1V33 A;  4UDM A;  1EQ3 A;  4BB9 A;  1W9P A;  1PJI A;  3WD3 A;  3SAU A;  2XP5 A;  1XNR M;  1DV0 A;  4LRT A;  5HT1 A;  3T1H M;  3J2P B;  1ZBW A;  2LH0 A;  4L8R C;  2O01 F;  4B7G A;  1FJD A;  2MPH A;  2WLZ A;  3KAG A;  4P8X A;  2G8L A;  1HNX M;  3ARQ A;  2W82 A;  1ZK6 A;  3LVW A;  4IBI A;  4LF4 M;  3K9P A;  2L2D A;  3ARV A;  2ZQU A;  1A7X A;  4MSP A;  1G3I A;  2GQF A;  4CIZ A;  2P5T A;  2XPB A;  1SXJ B;  4S12 A;  4WW0 A;  1NHG C;  3QAU A;  3I01 M;  2XP9 A;  4FN2 A;  2DG9 A;  3RGP A;  1E9S A;  1N78 A;  3SAV A;  4AZF A;  4JFM A;  3AOE C;  4ML4 A;  4DV4 M;  5JH8 A;  1J4H A;  2L7H A;  1IM2 A;  1HJX A;  1Q39 A;  1K82 A;  3K9O A;  3VKH A;  4JI2 M;  5B8I C;  4TUW A;  5DF0 A;  3UQA A;  5GPR A;  3IEC A;  2JY7 A;  1E9L A;  4JFJ A;  2M08 A;  1IBM M;  2VCD A;  3L2A A;  4NC6 A;  3GLI B;  2ZQV A;  2RGH A;  3R9X B;  4TX0 A;  1EDQ A;  4R3D A;  2YBU A;  3C9P A;  1OIZ A;  4A3V B;  5DIT A;  1V34 A;  3FTE A;  1ROT A;  1GJT A;  4Z2J A;  2X49 A;  4ITZ A;  3B7X A;  1Z5A A;  5GQB A;  1N75 A;  4LGM A;  2FOI C;  1FKL A;  1NY5 A;  4IIW A;  4MGH A;  1R5L A;  2CFO A;  1IX5 A;  4JFI A;  3BOS A;  1O6I A;  4LAX A;  1L1Z A;  3FYD A;  4ODR A;  5ITR A;  4QT3 A;  4DRN A;  2C96 A;  2KDL A;  3TCZ A;  1TH4 A;  3V76 A;  4B08 A;  4DR7 M;  1GOI A;  1NH6 A;  2CEA A;  1Z5C A;  1Q02 A;  1YUB A;  2Z3X A;  4ZPX A;  1HJW A;  1SG9 A;  2R4J A;  4DBG B;  3LQQ A;  1QPF A;  1TFV A;  4JI7 M;  1T11 A;  1IN5 A;  4MTV A;  3TWM A;  1ORY B;  5BR8 M;  2Z8Y M;  3J80 S;  2QF8 A;  3BMB A;  3FUW A;  4NRW A;  3CZ8 A;  2J5Y A;  3CGW A;  3HJS A;  1Q1C A;  4HBO A;  1FKS A;  3TQS A;  3KOZ E;  3HGI A;  4QNR A;  2Z7J A;  2HL7 A;  3TC5 A;  1XMQ M;  3GP1 A;  2LTU A;  2R6F A;  2EUL A;  1QAO A;  2ZR4 A;  4Q7N A;  4N19 A;  1LG2 A;  4IQC A;  5ITX A;  1T6O A;  1G59 A;  4D81 A;  2DT1 A;  3F92 A;  2QZ4 A;  1QVR A;  2V1U A;  4R0X A;  3CF2 A;  2QQ8 A;  1D0K A;  1ZL1 A;  2PI6 A;  2K8I A;  3J81 S;  2UZ5 A;  4DR1 M;  1ZB5 A;  2IF4 A;  2KI3 A;  2JP7 A;  2JXN A;  2FH0 A;  1NV8 A;  5DNY A;  1PJS A;  1EIB A;  4AW4 A;  4Z2L A;  3NWL A;  2L09 A;  4LJ9 A;  2DZN B;  4YY3 M;  3FRI A;  1Q6H A;  2WM0 A;  3GLF A;  3GPY A;  3THG A;  4AKI A;  3DFZ A;  4OVZ B;  3UMM A;  2ZBK B;  3U6S A;  3KAC A;  2Y0Q A;  4LJ6 A;  2CP8 A;  1FKT A;  1NWS A;  2PV2 A;  4W9O A;  1ZV1 A;  1N32 M;  2CHQ A;  1ZBV A;  3HU3 A;  1FFR A;  2R45 A;  2OQ4 A;  3GLG E;  4JI3 M;  4ODL A;  3O5L A;  4P8V A;  5FSW A;  2G8Z A;  4U84 A;  2HKJ A;  5HW8 A;  1NJG A;  3KOX E;  2F23 A;  4IBK A;  4FCT A;  1XXH B;  4DR5 M;  3G6M A;  2VF7 A;  4GIV A;  3U6L A;  1U79 A;  1QYR A;  2M60 A;  1D0M A;  3CF6 E;  2JY8 A;  5ITT A;  1GKI A;  1HJV A;  4GC9 A;  3PRB A;  4DV7 M;  3AL0 C;  4QIB A;  3U6Q A;  2NQ8 C;  1RU3 A;  5HWC A;  3J27 B;  5IT9 S;  2DI0 A;  1PRB A;  1ZBK A;  2WK2 A;  3TWL A;  1G8P A;  3I51 A;  3HZJ A;  1PJQ A;  4LRS A;  5KPT A;  2RQS A;  4LF8 M;  3KOW E;  3O5J A;  1GL7 A;  1ROU A;  4L6V 6;  3MDY B;  2KO7 A;  3GPX A;  5KPZ A;  4B3R M;  2XP7 A;  4C02 B;  3LUO A;  1FJG M;  5FTN A;  4Z2G A;  3CHF A;  3AQU A;  1F4I A;  2J7O A;  1AUA A;  3B9E A;  4P16 A;  2BJV A;  2DAI A;  1QUT A;  4JFL A;  3ILK A;  1HNW M;  3WKZ A;  2DWZ B;  1JB0 F;  5D75 A;  2XZU A;  1JCH B;  3TL4 X;  1Z6T A;  3O5Q A;  4LGX A;  1E94 E;  3U6P A;  1D7I A;  4URI A;  3SMP A;  1DO0 A;  1QPL A;  2F4E A;  1W5S A;  3CHC A;  3KS8 A;  4LG2 A;  3B74 A;  2RKO A;  1Y0O A;  1R9H A;  4B3S M;  3KAI A;  2MR9 A;  3U60 A;  4UN2 B;  1D6O A;  3ARY A;  4DRK A;  3NBI A;  4PTM A;  1GRJ A;  5IWA M;  3FRH A;  1L2B A;  1OJL A;  5KO3 A;  1TH3 A;  3VK8 A;  1NSF A;  2CHV A;  1KSF X;  3UQI A;  1G71 A;  4NOO B;  3U6E A;  5E6J A;  2DT2 A;  2AHM A;  4M0W A;  3NTP A;  5ITX E;  1JNT A;  4MPK A;  1C1K A;  1T43 A;  3GRY A;  1L8Q A;  3UZU A;  4LF7 M;  2UU9 M;  4I8O A;  1Q3B A;  4PT5 A;  4AG6 A;  1X6N A;  1ZAE A;  4BF8 A;  3B9D A;  4XAK A;  5JI3 E;  1OAI A;  2KFW A;  4F2L A;  3FXY A;  2F5N A;  4QNM A;  3UF8 A;  1S3S A;  4Z8X A;  4DV3 M;  3G6L A;  1GL6 A;  4NNR A;  4R71 A;  3MHV C;  1FKR A;  1LTM A;  4KR0 B;  2OPF A;  4L16 A;  3SYL A;  4DUZ M;  2QEN A;  1L2C A;  3A98 B;  2ZAM A;  1IBK M;  4P17 A;  2O9O A;  2D7H A;  1NY6 A;  1Z59 A;  1NV9 A;  2D9F A;  2MGW A;  3MMP A;  3UI4 A;  3ARU A;  4DRM A;  1WHC A;  2WSF F;  4NL4 H;  4TW8 A;  3AS2 A;  2M1I A;  3O5P A;  2R18 A;  2LJ4 A;  3UK6 A;  4R7G A;  4G4Q A;  5DYG A;  3GPP A;  5C18 A;  4W9P A;  4EIW A;  3VDU A;  1OTR A;  4DH0 A;  2B31 A;  3SAS A;  4DRH A;  2N87 A;  2L4E A;  3FUT A;  3JXV A;  5HWB A;  1LQ0 A;  4D80 A;  3GQ5 A;  4MM3 B;  2G5G X;  2G41 A;  3H9R B;  4JN6 A;  5HUA A;  3ZQJ A;  4B7H A;  5L8R F;  3L25 A;  1X37 A;  4GKK M;  1Q6U A;  3GTY X;  2O92 A;  4P8W A;  2B5U B;  1W5T A;  2XFT A;  4LF9 M;  1GUV A;  2XEP A;  4IBF A;  2KRU A;  3C58 A;  4HAR A;  1HXV A;  3PNV A;  2D7E A;  3AKZ A;  2F5P A;  1LJY A;  2MLY A;  3O5G A;  3M7G A;  4U85 A;  1E6Z A;  2LVN C;  1HQC A;  1T3T A;  1TH2 A;  3FTC A;  1TDZ A;  4ZPT R;  2VDB B;  2CUZ A;  2QCU A;  3WHL A;  3U61 A;  1DGB A;  2KZU A;  2XLJ A;  4TNS A;  3RM4 A;  1R4G A;  2LNH C;  4YHH M;  4WKA A;  1K3X A;  3M0E A;  4G4N A;  3WQW A;  3CGN A;  4FWG A;  2XP6 A;  3ODK A;  1N33 M;  4NSB A;  4G2P A;  3LCV B;  5J6E A;  2XSZ A;  3QYB A;  5DO2 A;  1HNZ M;  2HWJ A;  3T6P A;  4ZPV R;  4JI0 M;  1WXQ A;  3U5Z B;  4RKU F;  2QSF X;  4GEW A;  1BL4 A;  2MLX A;  3W68 A;  5EP2 A;  2DAE A;  2DHR A;  2LHG A;  3O5E A;  2FDM A;  2OLH A;  2D7G A;  2QBY A;  2F21 A;  4DR3 M;  1I4W A;  3VK7 A;  1BKF A;  1DGH B;  3GLG A;  1NWU A;  1VEJ A;  1NMV A;  4M0D A;  3H4J A;  3SBJ A;  4Z2H A;  1IQP A;  4GGQ A;  2CRU A;  4BLC A;  3O5M A;  2DT0 A;  1KYI A;  1HR0 M;  1VEG A;  2DSZ A;  2XFS A;  4AQY M;  1IY1 A;  3CH9 A;  2LXE A;  2LVO C;  2ZTD A;  2X8A A;  3W67 A;  4HLQ A;  4G4O A;  1JR3 A;  3T38 A;  1HQY E;  4DWS A;  1GLN A;  1N36 M;  4FCW A;  1XNQ M;  2JZ0 A;  2FS1 A;  3OA5 A;  3IHZ A;  1WJ7 A;  1OAO C;  3J7A S;  4LJA A;  1YLA A;  2XSZ D;  3GQ3 A;  1N1A A;  3SMS A;  1IY2 A;  2QPA A;  3WQV A;  4DUY M;  3NRK A;  3VAW A;  1ZMV A;  2OOA A;  2DG3 A;  4KQZ A;  3EIE A;  3FKE A;  3NBX X;  4JI5 M;  1K3W A;  2LBC A;  1DGG A;  3O5D A;  2KA6 B;  2DT3 A;  4LAV A;  4PD2 A;  2VF8 A;  2UUC M;  2QHO B;  2F4V M;  4RF0 A;  4LFC M;  1HT1 E;  1XB2 B;  4IPX A;  2LPV A;  4G4R A;  3HJQ A;  2JA2 A;  2KNV A;  2R4E A;  3GLH E;  1QQW A;  1IN7 A;  1JNS A;  4LZZ A;  1N77 A;  2Q2E B;  3ZC7 B;  5H37 D;  1WGN A;  2I7N A;  5GKN A;  4ODM A;  1EIJ A;  1UFZ A;  2LVP C;  4DR2 M;  4Q7J A;  2R44 A;  4KOD A;  3WD4 A;  4JI6 M;  4FAP A;  7CAT A;  2L2S A;  4GRI A;  1DGF A;  2KXE A;  1GO5 A;  1VDL A;  3BBZ A;  2A3A A;  2UXB M;  4HBE A;  3CHD A;  1JR3 D;  2DAM A;  4M9Z A;  4WJX A;  5E26 A;  1E6P A;  3B7Q A;  4DV2 M;  2K0B X;  2ESC A;  1R7R A;  3PVS A;  3K2L A;  4JI1 M;  3L28 A;  1FKF A;  4IBB A;  2DZO B;  2RGO A;  4FVM A;  4MGK E;  3SAR A;  5DYI A;  3PRA A;  4MGY E;  3QWL A;  4L72 B;  1IXS B;  3ALF A;  2DNA A;  3KW6 A;  4QHS A;  4QZV B;  1JVW A;  1NJF A;  3JR4 A;  5EXX A;  4O2T A;  2HCB A;  1E9R A;  2BNK A;  2C99 A;  2JY6 B;  4AG5 A;  3R8F A;  5FTJ A;  1W1P A;  4X62 M;  4GIP A;  4WK9 A;  5EP1 A;  3IG5 A;  4TW7 A;  4DZ3 A;  3FUU A;  3U61 B;  2EJS A;  2PV1 A;  2Z4S A;  1FAP A;  5DIU A;  1MU5 A;  4Z2K A;  2A3C A;  1IFY A;  1QAQ A;  4LFB M;  1YE9 A;  4ODO A;  2L7I A;  3FY1 A;  5I98 A;  2DSU A;  5ITU A;  3HU1 A;  3RME A;  2YR0 A;  4G6Z A;  4RF1 A;  1YAT A;  4MGZ E;  3RM9 A;  1JR3 E;  2BJW A;  4GH9 A;  4I4L A;  2QBY B;  1NNU C;  1TCO C;  3FYC A;  3K8Z A;  3EY6 A;  1V92 A;  4IT6 A;  2KGJ A;  3GO8 A;  4PDG A;  2V1C A;  3I4Y A;  2JZ1 A;  4DZ2 A;  3O5O A;  4NXN M;  2KW0 A;  1E15 A;  1HKK A;  1XHB A;  2EA0 A;  2AOS A;  4PCZ A;  5IZ7 D;  5HW7 A;  1FKD A;  4IQ2 A;  1A5T A;  3HHZ A;  3U6D A;  1B6C A;  1SXJ A;  4JI8 M;  4ITQ A;  1GVN A;  1XC8 A;  3AFH A;  3KAB A;  4CGY B;  2WZJ A;  3MK6 A;  1E6R A;  5BPV A;  1E6N A;  3I04 M;  2YQZ A;  3HHY A;  3FAP A;  4DV1 M;  2MNT A;  2PBC A;  4NRV A;  2JNH A;  2EUC A;  1J6Y A;  2VQE M;  4W5U A;  3FE3 A;  2RUR A;  4LJ7 A;  3H4M A;  1LL4 A;  1PGY A;  3KOY E;  5FTK A;  1JNE A;  3TDB A;  4GMQ A;  1JQJ C;  3LW5 F;  3AS3 A;  3WD2 A;  2HAK A;  3VLF B;  1ITX A;  2Q5A A;  2DPE A;  1J4R A;  1N34 M;  3GLI A;  5DIV A;  1WR1 B;  4OU7 A;  2A5Y B;  2YBT A;  3A46 A;  1FKK A;  4IJE A;  2Y20 A;  4MGI E;  4JYS A;  4DT4 A;  1MN3 A;  4GKJ M;  4DRQ A;  1G4A E;  5F3W A;  1W1T A;  3FTD A;  1FD9 A;  3ARW A;  4KLN A;  4D82 A;  2ZAO A;  2APL A;  3U6O A;  2XPA A;  4Z2I A;  1J7K A;  4AY1 A;  2OOB A;  2JWS A;  4MB7 A;  3B8S A;  1OFH A;  4ZS6 A;  4LY6 A;  2YNM D;  3KP1 E;  4MAV A;  1AIP C;  2CV0 A;  3WD0 A;  1SR0 A;  1UR9 A;  1KFV A;  4QHT A;  1HKJ A;  3HHW A;  5A2Q S;  4Z6Y A;  5BXJ A;  4P8U A;  4WKF A;  3L27 A;  4IBE A;  3ALG A;  4QOS A;  1PM5 A;  3L29 A;  2Y78 A;  4WIW A;  1TR8 A;  2C9C A;  3GLH A;  3WIJ A;  3FD9 A;  4IBC A;  1GAB A;  4DV5 M;  5KQ8 A;  4FW9 A;  3GLF B;  4DRO A;  1MJG M;  3WD1 A;  4MNK A;  2XP8 A;  1EE8 A;  4GHL A;  2ZTC A;  3KSJ A;  3UGJ A;  1LG1 A;  1G41 A;  3KSX A;  3IKG A;  1R6B X;  1QZE A;  2WLY A;  2UUA M;  4L3N A;  3FUX A;  3RE8 A;  4DV6 M;  2P4V A;  4F1I A;  2DG4 A;  4MGV A;  2UXD M;  4TW6 A;  4WKH A;  2M5Z A;  1SXJ E;  2I7P A;  3FUV A;  2CE7 A;  4B3M M;  1ZCN A;  2R46 A;  1D7J A;  3SFZ A;  3KAH A;  1OKS A;  1VEK A;  2X4A A;  4OVZ A;  5EP3 A;  1UM8 A;  1ZMW A;  2M2A A;  2UXC M;  1JND A;  1PIN A;  1TDH A;  2YFQ A;  2C9O A;  3OOB A;  3HU2 A;  1Q3C A;  4KT0 F;  3ZH9 B;  1W9V A;  4X64 M;  2O25 A;  3C3E A;  3PRD A;  4CJ6 A;  3ARS A;  2KNZ A;  2DZL A;  1M5Y A;  3PNY A;  2MF9 A;  4FWD A;  4IJF A;  1W26 A;  2UUB M;  1KT1 A;  1XXH A;  2DAK A;  4S3J A;  2XP4 A;  4ODK A;  3I4V A;  3IK8 A;  3C3D A;  1VDD A;  3KXE C;  1R2Z A;  4FWH A;  3A45 A;  3IHP A;  2RUQ A;  3GLI E;  1SXJ C;  3GPU A;  2JUJ A;  1OQY A;  3ART A;  3HKP A;  1HKM A;  1IN6 A;  1L2D A;  3O5R A;  4L78 A;  4DRP A;  5C1B A;  2LVQ D;  1QZM A;  3ARO A;  3M6A A;  3T15 A;  1IN8 A;  1L1T A;  2DSV A;  1NSG A;  1VQ1 A;  3QOK A;  1OFI A;  4U86 A;  1TF0 B;  5HTG A;  3AS0 A;  4XK8 F;  3U60 B;  3DA1 A;  4ODN A;  2KE0 A;  4QOZ C;  2J7N A;  2CV2 A;  4JXJ A;  3O5K A;  4W9Q A;  4AKG A;  5HKG A;  2ZR5 A;  2KEB A;  3E21 A;  1D2K A;  5HW6 A;  2CWB A;  4Y28 F;  3T1Y M;  4LZJ A;  2PPO A;  4AKH A;  2Y0T A;  3CGM A;  1NHW C;  2QP9 X;  4DR4 M;  2RRU A;  1XMO M;  3PFI A;  3KS4 A;  4R5E A;  1NMW A;  3RFW A;  2ZR6 A;  2RUC A;  3E46 A;  1SYT A;  1OWQ A;  5KQD A;  4TYO A;  2LHC A;  3VDP A;  1J5E M;  2RUD A;  3WH0 A;  4M9X A;  3LCU A;  3GQ4 A;  2FKE A;  1BVS A;  3UQB A;  3WL1 A;  4DR6 M;  1IY0 A;  4NXM M;  3LMM A;  3IKD A;  1NVM A;  2ERC A;  2G3Q A;  1EHN A;  3SAT A;  2DWL A;  2DVW B;  2DEN A;  1DO2 A;  4NSR A;  1D7H A;  4G50 A;  5FTM A;  3W4R A;  2L6O A;  2ETN A;  3JR5 A;  4ODP A;  4HEO A;  3TE6 A;  4CIS A;  5GPG A;  5IRE B;  2CHG A;  3HWS A;  2F5O A;  1E44 A;  3KFU G;  2K47 A;  1W9U A;  2L4F A;  4JFK A;  1ZBC A;  3KDS E;  3MJ5 A;  1XRV A;  3TPZ A;  3IG8 A;  3HHX A;  4DWS D;  3O5I A;  3KCE A;  2JY5 A;  4IBD A;  1FKB A;  4MH0 E;  3GLH B;  1PJT A;  2O5R A;  5EJC A;  4DRJ A;  4RNA A;  2MRO B;  3VFD A;  3SYK A;  4I81 A;  1EFU B;  1HT2 E;  3UI6 A;  1H0I A;  4FD2 A;  4LJ5 A;  1H0G A;  1VF8 A;  2PN0 A;  3B9P A;  3ARR A;  4LAW A;  1UR8 A;  2XP3 A;  1PBK A;  3PA7 A;  2EKK A;  4G3O A;  3UI5 A;  2CV1 A;  4OW0 A;  1F40 A;  5HBF A;  3KZ7 A;  2VQF M;  1YSY A;  2LWX A;  5LMU M;  4MNM A;  3TWK A;  1ZU8 A;  3HY5 A;  3Q8G A;  1YW5 A;  1Y8G A;  1OGG A;  4JI4 M;  2RSE A;  3OTO M;  2KR7 A;  1C7Y A;  1J09 A;  2WSC F;  3KAD A;  2FAP A;  1XXH E;  4LAY A;  2KZS A;  1D2N A;  3K92 A;  2N35 A;  3U6M A;  4DRI A;  1EYM A;  2K9D A;  2PV3 A;  3BXW A;  3SAW A;  3ARX A;  1GPF A;  1X6L A;  1HJP A;  1FKG A;  3E9S A;  2OFN A;  3PXG A;  2ZM6 M;  4GC5 A;  1LL6 A;  1OGB A;  1WAW A;  2E5L M;  5FLX S;  4IT4 A;  5ITQ A;  1WGL A;  1P3Q Q;  3HJ8 A;  3LQR A;  4XBO A;  1QAM A;  1XWI A;  4JYA M;  3PR9 A;  1CUK A;  2AWG A;  1GJS A;  3LVV A;  3FTF A;  3AJI B;  4HL4 A;  2XZF A;  2Y21 A;  3EIH A;  3B7Z A;  1WNO A;  4L4U A;  1W1V A;  3E4R A;  3JYJ A;  2VN1 A;  3GLG B;  4ODQ A;  3KVW A;  4X65 M;  3CTW B;  2R62 A;  8CAT A;  5DFL A;  3JAM S;  1QZ2 A;  2OO9 A;  1IBL M;  3L26 A;  1WB0 A;  4II7 A;  2HHH M;  3B89 A;  2V6Z M;  1ZQ9 A;  5FTL A;  4WP2 A;  4K0K M;  2ZQT A;  2JZV A;  2A3E A;  2LKN A;  1TGU A;  1I94 M;  2Z4R A;  5EXP A;  3U5Z A;  3SHF A;  1VG5 A;  4ANR A;  4ZPW R;  1W1Y A;  4LGY A;  2FFJ A;  2KHH A;  2DWM A;  4DWS B;  1NO1 A;  3GU0 A;  2BWE A;  2QNJ A;  4LF5 M;  4DWS C;  3AOE A;  4NZC A;  5LMN M;  1NWT A;  3AOG A;  2F5S A;  1ZMU A;  4KO8 A;  1H6U A;  4LJ8 A;  3D8L A;  1DGH A;  2KRK A;  1FKI A;  4DIP A;  2WSE F;  3SC3 A;  2LVA A;  1NNJ A;  3CF0 A;  4J4N A;  2MJ5 B; 
#chains in the Genus database with same CATH homology
 3GRV A;  3GRU A;  2IUZ A;  1L1P A;  2R65 A;  2XH9 A;  4CHT B;  2ITK A;  2LGO A;  3O5F A;  4IBG A;  3DOA A;  2FE8 A;  4LJ4 A;  1HKI A;  3AV0 A;  4JV5 M;  3ARZ A;  3WHK A;  3W0F A;  1XHG A;  2PPN A;  2ZQS A;  3GPK A;  4X66 M;  1P5Q A;  5EQT A;  2DWN A;  4REZ A;  3JYM A;  4B7F A;  2EO2 A;  3SHG B;  1KT0 A;  1SXJ D;  3Q8X A;  3UJN A;  4J4O A;  1C9H A;  4LF6 M;  5KPR A;  5JI2 E;  3U6C A;  2DSW A;  1IXR C;  3VKG A;  4MNL A;  3DZD A;  1FFQ A;  4PDI A;  3KAF A;  3W0L B;  4WUR A;  2XGN A;  4B3T M;  1CTN A;  3D8B A;  4BBA A;  3GRR A;  4KHP M;  1Z5B A;  4L15 A;  1KFW A;  2VII A;  5EP4 A;  2C98 A;  5EXS A;  3NI6 A;  2MLZ A;  4LFA M;  4AI6 A;  5ITY A;  3KP0 E;  4S3K A;  2XF3 A;  4DV0 M;  2C5R A;  2FNA A;  4GHA A;  1FNN A;  3WL0 A;  5DEZ A;  3A42 A;  1IXZ A;  4OX9 M;  3K1J A;  3RGS A;  2A3B A;  1MX0 A;  3AS1 A;  1NWR A;  1Q6I A;  4NSO B;  1F8A B;  3I6C A;  1E32 A;  1RD6 A;  1LV7 A;  4LCB A;  5EXT A;  3CHE A;  4I5S A;  2PPP A;  4QT2 A;  1QAN A;  4Q22 A;  1IN4 A;  1PJJ A;  1FKH A;  4M9S A;  1LL7 A;  4IBJ A;  4MNJ A;  3RGC A;  3ZCB B;  1FKJ A;  2DXI A;  1J4I A;  2ZAN A;  3RM8 A;  4GIT A;  2F5Q A;  4XGI A;  1R2Y A;  1K9T A;  4FCV A;  2F2D A;  2H1R A;  3B9A A;  3J7B A;  3ARP A;  4W5W A;  1EQ3 A;  4BB9 A;  1W9P A;  1PJI A;  3WD3 A;  3SAU A;  2XP5 A;  1XNR M;  4LRT A;  5HT1 A;  3T1H M;  3J2P B;  1ZBW A;  2LH0 A;  4L8R C;  4B7G A;  1FJD A;  2MPH A;  2WLZ A;  3KAG A;  4P8X A;  2G8L A;  1HNX M;  3ARQ A;  2W82 A;  1ZK6 A;  3LVW A;  4IBI A;  4LF4 M;  3ARV A;  2ZQU A;  1A7X A;  4MSP A;  1G3I A;  2P5T A;  2XPB A;  1SXJ B;  4S12 A;  4WW0 A;  1NHG C;  3QAU A;  2XP9 A;  4FN2 A;  2DG9 A;  3RGP A;  1E9S A;  1N78 A;  3SAV A;  4AZF A;  4JFM A;  3AOE C;  4ML4 A;  4DV4 M;  5JH8 A;  1J4H A;  2L7H A;  1IM2 A;  1HJX A;  1Q39 A;  1K82 A;  3VKH A;  4JI2 M;  5B8I C;  4TUW A;  5DF0 A;  3UQA A;  5GPR A;  1E9L A;  4JFJ A;  2M08 A;  1IBM M;  2VCD A;  3L2A A;  3GLI B;  2ZQV A;  2RGH A;  3R9X B;  4TX0 A;  1EDQ A;  4R3D A;  2YBU A;  4A3V B;  5DIT A;  3FTE A;  1ROT A;  4Z2J A;  2X49 A;  4ITZ A;  5GQB A;  1Z5A A;  3B7X A;  1N75 A;  4LGM A;  2FOI C;  1FKL A;  1NY5 A;  4IIW A;  4MGH A;  2CFO A;  1IX5 A;  4JFI A;  3BOS A;  1O6I A;  4LAX A;  1L1Z A;  3FYD A;  4ODR A;  5ITR A;  4QT3 A;  4DRN A;  2C96 A;  3TCZ A;  1TH4 A;  4B08 A;  4DR7 M;  1GOI A;  1NH6 A;  2CEA A;  1Z5C A;  1YUB A;  2Z3X A;  4ZPX A;  1HJW A;  2R4J A;  3LQQ A;  1QPF A;  1TFV A;  4JI7 M;  1T11 A;  1IN5 A;  4MTV A;  3TWM A;  1ORY B;  5BR8 M;  3J80 S;  2QF8 A;  3FUW A;  4NRW A;  3CZ8 A;  3HJS A;  1Q1C A;  4HBO A;  1FKS A;  3TQS A;  3KOZ E;  3HGI A;  4QNR A;  2Z7J A;  2HL7 A;  3TC5 A;  1XMQ M;  3GP1 A;  4Q7N A;  1QAO A;  2ZR4 A;  4N19 A;  1LG2 A;  4IQC A;  5ITX A;  1G59 A;  4D81 A;  2DT1 A;  2V1U A;  2QZ4 A;  1QVR A;  4R0X A;  3CF2 A;  1ZL1 A;  2PI6 A;  2K8I A;  3J81 S;  2UZ5 A;  4DR1 M;  1ZB5 A;  2IF4 A;  2KI3 A;  5DNY A;  1EIB A;  4AW4 A;  4Z2L A;  3NWL A;  2L09 A;  4LJ9 A;  2DZN B;  4YY3 M;  1Q6H A;  2WM0 A;  3GLF A;  3GPY A;  3THG A;  4AKI A;  3DFZ A;  4OVZ B;  3UMM A;  2ZBK B;  3U6S A;  3KAC A;  2Y0Q A;  4LJ6 A;  1FKT A;  1NWS A;  2PV2 A;  4W9O A;  1N32 M;  2CHQ A;  1ZBV A;  3HU3 A;  1FFR A;  2R45 A;  2OQ4 A;  4JI3 M;  4ODL A;  3O5L A;  4P8V A;  5FSW A;  2G8Z A;  4U84 A;  2HKJ A;  5HW8 A;  1NJG A;  3KOX E;  4IBK A;  4FCT A;  1XXH B;  4DR5 M;  3G6M A;  4GIV A;  3U6L A;  1U79 A;  1QYR A;  2M60 A;  3CF6 E;  5ITT A;  1GKI A;  1HJV A;  4GC9 A;  3PRB A;  4DV7 M;  3AL0 C;  4QIB A;  3U6Q A;  2NQ8 C;  5HWC A;  3J27 B;  5IT9 S;  1ZBK A;  2WK2 A;  3TWL A;  1G8P A;  3I51 A;  4LRS A;  5KPT A;  2RQS A;  4LF8 M;  3KOW E;  3O5J A;  1GL7 A;  1ROU A;  3MDY B;  2KO7 A;  3GPX A;  5KPZ A;  4B3R M;  2XP7 A;  4C02 B;  3LUO A;  1FJG M;  5FTN A;  4Z2G A;  3CHF A;  3AQU A;  2J7O A;  3B9E A;  4P16 A;  2BJV A;  4JFL A;  3ILK A;  1HNW M;  3WKZ A;  2DWZ B;  5D75 A;  2XZU A;  3TL4 X;  1Z6T A;  3O5Q A;  4LGX A;  1E94 E;  3U6P A;  1D7I A;  4URI A;  3SMP A;  1DO0 A;  1QPL A;  2F4E A;  1W5S A;  3CHC A;  3KS8 A;  4LG2 A;  2RKO A;  1Y0O A;  1R9H A;  4B3S M;  3KAI A;  3U60 A;  1D6O A;  3ARY A;  4DRK A;  3NBI A;  4PTM A;  5IWA M;  1L2B A;  1OJL A;  5KO3 A;  1TH3 A;  3VK8 A;  1NSF A;  2CHV A;  1KSF X;  3UQI A;  4NOO B;  3U6E A;  5E6J A;  2DT2 A;  2AHM A;  4M0W A;  3NTP A;  5ITX E;  1JNT A;  4MPK A;  1C1K A;  3GRY A;  1L8Q A;  3UZU A;  4LF7 M;  2UU9 M;  4I8O A;  1Q3B A;  4PT5 A;  4AG6 A;  1X6N A;  1ZAE A;  4BF8 A;  3B9D A;  4XAK A;  5JI3 E;  2KFW A;  3FXY A;  2F5N A;  4QNM A;  3UF8 A;  1S3S A;  4Z8X A;  4DV3 M;  3G6L A;  1GL6 A;  4NNR A;  3MHV C;  1FKR A;  4KR0 B;  2OPF A;  4L16 A;  3SYL A;  4DUZ M;  2QEN A;  1L2C A;  3A98 B;  2ZAM A;  1IBK M;  2O9O A;  2D7H A;  1NY6 A;  1Z59 A;  2D9F A;  3UI4 A;  3ARU A;  4DRM A;  4TW8 A;  4NL4 H;  3AS2 A;  2M1I A;  3O5P A;  2R18 A;  2LJ4 A;  3UK6 A;  4R7G A;  4G4Q A;  5DYG A;  3GPP A;  5C18 A;  4W9P A;  4EIW A;  3VDU A;  4DH0 A;  2B31 A;  3SAS A;  4DRH A;  2N87 A;  3FUT A;  3JXV A;  5HWB A;  1LQ0 A;  4D80 A;  3GQ5 A;  4MM3 B;  2G5G X;  2G41 A;  3H9R B;  4JN6 A;  5HUA A;  4B7H A;  3L25 A;  1X37 A;  4GKK M;  1Q6U A;  2O92 A;  4P8W A;  1W5T A;  2XFT A;  4LF9 M;  1GUV A;  2XEP A;  4IBF A;  2KRU A;  3C58 A;  4HAR A;  1HXV A;  3PNV A;  2D7E A;  3AKZ A;  2F5P A;  1LJY A;  2MLY A;  3O5G A;  3M7G A;  4U85 A;  1E6Z A;  1HQC A;  1T3T A;  1TH2 A;  3FTC A;  1TDZ A;  4ZPT R;  2CUZ A;  2QCU A;  3WHL A;  3U61 A;  1DGB A;  2KZU A;  2XLJ A;  4TNS A;  3RM4 A;  2LNH C;  4YHH M;  4WKA A;  1K3X A;  3M0E A;  4G4N A;  3WQW A;  3CGN A;  4FWG A;  2XP6 A;  3ODK A;  1N33 M;  4NSB A;  4G2P A;  5J6E A;  2XSZ A;  5DO2 A;  1HNZ M;  4ZPV R;  4JI0 M;  1WXQ A;  3U5Z B;  1BL4 A;  2MLX A;  5EP2 A;  2DHR A;  3O5E A;  2FDM A;  2OLH A;  2D7G A;  2QBY A;  2F21 A;  4DR3 M;  1I4W A;  3VK7 A;  1BKF A;  1DGH B;  3GLG A;  1NWU A;  1NMV A;  4M0D A;  3SBJ A;  4Z2H A;  1IQP A;  4GGQ A;  4BLC A;  3O5M A;  2DT0 A;  1KYI A;  1HR0 M;  2DSZ A;  2XFS A;  4AQY M;  1IY1 A;  3CH9 A;  2LXE A;  2X8A A;  4HLQ A;  4G4O A;  1JR3 A;  3T38 A;  1HQY E;  4DWS A;  1GLN A;  1N36 M;  4FCW A;  1XNQ M;  3OA5 A;  3IHZ A;  3J7A S;  4LJA A;  3GQ3 A;  2XSZ D;  1N1A A;  3SMS A;  1IY2 A;  2QPA A;  3WQV A;  4DUY M;  3NRK A;  3VAW A;  4KQZ A;  2DG3 A;  3EIE A;  3FKE A;  4JI5 M;  1K3W A;  1DGG A;  3O5D A;  2KA6 B;  2DT3 A;  4LAV A;  4PD2 A;  2UUC M;  2F4V M;  4RF0 A;  4LFC M;  1HT1 E;  4IPX A;  2LPV A;  4G4R A;  3HJQ A;  2JA2 A;  2R4E A;  1QQW A;  1IN7 A;  1JNS A;  4LZZ A;  1N77 A;  2Q2E B;  3ZC7 B;  5H37 D;  2I7N A;  5GKN A;  4ODM A;  4DR2 M;  4KOD A;  3WD4 A;  4JI6 M;  4FAP A;  7CAT A;  2L2S A;  4GRI A;  1DGF A;  2KXE A;  2A3A A;  2UXB M;  4HBE A;  3CHD A;  1JR3 D;  4WJX A;  4M9Z A;  5E26 A;  1E6P A;  4DV2 M;  2ESC A;  1R7R A;  3PVS A;  3K2L A;  4JI1 M;  3L28 A;  1FKF A;  4IBB A;  2DZO B;  2RGO A;  4FVM A;  4MGK E;  3SAR A;  5DYI A;  3PRA A;  4MGY E;  3QWL A;  4L72 B;  1IXS B;  3ALF A;  3KW6 A;  4QHS A;  4QZV B;  1JVW A;  1NJF A;  3JR4 A;  5EXX A;  4O2T A;  2HCB A;  1E9R A;  2BNK A;  2C99 A;  4AG5 A;  3R8F A;  5FTJ A;  1W1P A;  4X62 M;  4GIP A;  4WK9 A;  5EP1 A;  3IG5 A;  4TW7 A;  4DZ3 A;  3FUU A;  3U61 B;  2PV1 A;  2Z4S A;  1FAP A;  5DIU A;  1MU5 A;  4Z2K A;  2A3C A;  1QAQ A;  4LFB M;  1YE9 A;  4ODO A;  2L7I A;  3FY1 A;  5I98 A;  2DSU A;  5ITU A;  3HU1 A;  3RME A;  2YR0 A;  4G6Z A;  4RF1 A;  1YAT A;  4MGZ E;  3RM9 A;  2BJW A;  4GH9 A;  4I4L A;  2QBY B;  1NNU C;  1TCO C;  3FYC A;  3K8Z A;  3EY6 A;  4IT6 A;  2KGJ A;  3GO8 A;  4PDG A;  2V1C A;  3I4Y A;  4DZ2 A;  3O5O A;  4NXN M;  2KW0 A;  1E15 A;  1HKK A;  1XHB A;  2EA0 A;  2AOS A;  4PCZ A;  5IZ7 D;  5HW7 A;  1FKD A;  4IQ2 A;  3HHZ A;  3U6D A;  1B6C A;  1SXJ A;  4JI8 M;  4ITQ A;  1GVN A;  1XC8 A;  3AFH A;  3KAB A;  4CGY B;  3MK6 A;  1E6R A;  5BPV A;  1E6N A;  2YQZ A;  3HHY A;  3FAP A;  4DV1 M;  2MNT A;  2PBC A;  4NRV A;  2EUC A;  1J6Y A;  2VQE M;  4W5U A;  2RUR A;  4LJ7 A;  3H4M A;  1LL4 A;  5FTK A;  3KOY E;  1JNE A;  3TDB A;  4GMQ A;  1JQJ C;  3AS3 A;  3WD2 A;  3VLF B;  1ITX A;  2Q5A A;  2DPE A;  1J4R A;  1N34 M;  3GLI A;  5DIV A;  4OU7 A;  2A5Y B;  2YBT A;  3A46 A;  1FKK A;  4IJE A;  2Y20 A;  4MGI E;  4JYS A;  4DT4 A;  4GKJ M;  4DRQ A;  1G4A E;  5F3W A;  1W1T A;  3FTD A;  1FD9 A;  3ARW A;  4KLN A;  4D82 A;  2ZAO A;  3U6O A;  2XPA A;  4Z2I A;  1J7K A;  4AY1 A;  4MB7 A;  3B8S A;  1OFH A;  4ZS6 A;  4LY6 A;  2YNM D;  3KP1 E;  4MAV A;  2CV0 A;  3WD0 A;  1SR0 A;  1UR9 A;  1KFV A;  4QHT A;  1HKJ A;  3HHW A;  5A2Q S;  4Z6Y A;  5BXJ A;  4P8U A;  4WKF A;  3L27 A;  4IBE A;  3ALG A;  4QOS A;  1PM5 A;  3L29 A;  2Y78 A;  4WIW A;  2C9C A;  3GLH A;  3WIJ A;  3FD9 A;  4IBC A;  4DV5 M;  5KQ8 A;  4FW9 A;  3GLF B;  4DRO A;  3WD1 A;  4MNK A;  2XP8 A;  1EE8 A;  4GHL A;  3KSJ A;  3UGJ A;  1LG1 A;  1G41 A;  3KSX A;  3IKG A;  1R6B X;  2WLY A;  2UUA M;  4L3N A;  3FUX A;  3RE8 A;  4DV6 M;  2DG4 A;  4MGV A;  2UXD M;  4TW6 A;  4WKH A;  2M5Z A;  1SXJ E;  2I7P A;  3FUV A;  2CE7 A;  4B3M M;  1ZCN A;  2R46 A;  1D7J A;  3SFZ A;  3KAH A;  2X4A A;  4OVZ A;  5EP3 A;  1UM8 A;  2M2A A;  2UXC M;  1JND A;  1PIN A;  1TDH A;  2YFQ A;  2C9O A;  3OOB A;  3HU2 A;  1Q3C A;  3ZH9 B;  1W9V A;  4X64 M;  3PRD A;  3ARS A;  1M5Y A;  3PNY A;  2MF9 A;  4FWD A;  4IJF A;  1W26 A;  2UUB M;  1KT1 A;  1XXH A;  4S3J A;  2XP4 A;  4ODK A;  3I4V A;  3IK8 A;  1VDD A;  3KXE C;  1R2Z A;  4FWH A;  3A45 A;  2RUQ A;  1SXJ C;  3GPU A;  3ART A;  3HKP A;  1HKM A;  1IN6 A;  1L2D A;  3O5R A;  4L78 A;  4DRP A;  5C1B A;  1QZM A;  3ARO A;  3M6A A;  3T15 A;  1IN8 A;  1L1T A;  2DSV A;  1NSG A;  3QOK A;  1OFI A;  4U86 A;  5HTG A;  3AS0 A;  3U60 B;  3DA1 A;  4ODN A;  2KE0 A;  4QOZ C;  2J7N A;  2CV2 A;  4JXJ A;  3O5K A;  4W9Q A;  4AKG A;  5HKG A;  2ZR5 A;  2KEB A;  1D2K A;  5HW6 A;  3T1Y M;  4LZJ A;  2PPO A;  4AKH A;  2Y0T A;  3CGM A;  1NHW C;  2QP9 X;  4DR4 M;  1XMO M;  3PFI A;  3KS4 A;  4R5E A;  1NMW A;  3RFW A;  2ZR6 A;  2RUC A;  1SYT A;  1OWQ A;  5KQD A;  4TYO A;  3VDP A;  1J5E M;  2RUD A;  3WH0 A;  4M9X A;  3GQ4 A;  2FKE A;  3UQB A;  3WL1 A;  4DR6 M;  1IY0 A;  4NXM M;  3LMM A;  3IKD A;  1NVM A;  2ERC A;  1EHN A;  3SAT A;  2DWL A;  2DVW B;  1DO2 A;  4NSR A;  1D7H A;  4G50 A;  5FTM A;  3W4R A;  2L6O A;  3JR5 A;  4ODP A;  3TE6 A;  4CIS A;  5GPG A;  5IRE B;  2CHG A;  3HWS A;  2F5O A;  3KFU G;  2K47 A;  1W9U A;  4JFK A;  1ZBC A;  3KDS E;  3MJ5 A;  1XRV A;  3TPZ A;  3IG8 A;  3HHX A;  4DWS D;  3O5I A;  3KCE A;  4IBD A;  1FKB A;  4MH0 E;  3GLH B;  2O5R A;  5EJC A;  4DRJ A;  4RNA A;  3VFD A;  3SYK A;  4I81 A;  1HT2 E;  3UI6 A;  1H0I A;  4FD2 A;  4LJ5 A;  1H0G A;  1VF8 A;  3B9P A;  3ARR A;  4LAW A;  1UR8 A;  2XP3 A;  1PBK A;  3PA7 A;  3UI5 A;  2CV1 A;  4OW0 A;  1F40 A;  5HBF A;  3KZ7 A;  2VQF M;  1YSY A;  2LWX A;  5LMU M;  4MNM A;  3TWK A;  1ZU8 A;  1YW5 A;  1OGG A;  4JI4 M;  2RSE A;  3OTO M;  2KR7 A;  1J09 A;  3KAD A;  2FAP A;  4LAY A;  2KZS A;  1D2N A;  3K92 A;  3U6M A;  4DRI A;  1EYM A;  2PV3 A;  3BXW A;  3SAW A;  3ARX A;  1GPF A;  1X6L A;  1FKG A;  3E9S A;  2OFN A;  3PXG A;  2ZM6 M;  4GC5 A;  1LL6 A;  1OGB A;  1WAW A;  2E5L M;  5FLX S;  4IT4 A;  5ITQ A;  3HJ8 A;  3LQR A;  4XBO A;  1QAM A;  1XWI A;  4JYA M;  3PR9 A;  2AWG A;  3LVV A;  3FTF A;  3AJI B;  4HL4 A;  2XZF A;  2Y21 A;  3EIH A;  1WNO A;  4L4U A;  1W1V A;  3E4R A;  3JYJ A;  2VN1 A;  3GLG B;  4ODQ A;  3KVW A;  4X65 M;  3CTW B;  2R62 A;  8CAT A;  3JAM S;  1QZ2 A;  1IBL M;  3L26 A;  1WB0 A;  4II7 A;  2HHH M;  2V6Z M;  1ZQ9 A;  5FTL A;  4K0K M;  2ZQT A;  2JZV A;  2A3E A;  2LKN A;  1TGU A;  1I94 M;  2Z4R A;  5EXP A;  3U5Z A;  3SHF A;  4ZPW R;  1W1Y A;  4LGY A;  2FFJ A;  2DWM A;  4DWS B;  4LF5 M;  4DWS C;  3AOE A;  4NZC A;  5LMN M;  1NWT A;  3AOG A;  2F5S A;  4KO8 A;  1H6U A;  4LJ8 A;  3D8L A;  1DGH A;  2KRK A;  1FKI A;  4DIP A;  3SC3 A;  1NNJ A;  3CF0 A;  4J4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...