3RFWA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally-related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
252
structure length
252
Chain Sequence
ATVATVNGKSISDTEVSEFFAPMLRGQDFKTLPDNQKKALIQQYIMQDLILQDAKKQNLEKDPLYTKELDRAKDAILVNVYQEKILNTIKIDAAKVKAFYDQNKDKYVKPARVQAKHILVATEKEAKDIINELKGLKGKELDAKFSELAKEKSIDPGSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTTPVKTNFGYHVILKENSQAKGQIKFDEVKQGIENGLKFEEFKKVINQKGQDLLNSAKVEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Cell-binding factor 2
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally-related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
total genus 77
structure length 252
sequence length 252
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1040 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3rfwA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rfwA03
1QZ2A 3VAWA 3IKGA 3O5FA 4DZ3A 2KR7A 1QPLA 4ODQA 3UI5A 3KABA 5HW7A 4ODKA 3UI6A 2MLXA 5B8IC 2XP6A 5BXJA 4TW6A 1PINA 3JXVA 4LAYA 1Q6HA 3IK8A 4O2TA 2XP8A 4JFMA 2M08A 5I98A 4W9PA 1J4IA 4ODOA 2ITKA 2DG4A 4JYSA 5HW8A 1FKSA 4U84A 2OFNA 4N19A 1EYMA 5DIVA 2KGJA 1F40A 1EQ3A 3CGMA 3O5PA 4JFLA 4DH0A 5HTGA 5HWBA 3IKDA 5DIUA 1C9HA 4DRKA 1JNSA 5D75A 5HT1A 2PV1A 1FKBA 2XPBA 4DRQA 4DRPA 4TW8A 1JVWA 4ITZA 4ODMA 2MLZA 2XPAA 1A7XA 1FKHA 2RQSA 2N87A 1YW5A 2VCDA 3O5LA 4JFJA 1ZK6A 1TCOC 2MNTA 4ODRA 4LAVA 4IQ2A 2XP3A 1JNTA 2LJ4A 4LAWA 1J6YA 2MF9A 3FAPA 4ODPA 2XP5A 5GPGA 2VN1A 1FKLA 1Q6UA 2ZQTA 3IHZA 1HXVA 2RUCA 2ZQVA 1T11A 3O5EA 4TW7A 2PV2A 3NRKA 4QT3A 3UQAA 3O5JA 4QIBA 2XP7A 4TYOA 3NTPA 4J4NA 2IF4A 3B7XA 4DROA 5DITA 2MLYA 3LUOA 2DG9A 4JFIA 4GIVA 1R9HA 3KAGA 3TC5A 3I6CA 1ROUA 3JYJA 2F4EA 4U85A 3WH0A 1Y0OA 2PPNA 1KT0A 5HW6A 5J6EA 4FAPA 2ZR4A 4JFKA 4IQCA 2FAPA 2F21A 4ODLA 4DIPA 2RSEA 3OOBA 2UZ5A 3O5DA 4MGVA 2L2SA 2KO7A 3O5KA 1ROTA 4U86A 1P5QA 3PRBA 1Q6IA 1NMVA 3UI4A 1FKKA 1D7IA 3UQIA 2D9FA 2M2AA 5HUAA 1FJDA 1NMWA 2KI3A 2XP4A 3JYMA 3MDYB 2AWGA 3O5QA 3EY6A 2ZQSA 1W26A 3KZ7A 3O5RA 3TDBA 1YATA 1U79A 2RURA 1FKDA 3KAHA 4NNRA 2JZVA 1D7HA 2F2DA 4G2PA 4FN2A 3O5GA 1BL4A 3KAIA 3PA7A 2PPPA 1J4RA 1FAPA 1D7JA 1FD9A 3H9RB 2KE0A 2KFWA 2LGOA 2MPHA 1NSGA 1M5YA 1D6OA 2RUQA 3UF8A 5HKGA 3PRDA 4J4OA 2LPVA 4DRNA 4TNSA 1B6CA 2PBCA 2XP9A 2ZQUA 1FKGA 4TX0A 3O5IA 2ZR6A 4LAXA 3NI6A 4DRIA 1FKTA 2PV3A 4QT2A 3KADA 3KACA 3TCZA 4DT4A 1FKRA 2PPOA 4DZ2A 1PBKA 1J4HA 4G50A 3O5OA 2ZR5A 4IPXA 3GPKA 4DRJA 4DRMA 1ZCNA 3KAFA 3RFWA 2Y78A 4W9OA 5HWCA 2M1IA 1KT1A 4C02B 3RGCA 2LKNA 4DRHA 2Q5AA 1FKJA 2K8IA 1FKFA 2RUDA 3O5MA 3ODKA 3UQBA 4R0XA 1BKFA 2FKEA 3CGNA 1N1AA 1Q1CA 1F8AB 4ODNA 4W9QA 4BF8A 1FKIA 4MSPA 1L1PA 2DG3A 3KCEA 1QPFA 4GGQA
chains in the Genus database with same CATH superfamily
4LGXA 4B3SM 1GLNA 4MGKE 3VLFB 3B9EA 2LXEA 2MH8A 3KVWA 2R65A 4L16A 4D81A 1PRBA 4JI7M 1XNQM 3CZ8A 2XFSA 3FY1A 3VFDA 2LH0A 4WW0A 4JI6M 1SXJB 2L7HA 4HBEA 1A7XA 4JFJA 2BNKA 2X4AA 3UK6A 5EP1A 2VF8A 4I5SA 4JN6A 2MNTA 3SYKA 2LJ4A 2HL7A 5GPGA 4LF5M 2Z8YM 2XP5A 2ZQVA 3IG5A 4P8VA 3KXEC 2OLHA 1NO1A 2QENA 4XBOA 4JI2M 1R9HA 2C99A 4U85A 4QOZC 3AS3A 3A98B 5C18A 5EXTA 2F21A 2XZUA 1XRVA 3WHLA 1LG1A 2RGOA 1NMVA 1Z59A 4QHSA 2KI3A 3GLGB 2ZM6M 2J7OA 4RF1A 4G2PA 4II7A 2K6BA 4FN2A 3AS1A 2JY7A 4NXMM 2XLJA 2A3AA 3U60B 5JI2E 2OOAA 2WSFF 1W1YA 3BMBA 4Z2JA 1HKMA 2X8AA 3TE6A 2FH0A 3PVSA 3GP1A 4AZFA 1NWSA 2ZR5A 1OGGA 1RU3A 3ARSA 3AV0A 1KT1A 3LQQA 2LKNA 3GLFB 2JUJA 4KR0B 1L2CA 2G8ZA 4MSPA 5HBFA 2DG3A 2L2SA 4AG6A 2YBUA 3W68A 2AHMA 4ODQA 2O9OA 1DGFA 3WQWA 2QBYA 3IK8A 4WK9A 4JI4M 1YLAA 4I4LA 3SC3A 4LFBM 1HJPA 3W67A 1OAOC 1V33A 4TW8A 3K9OA 4LGMA 4DV6M 3HJSA 5KQDA 4GC5A 1T6OA 1QYRA 1E6NA 4LAWA 3KP1E 1IFYA 3FAPA 1MN3A 1FKLA 3M6AA 2DWLA 3CF0A 1GL7A 3W0LB 5EXPA 4X65M 2DAIA 2QHOB 1W1PA 3SHFA 4GHAA 2QCUA 2R4JA 3KSXA 3KW6A 3FYCA 2VIIA 2L09A 4BLCA 3LCUA 7CATA 4UN2B 2NQ8C 3CH9A 4WIWA 5EQTA 4KHPM 1FKKA 4LJ4A 3UMMA 2M2AA 5HUAA 2VDBB 1E9SA 1JCHB 2C5RA 3I4YA 3NBIA 3WD4A 1G3IA 1D7JA 1G41A 4G4OA 2KRKA 3AOGA 3A42A 3IHPA 4NSOB 1FKGA 2QF8A 3LQRA 1Q02A 1W9PA 1NWUA 1GUVA 3HZJA 1IXSB 1OFIA 5IT9S 1ZBCA 3FUUA 4MNKA 3PRAA 3ZCBB 3RM9A 1L1PA 2OO9A 2LVAA 3C3DA 3ZQJA 3R8FA 3GRYA 1W5SA 2ZBKB 4IJFA 4MGYE 4CIZA 2KGJA 4CGYB 1GRJA 3HHXA 4DRQA 1FKBA 4G6ZA 2LHCA 3DOAA 5H37D 3U6PA 1EHNA 5IZ7D 1HNZM 4GKJM 1ZK6A 1OKSA 1JQJC 4QNRA 3HHZA 1NSFA 3ARQA 1OTRA 3F92A 1VG5A 3AL0C 3CF6E 1Y0OA 2EJSA 3MJ5A 4DIPA 3FXYA 5ITUA 1I94M 4LY6A 4Z2KA 3HU1A 4KLNA 4GEWA 2EA0A 2KDLA 3HU3A 2CV1A 3AS2A 2J5YA 1FJGM 4JI1M 3A45A 2Z4RA 1VEGA 3AKZA 2KE0A 1NSGA 4GH9A 3EIHA 4R71A 4G4RA 1ZQ9A 2DWMA 4DRNA 4B08A 2PBCA 3NWLA 3PNYA 4XAKA 4LAXA 1H0IA 1OGBA 2DT1A 1N32M 4DZ2A 3L26A 3GPKA 1ZCNA 2Y78A 1E6ZA 2OPFA 4LZJA 2YNMD 1X6NA 2LVQD 2K8IA 3KDSE 2YR0A 1PJTA 4NL4H 1Z5BA 3WD2A 3GQ5A 4ZS6A 3TL4X 4FWDA 2LWXA 3FYDA 5BXJA 3JXVA 1Q6HA 5I98A 5EXXA 2HHHM 4Z2GA 4JFLA 3T38A 5FTMA 3FRIA 1AIPC 1ZBVA 2DSZA 2R44A 2N87A 1I4WA 4F2LA 1HT2E 5KPZA 3UQAA 2ETNA 2QSFX 3D8BA 3B7NA 4NXNM 2CV2A 4MPKA 1ROUA 2ESCA 2LVNC 3KS4A 3J81S 2UXDM 2P5TA 1D2KA 1ZAEA 2L4FA 2RSEA 1IY1A 2Y0TA 1KYIA 1J7KA 1YE9A 4JI5M 3KFUG 4R5EA 1W9VA 1TH4A 1N77A 2EULA 2JY5A 2FS1A 2F5PA 4PDIA 1D0MA 1EDQA 3FTDA 2LPVA 4TNSA 3AFHA 4TX0A 2ZR6A 3WL0A 4QT2A 3GU0A 1G8PA 1IN4A 4C02B 1G4AE 1NVMA 2HWJA 2XSZA 5KPTA 1BKFA 4DV7M 3M7GA 2GQFA 5B8IC 4PCZA 1K3XA 1PINA 4G4NA 1UR8A 1FKSA 3R9XB 4OX9M 4DRKA 1JNSA 1R7RA 4DWSA 1N33M 2L2DA 2Y0QA 3QWLA 1J5EM 1TCOC 5F3WA 1NNJA 4B3MM 2VN1A 5DEZA 3O5JA 4ZPVR 4IT4A 5DITA 4P16A 3LUOA 4MH0E 1IM2A 3EIPA 4GC9A 3IECA 5ITQA 3WIJA 2CRUA 3VK7A 1P5QA 1NY6A 4UDMA 3WHKA 2DSUA 4S12A 4REZA 1HJVA 4JI8M 4I81A 1DO2A 2F23A 2KFWA 1JNDA 3UF8A 1LV7A 3HJQA 4LJAA 1B6CA 4LGYA 1PJIA 3CTWB 2PV3A 3T1YM 3SYLA 4DRJA 1KFWA 3U61B 1Y8GA 4DRHA 2Q5AA 3SAWA 4LCBA 4BF8A 2BJWA 2JZ0A 1QZ2A 4DZ3A 3BBZA 3HU2A 4ODKA 1TTEA 3WL1A 2WSCF 5EP2A 3HKPA 1JNEA 4N19A 1Z5CA 2WZJA 5DIVA 5DO2A 1EE8A 5HT1A 4DRPA 1TF0B 1FKHA 3FUVA 3VKHA 4OU7A 4K0KM 1IQPA 2DT0A 4ODPA 1Q6UA 1P3QQ 5FLXS 4FWGA 3KSJA 2XP7A 3WQVA 3I01M 4JFIA 3LVWA 1FNNA 3H4JA 1WHCA 2C9OA 4IBBA 4IIWA 5HW6A 4JFKA 2X49A 1SXJE 4IQCA 3RM8A 1OIPA 4PT5A 3PRBA 4R7GA 1D0KA 4P8UA 1ZL1A 4QZVB 1PM5A 2DWNA 4HBOA 3EIEA 1W26A 1HR0M 2BJVA 2WM0A 4KODA 1FKDA 3B9PA 1TH2A 3U6MA 1GPFA 1J4RA 2H1RA 2Y21A 3ARYA 2MPHA 1SR0A 3FRHA 3D8LA 5HKGA 3B8SA 2HAKA 2CFOA 1PBKA 3KAFA 2XSZD 1DGHA 2N35A 2FOIC 4JV5M 2CHQA 2Q2EB 1QAOA 1R2YA 2ZAOA 1FKIA 4NRWA 4L72B 3SMSA 1T43A 2MLXA 2JY6B 3ARXA 2DKLA 4JYSA 2WLZA 3HJ8A 2FDMA 4DWSD 3HWSA 4DV4M 1F40A 3ZC7B 3IKDA 2DENA 5D75A 1SXJA 3GLFE 2DAGA 5DYIA 1GOIA 2RUCA 4DR1M 3NRKA 2KW0A 4QT3A 4QIBA 5KO3A 1NHWC 4TYOA 4WJXA 2VF7A 4DV2M 5E6JA 1L1ZA 1RD6A 4FAPA 3AOEC 4ODLA 3FTEA 2C9CA 3T1HM 4L6V6 1ROTA 1D0LA 2EUCA 2O5RA 4LF4M 2UXCM 5DF0A 1NMWA 2XP4A 3JYMA 1NV8A 2DAMA 2CP8A 1WGLA 1ZMVA 4GITA 2F5NA 4IBGA 1ZV1A 1IN6A 2F4VM 4QOSA 3U60A 4W5UA 3GLIE 4M9XA 4LFAM 2KZSA 1KSFX 3FTCA 1XXHE 4DRIA 1FKTA 4G50A 4MGHA 4FWHA 4GKKM 2C96A 4NRVA 1PJSA 3GLFA 1FKFA 2FKEA 3HX3A 1N1AA 4W9QA 1C9HA 1QDTA 4A3VB 1YSYA 1D2NA 2M08A 4DV1M 5IREB 3J7AS 3WD1A 4BBAA 3AQUA 1R4GA 2CHGA 2JXNA 2KNAA 4ODRA 1E6RA 2RGHA 3LMMA 1TGUA 3O5EA 1NWRA 3H4MA 2DZLA 4X62M 3NTPA 3GPPA 1IN7A 2BWBA 3U6CA 2KNVA 2FAPA 2R62A 3GLIA 3ARTA 2UZ5A 4DBGB 4DV0M 2ZANA 1XXHA 4TUWA 2DSWA 4QNMA 2D9FA 1FJDA 1V34A 2ZQSA 3TDBA 3KZ7A 2P4VA 2W82A 1JB0F 2RURA 3DFZA 1L8QA 1GVNA 4JYAM 3O5GA 2LGOA 4JI0M 4AI6A 3RM4A 5DNYA 4L3NA 4AKGA 1LQ0A 4M0WA 2UU9M 3KOXE 2DVWB 1DGGA 3JAMS 1WIVA 2F5QA 1XNRM 1FFQA 1IXSA 4MNMA 4MM3B 2A3BA 3RGCA 4IBEA 1OAIA 3C9PA 2KHHA 1O6IA 1L2DA 1XMQM 1VEKA 1L2BA 3KABA 1NJFA 3UI6A 4O2TA 4CHTB 2I7PA 2ZTCA 1HNXM 4MB7A 1SXJD 1NH6A 2DSVA 3O5PA 1GJTA 1R5LA 3AS0A 3T6PA 4HARA 4JXJA 5ITYA 4D80A 2MLZA 1E9LA 1YW5A 3RGPA 3K2LA 1QAQA 2R45A 4LAVA 1SXJC 4IQ2A 4P8XA 2G41A 3IHZA 1K3WA 2O92A 4ITQA 4J4NA 1IXRC 1N75A 1NHGC 1QAMA 2DG9A 2F5SA 3JYJA 3PXGA 4LJ9A 2CE7A 1TDHA 4Z2IA 3GPXA 1K9TA 4JI3M 2O25A 2EO2A 2KO7A 4HEOA 4DR5M 3GQ3A 3UI4A 2JNHA 2QZ4A 4X64M 3UQIA 1HKIA 4GMQA 2DT2A 3FKEA 3TPZA 1QQWA 4DR7M 1HKKA 2RRUA 4NOOB 2KRUA 4NSBA 1M5YA 1NWTA 1JR3A 3AROA 3PRDA 1IX5A 2DNAA 3NI6A 2QNJA 3K9PA 1IBMM 4R3DA 4IBJA 4FCTA 4DV5M 3ODKA 4R0XA 3HY5A 1F8AB 4URIA 1VDDA 4AKIA 1XC8A 3L25A 4MNJA 1OWQA 2XP6A 2XP8A 3OA5A 5HW8A 2LHGA 3VDUA 3PFIA 4DH0A 5HWBA 1ZBKA 4EIWA 2A3EA 2PV1A 2A3CA 2VQEM 3K1JA 4IBKA 4I8OA 5KPRA 3J27B 3KOYE 5ITTA 3CHDA 4W5WA 2DAEA 1T11A 4MGIE 4LF8M 2JWSA 4DR2M 4GIVA 3KAGA 2PPNA 3GLHB 2QQ8A 1SG9A 2KA6B 1OJLA 1R6BX 4D82A 5ITXE 2CHVA 4ZPWR 2ERCA 2WLYA 3TWKA 1NJGA 3FUTA 3V76A 3PNVA 3KAHA 2JZVA 4G3OA 1IBLM 5A2QS 1FFRA 2UUAM 4M0DA 1VDLA 3FUXA 5KQ8A 4B7HA 3TWLA 1GL6A 3BXWA 2ZQUA 3B9DA 3KOWE 1GO5A 5FTNA 4IBDA 2L7IA 1NY5A 1EIJA 4Z2HA 2KXEA 3RFWA 2YFQA 3SHGB 3CHEA 1LL7A 4PTMA 1V92A 1WR1B 5FSWA 3FUWA 3J7BA 3O5FA 2KR7A 2XGNA 3QYEA 5GKNA 1K82A 3U5ZA 4DR3M 3L28A 3DZDA 1LL4A 4JFMA 3IG8A 2V6ZM 1J4IA 2ITKA 4ODOA 1IY0A 1GKIA 2JA2A 3UGJA 1XB2B 3I51A 4XK8F 3CGWA 4ODMA 2ZTDA 2LTUA 2BWEA 1IN5A 2DI0A 4M9ZA 2VCDA 4AG5A 4LJ6A 2MR9A 4LF7M 2B31A 3W0FA 1E6PA 1JNTA 5ITXA 2KEBA 1XHBA 4LRTA 2ZQTA 1R2ZA 3PR9A 4GHLA 2PV2A 4ANRA 1ZU8A 4S3JA 1WB0A 3QYBA 5EP3A 2F4EA 4L15A 3SATA 3O5DA 2HCBA 4WP2A 4OVZA 4U86A 2MROB 1ORYB 2QPAA 1LTMA 2WSEF 3GRRA 1D7HA 1DGHB 2L6OA 1FAPA 2UUBM 3ARUA 3I4VA 1JR3D 1KFVA 4FD2A 1QUTA 3U6SA 2Z7JA 1QUSA 5IWAM 4NSRA 2CEAA 3U61A 4W9OA 5FTKA 1XWIA 1VF8A 2XF3A 4ZPXA 4LF9M 3B7QA 4GGQA 3U6QA 3VAWA 3L29A 1TFVA 3UI5A 3G6MA 3GLGE 4W9PA 2QBYB 3Q8GA 2J7NA 1Q3BA 1EYMA 1PGYA 3CGMA 5BPVA 2XPBA 2VQFM 4ITZA 4DR4M 3LVVA 2RQSA 2RKOA 3E46A 2OQ4A 4NZCA 1Q39A 4AY1A 3U6OA 1WXQA 1ZBWA 2MF9A 4Y28F 1HXVA 4PDGA 4DROA 4DUZM 2DWZB 4IBCA 4Q22A 3SARA 5J6EA 2E5LM 3B7ZA 5BR8M 1VEJA 4DWSC 2O01F 2EKKA 1CTNA 1D7IA 2M5ZA 3EY6A 5EP4A 4AQYM 3I04M 4HLQA 2XZFA 4B3TM 4NNRA 2LVOC 1BL4A 2G5GX 1TH3A 1C1KA 5GQBA 4Z2LA 4P8WA 2V1CA 4IJEA 1OIZA 4P17A 3GLGA 1DGBA 3KACA 1FKRA 1QANA 2R0IA 4IPXA 3AJIB 1H0GA 3O5MA 2PN0A 3SMPA 4GIPA 1Q1CA 4ODNA 1S3SA 3G6LA 5C1BA 3A46A 4IBIA 1YUBA 5HW7A 2R4EA 1C7YA 2G3QA 4TW6A 4LAYA 2EKFA 2PI6A 2DHYA 1XMOM 2DG4A 4U84A 3MK6A 1GJSA 4YHHM 2DT3A 1IY2A 4CISA 2LVPC 3GLIB 3U6EA 1E44A 2L4EA 1XXHB 5EJCA 4TW7A 3VKGA 4DUYM 3U6LA 2R18A 1F4IA 5E26A 1QVRA 3WH0A 1KT0A 2K9DA 5L8RF 1UR9A 4XGIA 3UJNA 3E4RA 1Q6IA 3THGA 4BB9A 3K8ZA 4LJ5A 4RKUF 3MDYB 1DV0A 1LG2A 1X37A 2I7NA 4WKHA 2WK2A 2F2DA 3TQSA 3GPUA 3VK8A 1ITXA 3JR5A 1EFUB 4X66M 3C58A 2D7GA 1TDZA 3ALGA 4J4OA 5LMUM 3ZH9B 2F5OA 3JR4A 1W1VA 4LRSA 2K0BX 5JI3E 4GRIA 3O5IA 2APLA 3TCZA 1Z6TA 1T3TA 2DAKA 4FCVA 2PPOA 1IXZA 1MU5A 1DO0A 1HT1E 1OQYA 5HWCA 2M1IA 5JH8A 3ARZA 5ITRA 2RUDA 2KZUA 4LJ7A 3GTYX 3J80S 1QPLA 2DPEA 4S3KA 1HQYE 2XH9A 3DA1A 1GABA 1LL6A 2YBTA 4DR6M 1JVWA 2R6FA 2XPAA 5GPRA 4HL4A 3GQ4A 3O5LA 2XFTA 2XP3A 2JP7A 1J6YA 1JR3E 4CJ6A 3SASA 4WKAA 3HHWA 8CATA 3B7XA 3SAVA 1UFZA 2DHRA 2JZ1A 4L78A 1E32A 2K47A 2FE8A 4LZZA 2ZAMA 4KQZA 1PJJA 2UXBM 4Q7JA 2LNHC 2R46A 3B89A 3LW5F 3NBXX 1ZMWA 2V1UA 1ZMUA 2AWGA 3ARPA 3FTFA 3RMEA 3J2PB 1QDRA 4MAVA 3PA7A 1TR8A 3H9RB 3B9AA 1E94E 1D6OA 2RUQA 4MNLA 3Q8XA 4FW9A 4IBFA 2XP9A 3RE8A 4LF6M 2DZNB 3O5OA 3WD3A 3HGIA 2JY8A 1A5TA 1WJ7A 1FKJA 1WNOA 2B3TA 3CGNA 1WGNA 3GRVA 4QHTA 1QZMA 2DXIA 4FVMA 3IKGA 1W9UA 1G71A 2KNZA 3MMPA 1H6UA 2MJ5B 1EIBA 3QOKA 3SBJA 1OFHA 3FD9A 1W5TA 5LMNM 4B7GA 2LBCA 1HNWM 4M9SA 2AOSA 3GPYA 3WD0A 5HTGA 4B3RM 4RF0A 5DIUA 4FCWA 1QZEA 2MGWA 4G4QA 4DWSB 5DFLA 1XHGA 5FTJA 2YQZA 3SFZA 1HJWA 1BVSA 1HJXA 1E15A 4WKFA 1UM8A 2Z4SA 2OOBA 2IF4A 5FTLA 3TC5A 3GRUA 4PD2A 4F1IA 4AW4A 1J09A 1WAWA 3KS8A 4RNAA 3MHVC 4OW0A 2A5YB 3OOBA 3VDPA 3O5KA 3L2AA 4WURA 3O5QA 3L27A 3RGSA 3O5RA 1YATA 2Y20A 4ML4A 4B7FA 1Z5AA 5EXSA 3ARVA 3LCVB 2PPPA 1E9RA 1FD9A 3GLHE 1CUKA 1L1TA 4L8RC 3ARWA 4DV3M 4MTVA 4KO8A 4LG2A 1HKJA 3B74A 3U5ZB 2UUCM 3T15A 3KADA 1HQCA 4MGZE 3OTOM 1G59A 1W1TA 4Z8XA 1IN8A 2DZOB 3GO8A 2HKJA 2CV0A 4NC6A 1X6LA 3UQBA 1IBKM 3UZUA 2H5XA 2GNOA 3KCEA 2C98A 4KT0F 3HHYA 4ZPTR 4LFCM 4AKHA 3AOEA 2OFNA 3ILKA 3TWMA 1EQ3A 3K92A 3WKZA 4LJ8A 3ARRA 1NV9A 2G8LA 3W4RA 2D7HA 4OVZB 1AUAA 3U6DA 1MJGM 3ALFA 1Q3CA 2FFJA 2D7EA 2M60A 2MLYA 3KP0E 1NNUC 3I6CA 1N34M 1MX0A 3GLHA 2ZR4A 1VQ1A 4Z6YA 1SYTA 3FE3A 3CHCA 1N78A 3CF2A 4MGVA 3E9SA 2XEPA 1LJYA 2B5UB 2QP9X 3CHFA 2Z3XA 3BOSA 1U79A 3C3EA 1PJQA 3KAIA 2CUZA 2CWBA 2IUZA 3E21A 4YY3M 3KOZE 1ZB5A 5DYGA 4IT6A 3M0EA 3SAUA 1N36M 4DT4A 1J4HA 4DRMA 3QAUA 4L4UA 4Q7NA 2FNAA 1QPFA
chains in the Genus database with same CATH topology
4LGXA 4B3SM 1GLNA 4MGKE 3VLFB 3B9EA 2LXEA 3KVWA 2R65A 4L16A 4D81A 4JI7M 1XNQM 3CZ8A 2XFSA 3FY1A 3VFDA 2LH0A 4WW0A 4JI6M 1SXJB 2L7HA 4HBEA 1A7XA 4JFJA 2BNKA 2X4AA 3UK6A 5EP1A 4I5SA 4JN6A 2MNTA 3SYKA 2LJ4A 2HL7A 5GPGA 4LF5M 2XP5A 2ZQVA 3IG5A 4P8VA 3KXEC 2OLHA 2QENA 4XBOA 4JI2M 1R9HA 2C99A 4U85A 4QOZC 3AS3A 3A98B 5C18A 5EXTA 2F21A 2XZUA 1XRVA 3WHLA 1LG1A 2RGOA 1NMVA 1Z59A 4QHSA 2KI3A 3GLGB 2ZM6M 2J7OA 4RF1A 4G2PA 4II7A 4FN2A 3AS1A 4NXMM 2XLJA 2A3AA 3U60B 5JI2E 1W1YA 4Z2JA 1HKMA 2X8AA 3TE6A 3PVSA 3GP1A 4AZFA 1NWSA 2ZR5A 1OGGA 3ARSA 3AV0A 1KT1A 3LQQA 2LKNA 3GLFB 4KR0B 1L2CA 2G8ZA 4MSPA 5HBFA 2DG3A 2L2SA 4AG6A 2YBUA 2AHMA 4ODQA 2O9OA 1DGFA 3WQWA 2QBYA 3IK8A 4WK9A 4JI4M 4I4LA 3SC3A 4LFBM 4TW8A 4DV6M 4LGMA 3HJSA 5KQDA 4GC5A 1QYRA 1E6NA 4LAWA 3KP1E 3FAPA 1FKLA 3M6AA 2DWLA 3CF0A 1GL7A 3W0LB 5EXPA 4X65M 1W1PA 3SHFA 4GHAA 2QCUA 2R4JA 3KSXA 3KW6A 3FYCA 2VIIA 2L09A 4BLCA 7CATA 2NQ8C 3CH9A 4WIWA 5EQTA 4KHPM 1FKKA 4LJ4A 3UMMA 2M2AA 5HUAA 1E9SA 2C5RA 3I4YA 3NBIA 3WD4A 1G3IA 1D7JA 1G41A 4G4OA 2KRKA 3AOGA 3A42A 4NSOB 1FKGA 2QF8A 3LQRA 1W9PA 1NWUA 1GUVA 1IXSB 1OFIA 5IT9S 1ZBCA 3FUUA 4MNKA 3PRAA 3ZCBB 3RM9A 1L1PA 3R8FA 3GRYA 1W5SA 2ZBKB 4IJFA 4MGYE 2KGJA 4CGYB 3HHXA 4DRQA 1FKBA 4G6ZA 5H37D 3DOAA 3U6PA 1EHNA 5IZ7D 1HNZM 4GKJM 1ZK6A 1JQJC 4QNRA 3HHZA 1NSFA 3ARQA 3AL0C 3CF6E 1Y0OA 3MJ5A 4DIPA 3FXYA 5ITUA 1I94M 4LY6A 4Z2KA 3HU1A 4KLNA 2EA0A 3HU3A 2CV1A 3AS2A 1FJGM 4JI1M 3A45A 2Z4RA 3AKZA 2KE0A 1NSGA 4GH9A 3EIHA 4G4RA 1ZQ9A 2DWMA 4DRNA 4B08A 2PBCA 3NWLA 3PNYA 4XAKA 4LAXA 1H0IA 1OGBA 2DT1A 1N32M 4DZ2A 3L26A 3GPKA 1ZCNA 2Y78A 1E6ZA 2OPFA 4LZJA 2YNMD 1X6NA 2K8IA 3KDSE 2YR0A 4NL4H 1Z5BA 3WD2A 3GQ5A 4ZS6A 3TL4X 4FWDA 2LWXA 3FYDA 5BXJA 3JXVA 1Q6HA 5I98A 5EXXA 2HHHM 4Z2GA 4JFLA 3T38A 5FTMA 1ZBVA 2DSZA 2N87A 1I4WA 1HT2E 5KPZA 3UQAA 3D8BA 4NXNM 2CV2A 4MPKA 1ROUA 2ESCA 3KS4A 3J81S 2UXDM 2P5TA 1D2KA 1ZAEA 2RSEA 1IY1A 2Y0TA 1KYIA 1J7KA 1YE9A 4JI5M 3KFUG 4R5EA 1W9VA 1TH4A 1N77A 2F5PA 4PDIA 1EDQA 3FTDA 2LPVA 4TNSA 3AFHA 4TX0A 2ZR6A 3WL0A 4QT2A 1G8PA 1IN4A 4C02B 1G4AE 1NVMA 2XSZA 5KPTA 1BKFA 4DV7M 3M7GA 5B8IC 4PCZA 1K3XA 1PINA 4G4NA 1UR8A 1FKSA 3R9XB 4OX9M 4DRKA 1JNSA 1R7RA 4DWSA 1N33M 2Y0QA 3QWLA 1J5EM 1TCOC 5F3WA 1NNJA 4B3MM 2VN1A 5DEZA 3O5JA 4ZPVR 4IT4A 5DITA 4P16A 3LUOA 4MH0E 1IM2A 4GC9A 5ITQA 3WIJA 3VK7A 1P5QA 1NY6A 3WHKA 2DSUA 4S12A 4REZA 1HJVA 4JI8M 4I81A 1DO2A 2KFWA 1JNDA 3UF8A 1LV7A 3HJQA 4LJAA 1B6CA 4LGYA 1PJIA 3CTWB 2PV3A 3T1YM 3SYLA 4DRJA 1KFWA 3U61B 4DRHA 2Q5AA 3SAWA 4LCBA 4BF8A 2BJWA 1QZ2A 4DZ3A 3HU2A 4ODKA 3WL1A 5EP2A 3HKPA 1JNEA 4N19A 1Z5CA 5DIVA 5DO2A 1EE8A 5HT1A 4DRPA 1FKHA 3FUVA 3VKHA 4OU7A 4K0KM 1IQPA 2DT0A 4ODPA 1Q6UA 5FLXS 4FWGA 3KSJA 2XP7A 3WQVA 4JFIA 3LVWA 1FNNA 2C9OA 4IBBA 4IIWA 5HW6A 4JFKA 2X49A 1SXJE 4IQCA 3RM8A 4PT5A 3PRBA 4R7GA 4P8UA 1ZL1A 4QZVB 1PM5A 2DWNA 4HBOA 3EIEA 1W26A 1HR0M 2BJVA 2WM0A 4KODA 1FKDA 3B9PA 1TH2A 3U6MA 1GPFA 1J4RA 2H1RA 2Y21A 3ARYA 2MPHA 1SR0A 3D8LA 5HKGA 3B8SA 2CFOA 1PBKA 3KAFA 2XSZD 1DGHA 2FOIC 4JV5M 2CHQA 2Q2EB 1QAOA 1R2YA 2ZAOA 1FKIA 4NRWA 4L72B 3SMSA 2MLXA 3ARXA 4JYSA 2WLZA 3HJ8A 2FDMA 4DWSD 3HWSA 4DV4M 1F40A 3ZC7B 3IKDA 5D75A 1SXJA 5DYIA 1GOIA 2RUCA 4DR1M 3NRKA 2KW0A 4QT3A 4QIBA 5KO3A 1NHWC 4TYOA 4WJXA 4DV2M 5E6JA 1L1ZA 1RD6A 4FAPA 3AOEC 4ODLA 3FTEA 2C9CA 3T1HM 1ROTA 2EUCA 2O5RA 4LF4M 2UXCM 5DF0A 1NMWA 2XP4A 3JYMA 4GITA 2F5NA 4IBGA 1IN6A 2F4VM 4QOSA 3U60A 4W5UA 4M9XA 4LFAM 2KZSA 1KSFX 3FTCA 4DRIA 1FKTA 4G50A 4MGHA 4FWHA 4GKKM 2C96A 4NRVA 3GLFA 1FKFA 2FKEA 1N1AA 4W9QA 1C9HA 4A3VB 1YSYA 1D2NA 2M08A 4DV1M 5IREB 3J7AS 3WD1A 4BBAA 3AQUA 2CHGA 4ODRA 1E6RA 2RGHA 3LMMA 1TGUA 3O5EA 1NWRA 3H4MA 4X62M 3NTPA 3GPPA 1IN7A 3U6CA 2FAPA 2R62A 3GLIA 3ARTA 2UZ5A 4DV0M 2ZANA 1XXHA 4TUWA 2DSWA 4QNMA 2D9FA 1FJDA 2ZQSA 3TDBA 3KZ7A 2W82A 2RURA 3DFZA 1L8QA 1GVNA 4JYAM 3O5GA 2LGOA 4JI0M 4AI6A 3RM4A 5DNYA 4L3NA 4AKGA 1LQ0A 4M0WA 2UU9M 3KOXE 2DVWB 1DGGA 3JAMS 2F5QA 1XNRM 1FFQA 4MNMA 4MM3B 2A3BA 3RGCA 4IBEA 1O6IA 1L2DA 1XMQM 1L2BA 3KABA 1NJFA 3UI6A 4O2TA 4CHTB 2I7PA 1HNXM 4MB7A 1SXJD 1NH6A 2DSVA 3O5PA 3AS0A 4HARA 4JXJA 5ITYA 4D80A 2MLZA 1E9LA 1YW5A 3RGPA 3K2LA 1QAQA 2R45A 4LAVA 1SXJC 4IQ2A 4P8XA 2G41A 3IHZA 1K3WA 2O92A 4ITQA 4J4NA 1IXRC 1N75A 1NHGC 1QAMA 2DG9A 2F5SA 3JYJA 3PXGA 4LJ9A 2CE7A 1TDHA 4Z2IA 3GPXA 1K9TA 4JI3M 2EO2A 2KO7A 4DR5M 3GQ3A 3UI4A 2QZ4A 4X64M 3UQIA 1HKIA 4GMQA 2DT2A 3FKEA 3TPZA 1QQWA 4DR7M 1HKKA 4NOOB 2KRUA 4NSBA 1M5YA 1NWTA 1JR3A 3AROA 3PRDA 1IX5A 3NI6A 1IBMM 4R3DA 4IBJA 4FCTA 4DV5M 3ODKA 4R0XA 1F8AB 4URIA 1VDDA 4AKIA 1XC8A 3L25A 4MNJA 1OWQA 2XP6A 2XP8A 3OA5A 5HW8A 3VDUA 3PFIA 4DH0A 5HWBA 1ZBKA 4EIWA 2A3EA 2PV1A 2A3CA 2VQEM 3K1JA 4IBKA 4I8OA 5KPRA 3J27B 3KOYE 5ITTA 3CHDA 4W5WA 1T11A 4MGIE 4LF8M 4DR2M 4GIVA 3KAGA 2PPNA 3GLHB 2KA6B 1OJLA 1R6BX 4D82A 5ITXE 2CHVA 4ZPWR 2ERCA 2WLYA 3TWKA 1NJGA 3FUTA 3PNVA 3KAHA 2JZVA 1IBLM 5A2QS 1FFRA 2UUAM 4M0DA 3FUXA 5KQ8A 4B7HA 3TWLA 1GL6A 2ZQUA 3BXWA 3B9DA 3KOWE 5FTNA 4IBDA 2L7IA 1NY5A 4Z2HA 2KXEA 3RFWA 2YFQA 3SHGB 3CHEA 1LL7A 4PTMA 5FSWA 3FUWA 3J7BA 3O5FA 2XGNA 2KR7A 5GKNA 1K82A 3U5ZA 4DR3M 3L28A 3DZDA 1LL4A 4JFMA 3IG8A 2V6ZM 1J4IA 2ITKA 4ODOA 1IY0A 1GKIA 2JA2A 3UGJA 3I51A 4ODMA 1IN5A 4M9ZA 2VCDA 4AG5A 4LJ6A 4LF7M 2B31A 3W0FA 1E6PA 1JNTA 5ITXA 2KEBA 1XHBA 4LRTA 2ZQTA 1R2ZA 3PR9A 4GHLA 2PV2A 1ZU8A 4S3JA 1WB0A 5EP3A 2F4EA 4L15A 3SATA 3O5DA 2HCBA 4OVZA 4U86A 1ORYB 2QPAA 3GRRA 1D7HA 1DGHB 2L6OA 1FAPA 2UUBM 3ARUA 3I4VA 1JR3D 1KFVA 4FD2A 3U6SA 2Z7JA 5IWAM 4NSRA 2CEAA 3U61A 4W9OA 5FTKA 1XWIA 1VF8A 2XF3A 4ZPXA 4LF9M 4GGQA 3U6QA 3VAWA 3L29A 1TFVA 3UI5A 3G6MA 4W9PA 2QBYB 2J7NA 1Q3BA 1EYMA 3CGMA 5BPVA 2XPBA 2VQFM 4ITZA 4DR4M 3LVVA 2RQSA 2RKOA 2OQ4A 4NZCA 1Q39A 4AY1A 3U6OA 1WXQA 1ZBWA 2MF9A 1HXVA 4PDGA 4DROA 4DUZM 2DWZB 4IBCA 4Q22A 3SARA 5J6EA 2E5LM 5BR8M 4DWSC 1CTNA 1D7IA 2M5ZA 3EY6A 5EP4A 4AQYM 4HLQA 2XZFA 4B3TM 4NNRA 1BL4A 2G5GX 1TH3A 1C1KA 5GQBA 4Z2LA 4P8WA 2V1CA 4IJEA 3GLGA 1DGBA 3KACA 1FKRA 1QANA 4IPXA 3AJIB 1H0GA 3O5MA 3SMPA 4GIPA 1Q1CA 4ODNA 1S3SA 3G6LA 5C1BA 3A46A 4IBIA 1YUBA 5HW7A 2R4EA 4TW6A 4LAYA 2PI6A 1XMOM 2DG4A 4U84A 3MK6A 4YHHM 2DT3A 1IY2A 4CISA 3GLIB 3U6EA 1XXHB 5EJCA 4TW7A 3VKGA 4DUYM 3U6LA 2R18A 5E26A 1QVRA 3WH0A 1KT0A 1UR9A 4XGIA 3UJNA 3E4RA 1Q6IA 3THGA 4BB9A 3K8ZA 4LJ5A 3MDYB 1LG2A 1X37A 2I7NA 4WKHA 2WK2A 2F2DA 3TQSA 3GPUA 3VK8A 1ITXA 3JR5A 4X66M 3C58A 2D7GA 1TDZA 3ALGA 4J4OA 5LMUM 3ZH9B 2F5OA 3JR4A 1W1VA 4LRSA 5JI3E 4GRIA 3O5IA 3TCZA 1Z6TA 1T3TA 4FCVA 2PPOA 1IXZA 1MU5A 1DO0A 1HT1E 5HWCA 2M1IA 5JH8A 3ARZA 5ITRA 2RUDA 2KZUA 4LJ7A 3J80S 1QPLA 2DPEA 4S3KA 1HQYE 2XH9A 3DA1A 1LL6A 2YBTA 4DR6M 1JVWA 2XPAA 5GPRA 4HL4A 3GQ4A 3O5LA 2XFTA 2XP3A 1J6YA 3SASA 4WKAA 3HHWA 8CATA 3B7XA 3SAVA 2DHRA 4L78A 1E32A 2K47A 2FE8A 4LZZA 2ZAMA 4KQZA 1PJJA 2UXBM 2LNHC 2R46A 2V1UA 2AWGA 3ARPA 3FTFA 3RMEA 3J2PB 4MAVA 3PA7A 3H9RB 3B9AA 1E94E 1D6OA 2RUQA 4MNLA 3Q8XA 4FW9A 4IBFA 2XP9A 3RE8A 4LF6M 2DZNB 3O5OA 3WD3A 3HGIA 1FKJA 1WNOA 3CGNA 3GRVA 4QHTA 1QZMA 2DXIA 4FVMA 3IKGA 1W9UA 1H6UA 1EIBA 3QOKA 3SBJA 1OFHA 3FD9A 1W5TA 5LMNM 4B7GA 1HNWM 4M9SA 2AOSA 3GPYA 3WD0A 5HTGA 4B3RM 4RF0A 5DIUA 4FCWA 4G4QA 4DWSB 1XHGA 5FTJA 2YQZA 3SFZA 1HJWA 1HJXA 1E15A 4WKFA 1UM8A 2Z4SA 2IF4A 5FTLA 3TC5A 3GRUA 4PD2A 4AW4A 1J09A 1WAWA 3KS8A 4RNAA 3MHVC 4OW0A 2A5YB 3OOBA 3VDPA 3O5KA 3L2AA 4WURA 3O5QA 3L27A 3RGSA 3O5RA 1YATA 2Y20A 4ML4A 4B7FA 1Z5AA 5EXSA 3ARVA 2PPPA 1E9RA 1FD9A 1L1TA 4L8RC 3ARWA 4DV3M 4MTVA 4KO8A 4LG2A 1HKJA 3U5ZB 2UUCM 3T15A 3KADA 1HQCA 4MGZE 3OTOM 1G59A 1W1TA 4Z8XA 1IN8A 2DZOB 3GO8A 2HKJA 2CV0A 1X6LA 3UQBA 1IBKM 3UZUA 3KCEA 2C98A 3HHYA 4ZPTR 4LFCM 4AKHA 3AOEA 2OFNA 3ILKA 3TWMA 1EQ3A 3K92A 3WKZA 4LJ8A 3ARRA 2G8LA 3W4RA 2D7HA 4OVZB 3U6DA 3ALFA 1Q3CA 2FFJA 2D7EA 2M60A 2MLYA 3KP0E 1NNUC 3I6CA 1N34M 1MX0A 3GLHA 2ZR4A 1SYTA 4Z6YA 3CHCA 1N78A 3CF2A 4MGVA 3E9SA 2XEPA 1LJYA 2QP9X 3CHFA 2Z3XA 3BOSA 1U79A 3KAIA 2CUZA 2IUZA 4YY3M 3KOZE 1ZB5A 5DYGA 4IT6A 3M0EA 3SAUA 1N36M 4DT4A 1J4HA 4DRMA 3QAUA 4L4UA 4Q7NA 2FNAA 1QPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ2 A;  3VAW A;  3IKG A;  3O5F A;  4DZ3 A;  2KR7 A;  1QPL A;  4ODQ A;  3UI5 A;  3KAB A;  5HW7 A;  4ODK A;  3UI6 A;  2MLX A;  5B8I C;  2XP6 A;  5BXJ A;  4TW6 A;  1PIN A;  3JXV A;  4LAY A;  1Q6H A;  3IK8 A;  4O2T A;  2XP8 A;  4JFM A;  2M08 A;  5I98 A;  4W9P A;  1J4I A;  4ODO A;  2ITK A;  2DG4 A;  4JYS A;  5HW8 A;  1FKS A;  4U84 A;  2OFN A;  4N19 A;  1EYM A;  5DIV A;  2KGJ A;  1F40 A;  1EQ3 A;  3CGM A;  3O5P A;  4JFL A;  4DH0 A;  5HTG A;  5HWB A;  3IKD A;  5DIU A;  1C9H A;  4DRK A;  1JNS A;  5D75 A;  5HT1 A;  2PV1 A;  1FKB A;  2XPB A;  4DRQ A;  4DRP A;  4TW8 A;  1JVW A;  4ITZ A;  4ODM A;  2MLZ A;  2XPA A;  1A7X A;  1FKH A;  2RQS A;  2N87 A;  1YW5 A;  2VCD A;  3O5L A;  4JFJ A;  1ZK6 A;  1TCO C;  2MNT A;  4ODR A;  4LAV A;  4IQ2 A;  2XP3 A;  1JNT A;  2LJ4 A;  4LAW A;  1J6Y A;  2MF9 A;  3FAP A;  4ODP A;  2XP5 A;  5GPG A;  2VN1 A;  1FKL A;  1Q6U A;  2ZQT A;  3IHZ A;  1HXV A;  2RUC A;  2ZQV A;  1T11 A;  3O5E A;  4TW7 A;  2PV2 A;  3NRK A;  4QT3 A;  3UQA A;  3O5J A;  4QIB A;  2XP7 A;  4TYO A;  3NTP A;  4J4N A;  2IF4 A;  3B7X A;  4DRO A;  5DIT A;  2MLY A;  3LUO A;  2DG9 A;  4JFI A;  4GIV A;  1R9H A;  3KAG A;  3TC5 A;  3I6C A;  1ROU A;  3JYJ A;  2F4E A;  4U85 A;  3WH0 A;  1Y0O A;  2PPN A;  1KT0 A;  5HW6 A;  5J6E A;  4FAP A;  2ZR4 A;  4JFK A;  4IQC A;  2FAP A;  2F21 A;  4ODL A;  4DIP A;  2RSE A;  3OOB A;  2UZ5 A;  3O5D A;  4MGV A;  2L2S A;  2KO7 A;  3O5K A;  1ROT A;  4U86 A;  1P5Q A;  3PRB A;  1Q6I A;  1NMV A;  3UI4 A;  1FKK A;  1D7I A;  3UQI A;  2D9F A;  2M2A A;  5HUA A;  1FJD A;  1NMW A;  2KI3 A;  2XP4 A;  3JYM A;  3MDY B;  2AWG A;  3O5Q A;  3EY6 A;  2ZQS A;  1W26 A;  3KZ7 A;  3O5R A;  3TDB A;  1YAT A;  1U79 A;  2RUR A;  1FKD A;  3KAH A;  4NNR A;  2JZV A;  1D7H A;  2F2D A;  4G2P A;  4FN2 A;  3O5G A;  1BL4 A;  3KAI A;  3PA7 A;  2PPP A;  1J4R A;  1FAP A;  1D7J A;  1FD9 A;  3H9R B;  2KE0 A;  2KFW A;  2LGO A;  2MPH A;  1NSG A;  1M5Y A;  1D6O A;  2RUQ A;  3UF8 A;  5HKG A;  3PRD A;  4J4O A;  2LPV A;  4DRN A;  4TNS A;  1B6C A;  2PBC A;  2XP9 A;  2ZQU A;  1FKG A;  4TX0 A;  3O5I A;  2ZR6 A;  4LAX A;  3NI6 A;  4DRI A;  1FKT A;  2PV3 A;  4QT2 A;  3KAD A;  3KAC A;  3TCZ A;  4DT4 A;  1FKR A;  2PPO A;  4DZ2 A;  1PBK A;  1J4H A;  4G50 A;  3O5O A;  2ZR5 A;  4IPX A;  3GPK A;  4DRJ A;  4DRM A;  1ZCN A;  3KAF A;  3RFW A;  2Y78 A;  4W9O A;  5HWC A;  2M1I A;  1KT1 A;  4C02 B;  3RGC A;  2LKN A;  4DRH A;  2Q5A A;  1FKJ A;  2K8I A;  1FKF A;  2RUD A;  3O5M A;  3ODK A;  3UQB A;  4R0X A;  1BKF A;  2FKE A;  3CGN A;  1N1A A;  1Q1C A;  1F8A B;  4ODN A;  4W9Q A;  4BF8 A;  1FKI A;  4MSP A;  1L1P A;  2DG3 A;  3KCE A;  1QPF A;  4GGQ A; 
#chains in the Genus database with same CATH topology
 4LGX A;  4B3S M;  1GLN A;  4MGK E;  3VLF B;  3B9E A;  2LXE A;  2MH8 A;  3KVW A;  2R65 A;  4L16 A;  4D81 A;  1PRB A;  4JI7 M;  1XNQ M;  3CZ8 A;  2XFS A;  3FY1 A;  3VFD A;  2LH0 A;  4WW0 A;  4JI6 M;  1SXJ B;  2L7H A;  4HBE A;  1A7X A;  4JFJ A;  2BNK A;  2X4A A;  3UK6 A;  5EP1 A;  2VF8 A;  4I5S A;  4JN6 A;  2MNT A;  3SYK A;  2LJ4 A;  2HL7 A;  5GPG A;  4LF5 M;  2Z8Y M;  2XP5 A;  2ZQV A;  3IG5 A;  4P8V A;  3KXE C;  2OLH A;  1NO1 A;  2QEN A;  4XBO A;  4JI2 M;  1R9H A;  2C99 A;  4U85 A;  4QOZ C;  3AS3 A;  3A98 B;  5C18 A;  5EXT A;  2F21 A;  2XZU A;  1XRV A;  3WHL A;  1LG1 A;  2RGO A;  1NMV A;  1Z59 A;  4QHS A;  2KI3 A;  3GLG B;  2ZM6 M;  2J7O A;  4RF1 A;  4G2P A;  4II7 A;  2K6B A;  4FN2 A;  3AS1 A;  2JY7 A;  4NXM M;  2XLJ A;  2A3A A;  3U60 B;  5JI2 E;  2OOA A;  2WSF F;  1W1Y A;  3BMB A;  4Z2J A;  1HKM A;  2X8A A;  3TE6 A;  2FH0 A;  3PVS A;  3GP1 A;  4AZF A;  1NWS A;  2ZR5 A;  1OGG A;  1RU3 A;  3ARS A;  3AV0 A;  1KT1 A;  3LQQ A;  2LKN A;  3GLF B;  2JUJ A;  4KR0 B;  1L2C A;  2G8Z A;  4MSP A;  5HBF A;  2DG3 A;  2L2S A;  4AG6 A;  2YBU A;  3W68 A;  2AHM A;  4ODQ A;  2O9O A;  1DGF A;  3WQW A;  2QBY A;  3IK8 A;  4WK9 A;  4JI4 M;  1YLA A;  4I4L A;  3SC3 A;  4LFB M;  1HJP A;  3W67 A;  1OAO C;  1V33 A;  4TW8 A;  3K9O A;  4LGM A;  4DV6 M;  3HJS A;  5KQD A;  4GC5 A;  1T6O A;  1QYR A;  1E6N A;  4LAW A;  3KP1 E;  1IFY A;  3FAP A;  1MN3 A;  1FKL A;  3M6A A;  2DWL A;  3CF0 A;  1GL7 A;  3W0L B;  5EXP A;  4X65 M;  2DAI A;  2QHO B;  1W1P A;  3SHF A;  4GHA A;  2QCU A;  2R4J A;  3KSX A;  3KW6 A;  3FYC A;  2VII A;  2L09 A;  4BLC A;  3LCU A;  7CAT A;  4UN2 B;  2NQ8 C;  3CH9 A;  4WIW A;  5EQT A;  4KHP M;  1FKK A;  4LJ4 A;  3UMM A;  2M2A A;  5HUA A;  2VDB B;  1E9S A;  1JCH B;  2C5R A;  3I4Y A;  3NBI A;  3WD4 A;  1G3I A;  1D7J A;  1G41 A;  4G4O A;  2KRK A;  3AOG A;  3A42 A;  3IHP A;  4NSO B;  1FKG A;  2QF8 A;  3LQR A;  1Q02 A;  1W9P A;  1NWU A;  1GUV A;  3HZJ A;  1IXS B;  1OFI A;  5IT9 S;  1ZBC A;  3FUU A;  4MNK A;  3PRA A;  3ZCB B;  3RM9 A;  1L1P A;  2OO9 A;  2LVA A;  3C3D A;  3ZQJ A;  3R8F A;  3GRY A;  1W5S A;  2ZBK B;  4IJF A;  4MGY E;  4CIZ A;  2KGJ A;  4CGY B;  1GRJ A;  3HHX A;  4DRQ A;  1FKB A;  4G6Z A;  2LHC A;  3DOA A;  5H37 D;  3U6P A;  1EHN A;  5IZ7 D;  1HNZ M;  4GKJ M;  1ZK6 A;  1OKS A;  1JQJ C;  4QNR A;  3HHZ A;  1NSF A;  3ARQ A;  1OTR A;  3F92 A;  1VG5 A;  3AL0 C;  3CF6 E;  1Y0O A;  2EJS A;  3MJ5 A;  4DIP A;  3FXY A;  5ITU A;  1I94 M;  4LY6 A;  4Z2K A;  3HU1 A;  4KLN A;  4GEW A;  2EA0 A;  2KDL A;  3HU3 A;  2CV1 A;  3AS2 A;  2J5Y A;  1FJG M;  4JI1 M;  3A45 A;  2Z4R A;  1VEG A;  3AKZ A;  2KE0 A;  1NSG A;  4GH9 A;  3EIH A;  4R71 A;  4G4R A;  1ZQ9 A;  2DWM A;  4DRN A;  4B08 A;  2PBC A;  3NWL A;  3PNY A;  4XAK A;  4LAX A;  1H0I A;  1OGB A;  2DT1 A;  1N32 M;  4DZ2 A;  3L26 A;  3GPK A;  1ZCN A;  2Y78 A;  1E6Z A;  2OPF A;  4LZJ A;  2YNM D;  1X6N A;  2LVQ D;  2K8I A;  3KDS E;  2YR0 A;  1PJT A;  4NL4 H;  1Z5B A;  3WD2 A;  3GQ5 A;  4ZS6 A;  3TL4 X;  4FWD A;  2LWX A;  3FYD A;  5BXJ A;  3JXV A;  1Q6H A;  5I98 A;  5EXX A;  2HHH M;  4Z2G A;  4JFL A;  3T38 A;  5FTM A;  3FRI A;  1AIP C;  1ZBV A;  2DSZ A;  2R44 A;  2N87 A;  1I4W A;  4F2L A;  1HT2 E;  5KPZ A;  3UQA A;  2ETN A;  2QSF X;  3D8B A;  3B7N A;  4NXN M;  2CV2 A;  4MPK A;  1ROU A;  2ESC A;  2LVN C;  3KS4 A;  3J81 S;  2UXD M;  2P5T A;  1D2K A;  1ZAE A;  2L4F A;  2RSE A;  1IY1 A;  2Y0T A;  1KYI A;  1J7K A;  1YE9 A;  4JI5 M;  3KFU G;  4R5E A;  1W9V A;  1TH4 A;  1N77 A;  2EUL A;  2JY5 A;  2FS1 A;  2F5P A;  4PDI A;  1D0M A;  1EDQ A;  3FTD A;  2LPV A;  4TNS A;  3AFH A;  4TX0 A;  2ZR6 A;  3WL0 A;  4QT2 A;  3GU0 A;  1G8P A;  1IN4 A;  4C02 B;  1G4A E;  1NVM A;  2HWJ A;  2XSZ A;  5KPT A;  1BKF A;  4DV7 M;  3M7G A;  2GQF A;  5B8I C;  4PCZ A;  1K3X A;  1PIN A;  4G4N A;  1UR8 A;  1FKS A;  3R9X B;  4OX9 M;  4DRK A;  1JNS A;  1R7R A;  4DWS A;  1N33 M;  2L2D A;  2Y0Q A;  3QWL A;  1J5E M;  1TCO C;  5F3W A;  1NNJ A;  4B3M M;  2VN1 A;  5DEZ A;  3O5J A;  4ZPV R;  4IT4 A;  5DIT A;  4P16 A;  3LUO A;  4MH0 E;  1IM2 A;  3EIP A;  4GC9 A;  3IEC A;  5ITQ A;  3WIJ A;  2CRU A;  3VK7 A;  1P5Q A;  1NY6 A;  4UDM A;  3WHK A;  2DSU A;  4S12 A;  4REZ A;  1HJV A;  4JI8 M;  4I81 A;  1DO2 A;  2F23 A;  2KFW A;  1JND A;  3UF8 A;  1LV7 A;  3HJQ A;  4LJA A;  1B6C A;  4LGY A;  1PJI A;  3CTW B;  2PV3 A;  3T1Y M;  3SYL A;  4DRJ A;  1KFW A;  3U61 B;  1Y8G A;  4DRH A;  2Q5A A;  3SAW A;  4LCB A;  4BF8 A;  2BJW A;  2JZ0 A;  1QZ2 A;  4DZ3 A;  3BBZ A;  3HU2 A;  4ODK A;  1TTE A;  3WL1 A;  2WSC F;  5EP2 A;  3HKP A;  1JNE A;  4N19 A;  1Z5C A;  2WZJ A;  5DIV A;  5DO2 A;  1EE8 A;  5HT1 A;  4DRP A;  1TF0 B;  1FKH A;  3FUV A;  3VKH A;  4OU7 A;  4K0K M;  1IQP A;  2DT0 A;  4ODP A;  1Q6U A;  1P3Q Q;  5FLX S;  4FWG A;  3KSJ A;  2XP7 A;  3WQV A;  3I01 M;  4JFI A;  3LVW A;  1FNN A;  3H4J A;  1WHC A;  2C9O A;  4IBB A;  4IIW A;  5HW6 A;  4JFK A;  2X49 A;  1SXJ E;  4IQC A;  3RM8 A;  1OIP A;  4PT5 A;  3PRB A;  4R7G A;  1D0K A;  4P8U A;  1ZL1 A;  4QZV B;  1PM5 A;  2DWN A;  4HBO A;  3EIE A;  1W26 A;  1HR0 M;  2BJV A;  2WM0 A;  4KOD A;  1FKD A;  3B9P A;  1TH2 A;  3U6M A;  1GPF A;  1J4R A;  2H1R A;  2Y21 A;  3ARY A;  2MPH A;  1SR0 A;  3FRH A;  3D8L A;  5HKG A;  3B8S A;  2HAK A;  2CFO A;  1PBK A;  3KAF A;  2XSZ D;  1DGH A;  2N35 A;  2FOI C;  4JV5 M;  2CHQ A;  2Q2E B;  1QAO A;  1R2Y A;  2ZAO A;  1FKI A;  4NRW A;  4L72 B;  3SMS A;  1T43 A;  2MLX A;  2JY6 B;  3ARX A;  2DKL A;  4JYS A;  2WLZ A;  3HJ8 A;  2FDM A;  4DWS D;  3HWS A;  4DV4 M;  1F40 A;  3ZC7 B;  3IKD A;  2DEN A;  5D75 A;  1SXJ A;  3GLF E;  2DAG A;  5DYI A;  1GOI A;  2RUC A;  4DR1 M;  3NRK A;  2KW0 A;  4QT3 A;  4QIB A;  5KO3 A;  1NHW C;  4TYO A;  4WJX A;  2VF7 A;  4DV2 M;  5E6J A;  1L1Z A;  1RD6 A;  4FAP A;  3AOE C;  4ODL A;  3FTE A;  2C9C A;  3T1H M;  4L6V 6;  1ROT A;  1D0L A;  2EUC A;  2O5R A;  4LF4 M;  2UXC M;  5DF0 A;  1NMW A;  2XP4 A;  3JYM A;  1NV8 A;  2DAM A;  2CP8 A;  1WGL A;  1ZMV A;  4GIT A;  2F5N A;  4IBG A;  1ZV1 A;  1IN6 A;  2F4V M;  4QOS A;  3U60 A;  4W5U A;  3GLI E;  4M9X A;  4LFA M;  2KZS A;  1KSF X;  3FTC A;  1XXH E;  4DRI A;  1FKT A;  4G50 A;  4MGH A;  4FWH A;  4GKK M;  2C96 A;  4NRV A;  1PJS A;  3GLF A;  1FKF A;  2FKE A;  3HX3 A;  1N1A A;  4W9Q A;  1C9H A;  1QDT A;  4A3V B;  1YSY A;  1D2N A;  2M08 A;  4DV1 M;  5IRE B;  3J7A S;  3WD1 A;  4BBA A;  3AQU A;  1R4G A;  2CHG A;  2JXN A;  2KNA A;  4ODR A;  1E6R A;  2RGH A;  3LMM A;  1TGU A;  3O5E A;  1NWR A;  3H4M A;  2DZL A;  4X62 M;  3NTP A;  3GPP A;  1IN7 A;  2BWB A;  3U6C A;  2KNV A;  2FAP A;  2R62 A;  3GLI A;  3ART A;  2UZ5 A;  4DBG B;  4DV0 M;  2ZAN A;  1XXH A;  4TUW A;  2DSW A;  4QNM A;  2D9F A;  1FJD A;  1V34 A;  2ZQS A;  3TDB A;  3KZ7 A;  2P4V A;  2W82 A;  1JB0 F;  2RUR A;  3DFZ A;  1L8Q A;  1GVN A;  4JYA M;  3O5G A;  2LGO A;  4JI0 M;  4AI6 A;  3RM4 A;  5DNY A;  4L3N A;  4AKG A;  1LQ0 A;  4M0W A;  2UU9 M;  3KOX E;  2DVW B;  1DGG A;  3JAM S;  1WIV A;  2F5Q A;  1XNR M;  1FFQ A;  1IXS A;  4MNM A;  4MM3 B;  2A3B A;  3RGC A;  4IBE A;  1OAI A;  3C9P A;  2KHH A;  1O6I A;  1L2D A;  1XMQ M;  1VEK A;  1L2B A;  3KAB A;  1NJF A;  3UI6 A;  4O2T A;  4CHT B;  2I7P A;  2ZTC A;  1HNX M;  4MB7 A;  1SXJ D;  1NH6 A;  2DSV A;  3O5P A;  1GJT A;  1R5L A;  3AS0 A;  3T6P A;  4HAR A;  4JXJ A;  5ITY A;  4D80 A;  2MLZ A;  1E9L A;  1YW5 A;  3RGP A;  3K2L A;  1QAQ A;  2R45 A;  4LAV A;  1SXJ C;  4IQ2 A;  4P8X A;  2G41 A;  3IHZ A;  1K3W A;  2O92 A;  4ITQ A;  4J4N A;  1IXR C;  1N75 A;  1NHG C;  1QAM A;  2DG9 A;  2F5S A;  3JYJ A;  3PXG A;  4LJ9 A;  2CE7 A;  1TDH A;  4Z2I A;  3GPX A;  1K9T A;  4JI3 M;  2O25 A;  2EO2 A;  2KO7 A;  4HEO A;  4DR5 M;  3GQ3 A;  3UI4 A;  2JNH A;  2QZ4 A;  4X64 M;  3UQI A;  1HKI A;  4GMQ A;  2DT2 A;  3FKE A;  3TPZ A;  1QQW A;  4DR7 M;  1HKK A;  2RRU A;  4NOO B;  2KRU A;  4NSB A;  1M5Y A;  1NWT A;  1JR3 A;  3ARO A;  3PRD A;  1IX5 A;  2DNA A;  3NI6 A;  2QNJ A;  3K9P A;  1IBM M;  4R3D A;  4IBJ A;  4FCT A;  4DV5 M;  3ODK A;  4R0X A;  3HY5 A;  1F8A B;  4URI A;  1VDD A;  4AKI A;  1XC8 A;  3L25 A;  4MNJ A;  1OWQ A;  2XP6 A;  2XP8 A;  3OA5 A;  5HW8 A;  2LHG A;  3VDU A;  3PFI A;  4DH0 A;  5HWB A;  1ZBK A;  4EIW A;  2A3E A;  2PV1 A;  2A3C A;  2VQE M;  3K1J A;  4IBK A;  4I8O A;  5KPR A;  3J27 B;  3KOY E;  5ITT A;  3CHD A;  4W5W A;  2DAE A;  1T11 A;  4MGI E;  4LF8 M;  2JWS A;  4DR2 M;  4GIV A;  3KAG A;  2PPN A;  3GLH B;  2QQ8 A;  1SG9 A;  2KA6 B;  1OJL A;  1R6B X;  4D82 A;  5ITX E;  2CHV A;  4ZPW R;  2ERC A;  2WLY A;  3TWK A;  1NJG A;  3FUT A;  3V76 A;  3PNV A;  3KAH A;  2JZV A;  4G3O A;  1IBL M;  5A2Q S;  1FFR A;  2UUA M;  4M0D A;  1VDL A;  3FUX A;  5KQ8 A;  4B7H A;  3TWL A;  1GL6 A;  3BXW A;  2ZQU A;  3B9D A;  3KOW E;  1GO5 A;  5FTN A;  4IBD A;  2L7I A;  1NY5 A;  1EIJ A;  4Z2H A;  2KXE A;  3RFW A;  2YFQ A;  3SHG B;  3CHE A;  1LL7 A;  4PTM A;  1V92 A;  1WR1 B;  5FSW A;  3FUW A;  3J7B A;  3O5F A;  2KR7 A;  2XGN A;  3QYE A;  5GKN A;  1K82 A;  3U5Z A;  4DR3 M;  3L28 A;  3DZD A;  1LL4 A;  4JFM A;  3IG8 A;  2V6Z M;  1J4I A;  2ITK A;  4ODO A;  1IY0 A;  1GKI A;  2JA2 A;  3UGJ A;  1XB2 B;  3I51 A;  4XK8 F;  3CGW A;  4ODM A;  2ZTD A;  2LTU A;  2BWE A;  1IN5 A;  2DI0 A;  4M9Z A;  2VCD A;  4AG5 A;  4LJ6 A;  2MR9 A;  4LF7 M;  2B31 A;  3W0F A;  1E6P A;  1JNT A;  5ITX A;  2KEB A;  1XHB A;  4LRT A;  2ZQT A;  1R2Z A;  3PR9 A;  4GHL A;  2PV2 A;  4ANR A;  1ZU8 A;  4S3J A;  1WB0 A;  3QYB A;  5EP3 A;  2F4E A;  4L15 A;  3SAT A;  3O5D A;  2HCB A;  4WP2 A;  4OVZ A;  4U86 A;  2MRO B;  1ORY B;  2QPA A;  1LTM A;  2WSE F;  3GRR A;  1D7H A;  1DGH B;  2L6O A;  1FAP A;  2UUB M;  3ARU A;  3I4V A;  1JR3 D;  1KFV A;  4FD2 A;  1QUT A;  3U6S A;  2Z7J A;  1QUS A;  5IWA M;  4NSR A;  2CEA A;  3U61 A;  4W9O A;  5FTK A;  1XWI A;  1VF8 A;  2XF3 A;  4ZPX A;  4LF9 M;  3B7Q A;  4GGQ A;  3U6Q A;  3VAW A;  3L29 A;  1TFV A;  3UI5 A;  3G6M A;  3GLG E;  4W9P A;  2QBY B;  3Q8G A;  2J7N A;  1Q3B A;  1EYM A;  1PGY A;  3CGM A;  5BPV A;  2XPB A;  2VQF M;  4ITZ A;  4DR4 M;  3LVV A;  2RQS A;  2RKO A;  3E46 A;  2OQ4 A;  4NZC A;  1Q39 A;  4AY1 A;  3U6O A;  1WXQ A;  1ZBW A;  2MF9 A;  4Y28 F;  1HXV A;  4PDG A;  4DRO A;  4DUZ M;  2DWZ B;  4IBC A;  4Q22 A;  3SAR A;  5J6E A;  2E5L M;  3B7Z A;  5BR8 M;  1VEJ A;  4DWS C;  2O01 F;  2EKK A;  1CTN A;  1D7I A;  2M5Z A;  3EY6 A;  5EP4 A;  4AQY M;  3I04 M;  4HLQ A;  2XZF A;  4B3T M;  4NNR A;  2LVO C;  1BL4 A;  2G5G X;  1TH3 A;  1C1K A;  5GQB A;  4Z2L A;  4P8W A;  2V1C A;  4IJE A;  1OIZ A;  4P17 A;  3GLG A;  1DGB A;  3KAC A;  1FKR A;  1QAN A;  2R0I A;  4IPX A;  3AJI B;  1H0G A;  3O5M A;  2PN0 A;  3SMP A;  4GIP A;  1Q1C A;  4ODN A;  1S3S A;  3G6L A;  5C1B A;  3A46 A;  4IBI A;  1YUB A;  5HW7 A;  2R4E A;  1C7Y A;  2G3Q A;  4TW6 A;  4LAY A;  2EKF A;  2PI6 A;  2DHY A;  1XMO M;  2DG4 A;  4U84 A;  3MK6 A;  1GJS A;  4YHH M;  2DT3 A;  1IY2 A;  4CIS A;  2LVP C;  3GLI B;  3U6E A;  1E44 A;  2L4E A;  1XXH B;  5EJC A;  4TW7 A;  3VKG A;  4DUY M;  3U6L A;  2R18 A;  1F4I A;  5E26 A;  1QVR A;  3WH0 A;  1KT0 A;  2K9D A;  5L8R F;  1UR9 A;  4XGI A;  3UJN A;  3E4R A;  1Q6I A;  3THG A;  4BB9 A;  3K8Z A;  4LJ5 A;  4RKU F;  3MDY B;  1DV0 A;  1LG2 A;  1X37 A;  2I7N A;  4WKH A;  2WK2 A;  2F2D A;  3TQS A;  3GPU A;  3VK8 A;  1ITX A;  3JR5 A;  1EFU B;  4X66 M;  3C58 A;  2D7G A;  1TDZ A;  3ALG A;  4J4O A;  5LMU M;  3ZH9 B;  2F5O A;  3JR4 A;  1W1V A;  4LRS A;  2K0B X;  5JI3 E;  4GRI A;  3O5I A;  2APL A;  3TCZ A;  1Z6T A;  1T3T A;  2DAK A;  4FCV A;  2PPO A;  1IXZ A;  1MU5 A;  1DO0 A;  1HT1 E;  1OQY A;  5HWC A;  2M1I A;  5JH8 A;  3ARZ A;  5ITR A;  2RUD A;  2KZU A;  4LJ7 A;  3GTY X;  3J80 S;  1QPL A;  2DPE A;  4S3K A;  1HQY E;  2XH9 A;  3DA1 A;  1GAB A;  1LL6 A;  2YBT A;  4DR6 M;  1JVW A;  2R6F A;  2XPA A;  5GPR A;  4HL4 A;  3GQ4 A;  3O5L A;  2XFT A;  2XP3 A;  2JP7 A;  1J6Y A;  1JR3 E;  4CJ6 A;  3SAS A;  4WKA A;  3HHW A;  8CAT A;  3B7X A;  3SAV A;  1UFZ A;  2DHR A;  2JZ1 A;  4L78 A;  1E32 A;  2K47 A;  2FE8 A;  4LZZ A;  2ZAM A;  4KQZ A;  1PJJ A;  2UXB M;  4Q7J A;  2LNH C;  2R46 A;  3B89 A;  3LW5 F;  3NBX X;  1ZMW A;  2V1U A;  1ZMU A;  2AWG A;  3ARP A;  3FTF A;  3RME A;  3J2P B;  1QDR A;  4MAV A;  3PA7 A;  1TR8 A;  3H9R B;  3B9A A;  1E94 E;  1D6O A;  2RUQ A;  4MNL A;  3Q8X A;  4FW9 A;  4IBF A;  2XP9 A;  3RE8 A;  4LF6 M;  2DZN B;  3O5O A;  3WD3 A;  3HGI A;  2JY8 A;  1A5T A;  1WJ7 A;  1FKJ A;  1WNO A;  2B3T A;  3CGN A;  1WGN A;  3GRV A;  4QHT A;  1QZM A;  2DXI A;  4FVM A;  3IKG A;  1W9U A;  1G71 A;  2KNZ A;  3MMP A;  1H6U A;  2MJ5 B;  1EIB A;  3QOK A;  3SBJ A;  1OFH A;  3FD9 A;  1W5T A;  5LMN M;  4B7G A;  2LBC A;  1HNW M;  4M9S A;  2AOS A;  3GPY A;  3WD0 A;  5HTG A;  4B3R M;  4RF0 A;  5DIU A;  4FCW A;  1QZE A;  2MGW A;  4G4Q A;  4DWS B;  5DFL A;  1XHG A;  5FTJ A;  2YQZ A;  3SFZ A;  1HJW A;  1BVS A;  1HJX A;  1E15 A;  4WKF A;  1UM8 A;  2Z4S A;  2OOB A;  2IF4 A;  5FTL A;  3TC5 A;  3GRU A;  4PD2 A;  4F1I A;  4AW4 A;  1J09 A;  1WAW A;  3KS8 A;  4RNA A;  3MHV C;  4OW0 A;  2A5Y B;  3OOB A;  3VDP A;  3O5K A;  3L2A A;  4WUR A;  3O5Q A;  3L27 A;  3RGS A;  3O5R A;  1YAT A;  2Y20 A;  4ML4 A;  4B7F A;  1Z5A A;  5EXS A;  3ARV A;  3LCV B;  2PPP A;  1E9R A;  1FD9 A;  3GLH E;  1CUK A;  1L1T A;  4L8R C;  3ARW A;  4DV3 M;  4MTV A;  4KO8 A;  4LG2 A;  1HKJ A;  3B74 A;  3U5Z B;  2UUC M;  3T15 A;  3KAD A;  1HQC A;  4MGZ E;  3OTO M;  1G59 A;  1W1T A;  4Z8X A;  1IN8 A;  2DZO B;  3GO8 A;  2HKJ A;  2CV0 A;  4NC6 A;  1X6L A;  3UQB A;  1IBK M;  3UZU A;  2H5X A;  2GNO A;  3KCE A;  2C98 A;  4KT0 F;  3HHY A;  4ZPT R;  4LFC M;  4AKH A;  3AOE A;  2OFN A;  3ILK A;  3TWM A;  1EQ3 A;  3K92 A;  3WKZ A;  4LJ8 A;  3ARR A;  1NV9 A;  2G8L A;  3W4R A;  2D7H A;  4OVZ B;  1AUA A;  3U6D A;  1MJG M;  3ALF A;  1Q3C A;  2FFJ A;  2D7E A;  2M60 A;  2MLY A;  3KP0 E;  1NNU C;  3I6C A;  1N34 M;  1MX0 A;  3GLH A;  2ZR4 A;  1VQ1 A;  4Z6Y A;  1SYT A;  3FE3 A;  3CHC A;  1N78 A;  3CF2 A;  4MGV A;  3E9S A;  2XEP A;  1LJY A;  2B5U B;  2QP9 X;  3CHF A;  2Z3X A;  3BOS A;  1U79 A;  3C3E A;  1PJQ A;  3KAI A;  2CUZ A;  2CWB A;  2IUZ A;  3E21 A;  4YY3 M;  3KOZ E;  1ZB5 A;  5DYG A;  4IT6 A;  3M0E A;  3SAU A;  1N36 M;  4DT4 A;  1J4H A;  4DRM A;  3QAU A;  4L4U A;  4Q7N A;  2FNA A;  1QPF A; 
#chains in the Genus database with same CATH homology
 4LGX A;  4B3S M;  1GLN A;  4MGK E;  3VLF B;  3B9E A;  2LXE A;  3KVW A;  2R65 A;  4L16 A;  4D81 A;  4JI7 M;  1XNQ M;  3CZ8 A;  2XFS A;  3FY1 A;  3VFD A;  2LH0 A;  4WW0 A;  4JI6 M;  1SXJ B;  2L7H A;  4HBE A;  1A7X A;  4JFJ A;  2BNK A;  2X4A A;  3UK6 A;  5EP1 A;  4I5S A;  4JN6 A;  2MNT A;  3SYK A;  2LJ4 A;  2HL7 A;  5GPG A;  4LF5 M;  2XP5 A;  2ZQV A;  3IG5 A;  4P8V A;  3KXE C;  2OLH A;  2QEN A;  4XBO A;  4JI2 M;  1R9H A;  2C99 A;  4U85 A;  4QOZ C;  3AS3 A;  3A98 B;  5C18 A;  5EXT A;  2F21 A;  2XZU A;  1XRV A;  3WHL A;  1LG1 A;  2RGO A;  1NMV A;  1Z59 A;  4QHS A;  2KI3 A;  3GLG B;  2ZM6 M;  2J7O A;  4RF1 A;  4G2P A;  4II7 A;  4FN2 A;  3AS1 A;  4NXM M;  2XLJ A;  2A3A A;  3U60 B;  5JI2 E;  1W1Y A;  4Z2J A;  1HKM A;  2X8A A;  3TE6 A;  3PVS A;  3GP1 A;  4AZF A;  1NWS A;  2ZR5 A;  1OGG A;  3ARS A;  3AV0 A;  1KT1 A;  3LQQ A;  2LKN A;  3GLF B;  4KR0 B;  1L2C A;  2G8Z A;  4MSP A;  5HBF A;  2DG3 A;  2L2S A;  4AG6 A;  2YBU A;  2AHM A;  4ODQ A;  2O9O A;  1DGF A;  3WQW A;  2QBY A;  3IK8 A;  4WK9 A;  4JI4 M;  4I4L A;  3SC3 A;  4LFB M;  4TW8 A;  4DV6 M;  4LGM A;  3HJS A;  5KQD A;  4GC5 A;  1QYR A;  1E6N A;  4LAW A;  3KP1 E;  3FAP A;  1FKL A;  3M6A A;  2DWL A;  3CF0 A;  1GL7 A;  3W0L B;  5EXP A;  4X65 M;  1W1P A;  3SHF A;  4GHA A;  2QCU A;  2R4J A;  3KSX A;  3KW6 A;  3FYC A;  2VII A;  2L09 A;  4BLC A;  7CAT A;  2NQ8 C;  3CH9 A;  4WIW A;  5EQT A;  4KHP M;  1FKK A;  4LJ4 A;  3UMM A;  2M2A A;  5HUA A;  1E9S A;  2C5R A;  3I4Y A;  3NBI A;  3WD4 A;  1G3I A;  1D7J A;  1G41 A;  4G4O A;  2KRK A;  3AOG A;  3A42 A;  4NSO B;  1FKG A;  2QF8 A;  3LQR A;  1W9P A;  1NWU A;  1GUV A;  1IXS B;  1OFI A;  5IT9 S;  1ZBC A;  3FUU A;  4MNK A;  3PRA A;  3ZCB B;  3RM9 A;  1L1P A;  3R8F A;  3GRY A;  1W5S A;  2ZBK B;  4IJF A;  4MGY E;  2KGJ A;  4CGY B;  3HHX A;  4DRQ A;  1FKB A;  4G6Z A;  5H37 D;  3DOA A;  3U6P A;  1EHN A;  5IZ7 D;  1HNZ M;  4GKJ M;  1ZK6 A;  1JQJ C;  4QNR A;  3HHZ A;  1NSF A;  3ARQ A;  3AL0 C;  3CF6 E;  1Y0O A;  3MJ5 A;  4DIP A;  3FXY A;  5ITU A;  1I94 M;  4LY6 A;  4Z2K A;  3HU1 A;  4KLN A;  2EA0 A;  3HU3 A;  2CV1 A;  3AS2 A;  1FJG M;  4JI1 M;  3A45 A;  2Z4R A;  3AKZ A;  2KE0 A;  1NSG A;  4GH9 A;  3EIH A;  4G4R A;  1ZQ9 A;  2DWM A;  4DRN A;  4B08 A;  2PBC A;  3NWL A;  3PNY A;  4XAK A;  4LAX A;  1H0I A;  1OGB A;  2DT1 A;  1N32 M;  4DZ2 A;  3L26 A;  3GPK A;  1ZCN A;  2Y78 A;  1E6Z A;  2OPF A;  4LZJ A;  2YNM D;  1X6N A;  2K8I A;  3KDS E;  2YR0 A;  4NL4 H;  1Z5B A;  3WD2 A;  3GQ5 A;  4ZS6 A;  3TL4 X;  4FWD A;  2LWX A;  3FYD A;  5BXJ A;  3JXV A;  1Q6H A;  5I98 A;  5EXX A;  2HHH M;  4Z2G A;  4JFL A;  3T38 A;  5FTM A;  1ZBV A;  2DSZ A;  2N87 A;  1I4W A;  1HT2 E;  5KPZ A;  3UQA A;  3D8B A;  4NXN M;  2CV2 A;  4MPK A;  1ROU A;  2ESC A;  3KS4 A;  3J81 S;  2UXD M;  2P5T A;  1D2K A;  1ZAE A;  2RSE A;  1IY1 A;  2Y0T A;  1KYI A;  1J7K A;  1YE9 A;  4JI5 M;  3KFU G;  4R5E A;  1W9V A;  1TH4 A;  1N77 A;  2F5P A;  4PDI A;  1EDQ A;  3FTD A;  2LPV A;  4TNS A;  3AFH A;  4TX0 A;  2ZR6 A;  3WL0 A;  4QT2 A;  1G8P A;  1IN4 A;  4C02 B;  1G4A E;  1NVM A;  2XSZ A;  5KPT A;  1BKF A;  4DV7 M;  3M7G A;  5B8I C;  4PCZ A;  1K3X A;  1PIN A;  4G4N A;  1UR8 A;  1FKS A;  3R9X B;  4OX9 M;  4DRK A;  1JNS A;  1R7R A;  4DWS A;  1N33 M;  2Y0Q A;  3QWL A;  1J5E M;  1TCO C;  5F3W A;  1NNJ A;  4B3M M;  2VN1 A;  5DEZ A;  3O5J A;  4ZPV R;  4IT4 A;  5DIT A;  4P16 A;  3LUO A;  4MH0 E;  1IM2 A;  4GC9 A;  5ITQ A;  3WIJ A;  3VK7 A;  1P5Q A;  1NY6 A;  3WHK A;  2DSU A;  4S12 A;  4REZ A;  1HJV A;  4JI8 M;  4I81 A;  1DO2 A;  2KFW A;  1JND A;  3UF8 A;  1LV7 A;  3HJQ A;  4LJA A;  1B6C A;  4LGY A;  1PJI A;  3CTW B;  2PV3 A;  3T1Y M;  3SYL A;  4DRJ A;  1KFW A;  3U61 B;  4DRH A;  2Q5A A;  3SAW A;  4LCB A;  4BF8 A;  2BJW A;  1QZ2 A;  4DZ3 A;  3HU2 A;  4ODK A;  3WL1 A;  5EP2 A;  3HKP A;  1JNE A;  4N19 A;  1Z5C A;  5DIV A;  5DO2 A;  1EE8 A;  5HT1 A;  4DRP A;  1FKH A;  3FUV A;  3VKH A;  4OU7 A;  4K0K M;  1IQP A;  2DT0 A;  4ODP A;  1Q6U A;  5FLX S;  4FWG A;  3KSJ A;  2XP7 A;  3WQV A;  4JFI A;  3LVW A;  1FNN A;  2C9O A;  4IBB A;  4IIW A;  5HW6 A;  4JFK A;  2X49 A;  1SXJ E;  4IQC A;  3RM8 A;  4PT5 A;  3PRB A;  4R7G A;  4P8U A;  1ZL1 A;  4QZV B;  1PM5 A;  2DWN A;  4HBO A;  3EIE A;  1W26 A;  1HR0 M;  2BJV A;  2WM0 A;  4KOD A;  1FKD A;  3B9P A;  1TH2 A;  3U6M A;  1GPF A;  1J4R A;  2H1R A;  2Y21 A;  3ARY A;  2MPH A;  1SR0 A;  3D8L A;  5HKG A;  3B8S A;  2CFO A;  1PBK A;  3KAF A;  2XSZ D;  1DGH A;  2FOI C;  4JV5 M;  2CHQ A;  2Q2E B;  1QAO A;  1R2Y A;  2ZAO A;  1FKI A;  4NRW A;  4L72 B;  3SMS A;  2MLX A;  3ARX A;  4JYS A;  2WLZ A;  3HJ8 A;  2FDM A;  4DWS D;  3HWS A;  4DV4 M;  1F40 A;  3ZC7 B;  3IKD A;  5D75 A;  1SXJ A;  5DYI A;  1GOI A;  2RUC A;  4DR1 M;  3NRK A;  2KW0 A;  4QT3 A;  4QIB A;  5KO3 A;  1NHW C;  4TYO A;  4WJX A;  4DV2 M;  5E6J A;  1L1Z A;  1RD6 A;  4FAP A;  3AOE C;  4ODL A;  3FTE A;  2C9C A;  3T1H M;  1ROT A;  2EUC A;  2O5R A;  4LF4 M;  2UXC M;  5DF0 A;  1NMW A;  2XP4 A;  3JYM A;  4GIT A;  2F5N A;  4IBG A;  1IN6 A;  2F4V M;  4QOS A;  3U60 A;  4W5U A;  4M9X A;  4LFA M;  2KZS A;  1KSF X;  3FTC A;  4DRI A;  1FKT A;  4G50 A;  4MGH A;  4FWH A;  4GKK M;  2C96 A;  4NRV A;  3GLF A;  1FKF A;  2FKE A;  1N1A A;  4W9Q A;  1C9H A;  4A3V B;  1YSY A;  1D2N A;  2M08 A;  4DV1 M;  5IRE B;  3J7A S;  3WD1 A;  4BBA A;  3AQU A;  2CHG A;  4ODR A;  1E6R A;  2RGH A;  3LMM A;  1TGU A;  3O5E A;  1NWR A;  3H4M A;  4X62 M;  3NTP A;  3GPP A;  1IN7 A;  3U6C A;  2FAP A;  2R62 A;  3GLI A;  3ART A;  2UZ5 A;  4DV0 M;  2ZAN A;  1XXH A;  4TUW A;  2DSW A;  4QNM A;  2D9F A;  1FJD A;  2ZQS A;  3TDB A;  3KZ7 A;  2W82 A;  2RUR A;  3DFZ A;  1L8Q A;  1GVN A;  4JYA M;  3O5G A;  2LGO A;  4JI0 M;  4AI6 A;  3RM4 A;  5DNY A;  4L3N A;  4AKG A;  1LQ0 A;  4M0W A;  2UU9 M;  3KOX E;  2DVW B;  1DGG A;  3JAM S;  2F5Q A;  1XNR M;  1FFQ A;  4MNM A;  4MM3 B;  2A3B A;  3RGC A;  4IBE A;  1O6I A;  1L2D A;  1XMQ M;  1L2B A;  3KAB A;  1NJF A;  3UI6 A;  4O2T A;  4CHT B;  2I7P A;  1HNX M;  4MB7 A;  1SXJ D;  1NH6 A;  2DSV A;  3O5P A;  3AS0 A;  4HAR A;  4JXJ A;  5ITY A;  4D80 A;  2MLZ A;  1E9L A;  1YW5 A;  3RGP A;  3K2L A;  1QAQ A;  2R45 A;  4LAV A;  1SXJ C;  4IQ2 A;  4P8X A;  2G41 A;  3IHZ A;  1K3W A;  2O92 A;  4ITQ A;  4J4N A;  1IXR C;  1N75 A;  1NHG C;  1QAM A;  2DG9 A;  2F5S A;  3JYJ A;  3PXG A;  4LJ9 A;  2CE7 A;  1TDH A;  4Z2I A;  3GPX A;  1K9T A;  4JI3 M;  2EO2 A;  2KO7 A;  4DR5 M;  3GQ3 A;  3UI4 A;  2QZ4 A;  4X64 M;  3UQI A;  1HKI A;  4GMQ A;  2DT2 A;  3FKE A;  3TPZ A;  1QQW A;  4DR7 M;  1HKK A;  4NOO B;  2KRU A;  4NSB A;  1M5Y A;  1NWT A;  1JR3 A;  3ARO A;  3PRD A;  1IX5 A;  3NI6 A;  1IBM M;  4R3D A;  4IBJ A;  4FCT A;  4DV5 M;  3ODK A;  4R0X A;  1F8A B;  4URI A;  1VDD A;  4AKI A;  1XC8 A;  3L25 A;  4MNJ A;  1OWQ A;  2XP6 A;  2XP8 A;  3OA5 A;  5HW8 A;  3VDU A;  3PFI A;  4DH0 A;  5HWB A;  1ZBK A;  4EIW A;  2A3E A;  2PV1 A;  2A3C A;  2VQE M;  3K1J A;  4IBK A;  4I8O A;  5KPR A;  3J27 B;  3KOY E;  5ITT A;  3CHD A;  4W5W A;  1T11 A;  4MGI E;  4LF8 M;  4DR2 M;  4GIV A;  3KAG A;  2PPN A;  3GLH B;  2KA6 B;  1OJL A;  1R6B X;  4D82 A;  5ITX E;  2CHV A;  4ZPW R;  2ERC A;  2WLY A;  3TWK A;  1NJG A;  3FUT A;  3PNV A;  3KAH A;  2JZV A;  1IBL M;  5A2Q S;  1FFR A;  2UUA M;  4M0D A;  3FUX A;  5KQ8 A;  4B7H A;  3TWL A;  1GL6 A;  2ZQU A;  3BXW A;  3B9D A;  3KOW E;  5FTN A;  4IBD A;  2L7I A;  1NY5 A;  4Z2H A;  2KXE A;  3RFW A;  2YFQ A;  3SHG B;  3CHE A;  1LL7 A;  4PTM A;  5FSW A;  3FUW A;  3J7B A;  3O5F A;  2XGN A;  2KR7 A;  5GKN A;  1K82 A;  3U5Z A;  4DR3 M;  3L28 A;  3DZD A;  1LL4 A;  4JFM A;  3IG8 A;  2V6Z M;  1J4I A;  2ITK A;  4ODO A;  1IY0 A;  1GKI A;  2JA2 A;  3UGJ A;  3I51 A;  4ODM A;  1IN5 A;  4M9Z A;  2VCD A;  4AG5 A;  4LJ6 A;  4LF7 M;  2B31 A;  3W0F A;  1E6P A;  1JNT A;  5ITX A;  2KEB A;  1XHB A;  4LRT A;  2ZQT A;  1R2Z A;  3PR9 A;  4GHL A;  2PV2 A;  1ZU8 A;  4S3J A;  1WB0 A;  5EP3 A;  2F4E A;  4L15 A;  3SAT A;  3O5D A;  2HCB A;  4OVZ A;  4U86 A;  1ORY B;  2QPA A;  3GRR A;  1D7H A;  1DGH B;  2L6O A;  1FAP A;  2UUB M;  3ARU A;  3I4V A;  1JR3 D;  1KFV A;  4FD2 A;  3U6S A;  2Z7J A;  5IWA M;  4NSR A;  2CEA A;  3U61 A;  4W9O A;  5FTK A;  1XWI A;  1VF8 A;  2XF3 A;  4ZPX A;  4LF9 M;  4GGQ A;  3U6Q A;  3VAW A;  3L29 A;  1TFV A;  3UI5 A;  3G6M A;  4W9P A;  2QBY B;  2J7N A;  1Q3B A;  1EYM A;  3CGM A;  5BPV A;  2XPB A;  2VQF M;  4ITZ A;  4DR4 M;  3LVV A;  2RQS A;  2RKO A;  2OQ4 A;  4NZC A;  1Q39 A;  4AY1 A;  3U6O A;  1WXQ A;  1ZBW A;  2MF9 A;  1HXV A;  4PDG A;  4DRO A;  4DUZ M;  2DWZ B;  4IBC A;  4Q22 A;  3SAR A;  5J6E A;  2E5L M;  5BR8 M;  4DWS C;  1CTN A;  1D7I A;  2M5Z A;  3EY6 A;  5EP4 A;  4AQY M;  4HLQ A;  2XZF A;  4B3T M;  4NNR A;  1BL4 A;  2G5G X;  1TH3 A;  1C1K A;  5GQB A;  4Z2L A;  4P8W A;  2V1C A;  4IJE A;  3GLG A;  1DGB A;  3KAC A;  1FKR A;  1QAN A;  4IPX A;  3AJI B;  1H0G A;  3O5M A;  3SMP A;  4GIP A;  1Q1C A;  4ODN A;  1S3S A;  3G6L A;  5C1B A;  3A46 A;  4IBI A;  1YUB A;  5HW7 A;  2R4E A;  4TW6 A;  4LAY A;  2PI6 A;  1XMO M;  2DG4 A;  4U84 A;  3MK6 A;  4YHH M;  2DT3 A;  1IY2 A;  4CIS A;  3GLI B;  3U6E A;  1XXH B;  5EJC A;  4TW7 A;  3VKG A;  4DUY M;  3U6L A;  2R18 A;  5E26 A;  1QVR A;  3WH0 A;  1KT0 A;  1UR9 A;  4XGI A;  3UJN A;  3E4R A;  1Q6I A;  3THG A;  4BB9 A;  3K8Z A;  4LJ5 A;  3MDY B;  1LG2 A;  1X37 A;  2I7N A;  4WKH A;  2WK2 A;  2F2D A;  3TQS A;  3GPU A;  3VK8 A;  1ITX A;  3JR5 A;  4X66 M;  3C58 A;  2D7G A;  1TDZ A;  3ALG A;  4J4O A;  5LMU M;  3ZH9 B;  2F5O A;  3JR4 A;  1W1V A;  4LRS A;  5JI3 E;  4GRI A;  3O5I A;  3TCZ A;  1Z6T A;  1T3T A;  4FCV A;  2PPO A;  1IXZ A;  1MU5 A;  1DO0 A;  1HT1 E;  5HWC A;  2M1I A;  5JH8 A;  3ARZ A;  5ITR A;  2RUD A;  2KZU A;  4LJ7 A;  3J80 S;  1QPL A;  2DPE A;  4S3K A;  1HQY E;  2XH9 A;  3DA1 A;  1LL6 A;  2YBT A;  4DR6 M;  1JVW A;  2XPA A;  5GPR A;  4HL4 A;  3GQ4 A;  3O5L A;  2XFT A;  2XP3 A;  1J6Y A;  3SAS A;  4WKA A;  3HHW A;  8CAT A;  3B7X A;  3SAV A;  2DHR A;  4L78 A;  1E32 A;  2K47 A;  2FE8 A;  4LZZ A;  2ZAM A;  4KQZ A;  1PJJ A;  2UXB M;  2LNH C;  2R46 A;  2V1U A;  2AWG A;  3ARP A;  3FTF A;  3RME A;  3J2P B;  4MAV A;  3PA7 A;  3H9R B;  3B9A A;  1E94 E;  1D6O A;  2RUQ A;  4MNL A;  3Q8X A;  4FW9 A;  4IBF A;  2XP9 A;  3RE8 A;  4LF6 M;  2DZN B;  3O5O A;  3WD3 A;  3HGI A;  1FKJ A;  1WNO A;  3CGN A;  3GRV A;  4QHT A;  1QZM A;  2DXI A;  4FVM A;  3IKG A;  1W9U A;  1H6U A;  1EIB A;  3QOK A;  3SBJ A;  1OFH A;  3FD9 A;  1W5T A;  5LMN M;  4B7G A;  1HNW M;  4M9S A;  2AOS A;  3GPY A;  3WD0 A;  5HTG A;  4B3R M;  4RF0 A;  5DIU A;  4FCW A;  4G4Q A;  4DWS B;  1XHG A;  5FTJ A;  2YQZ A;  3SFZ A;  1HJW A;  1HJX A;  1E15 A;  4WKF A;  1UM8 A;  2Z4S A;  2IF4 A;  5FTL A;  3TC5 A;  3GRU A;  4PD2 A;  4AW4 A;  1J09 A;  1WAW A;  3KS8 A;  4RNA A;  3MHV C;  4OW0 A;  2A5Y B;  3OOB A;  3VDP A;  3O5K A;  3L2A A;  4WUR A;  3O5Q A;  3L27 A;  3RGS A;  3O5R A;  1YAT A;  2Y20 A;  4ML4 A;  4B7F A;  1Z5A A;  5EXS A;  3ARV A;  2PPP A;  1E9R A;  1FD9 A;  1L1T A;  4L8R C;  3ARW A;  4DV3 M;  4MTV A;  4KO8 A;  4LG2 A;  1HKJ A;  3U5Z B;  2UUC M;  3T15 A;  3KAD A;  1HQC A;  4MGZ E;  3OTO M;  1G59 A;  1W1T A;  4Z8X A;  1IN8 A;  2DZO B;  3GO8 A;  2HKJ A;  2CV0 A;  1X6L A;  3UQB A;  1IBK M;  3UZU A;  3KCE A;  2C98 A;  3HHY A;  4ZPT R;  4LFC M;  4AKH A;  3AOE A;  2OFN A;  3ILK A;  3TWM A;  1EQ3 A;  3K92 A;  3WKZ A;  4LJ8 A;  3ARR A;  2G8L A;  3W4R A;  2D7H A;  4OVZ B;  3U6D A;  3ALF A;  1Q3C A;  2FFJ A;  2D7E A;  2M60 A;  2MLY A;  3KP0 E;  1NNU C;  3I6C A;  1N34 M;  1MX0 A;  3GLH A;  2ZR4 A;  1SYT A;  4Z6Y A;  3CHC A;  1N78 A;  3CF2 A;  4MGV A;  3E9S A;  2XEP A;  1LJY A;  2QP9 X;  3CHF A;  2Z3X A;  3BOS A;  1U79 A;  3KAI A;  2CUZ A;  2IUZ A;  4YY3 M;  3KOZ E;  1ZB5 A;  5DYG A;  4IT6 A;  3M0E A;  3SAU A;  1N36 M;  4DT4 A;  1J4H A;  4DRM A;  3QAU A;  4L4U A;  4Q7N A;  2FNA A;  1QPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...