3RFWA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally-related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
252
structure length
252
Chain Sequence
ATVATVNGKSISDTEVSEFFAPMLRGQDFKTLPDNQKKALIQQYIMQDLILQDAKKQNLEKDPLYTKELDRAKDAILVNVYQEKILNTIKIDAAKVKAFYDQNKDKYVKPARVQAKHILVATEKEAKDIINELKGLKGKELDAKFSELAKEKSIDPGSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTTPVKTNFGYHVILKENSQAKGQIKFDEVKQGIENGLKFEEFKKVINQKGQDLLNSAKVEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally-related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Chaperone
molecule keywords Cell-binding factor 2
total genus 77
structure length 252
sequence length 252
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1040 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3rfwA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rfwA03
1FJDA 4ODRA 1ZCNA 1YATA 2JZVA 3ODKA 1D7JA 4ITZA 4JFLA 4LAXA 2Q5AA 5DIVA 2VN1A 1Q1CA 1M5YA 1EYMA 2M2AA 4JFIA 3TDBA 5HWCA 1JVWA 3TCZA 1A7XA 1QPFA 2LGOA 3O5EA 1F8AB 1QZ2A 1ZK6A 5HUAA 2FKEA 1Q6HA 3PRDA 5DIUA 1J4RA 2ZQVA 2L2SA 4FN2A 3JYMA 4QIBA 4DH0A 1FKIA 1R9HA 2PV3A 3KAHA 4DRNA 5HKGA 1Q6UA 1ROTA 1YW5A 2F21A 3KCEA 5HW8A 3UQAA 3UI4A 2F4EA 3JXVA 3VAWA 1JNSA 2M08A 4N19A 2KFWA 3O5MA 4TW8A 4IQ2A 2DG9A 4G50A 2XP5A 1W26A 1FKBA 2ZR5A 3KZ7A 4ODMA 4C02B 4TYOA 1FKRA 3GPKA 1D6OA 1C9HA 2D9FA 2MF9A 1PBKA 3OOBA 4JFMA 3KABA 1FD9A 2RUQA 3PA7A 1KT0A 4BF8A 3CGMA 2ZQUA 1FAPA 3KAFA 1EQ3A 1FKLA 5HT1A 3UQBA 5HWBA 5BXJA 1Q6IA 1FKJA 3IHZA 2FAPA 4DRIA 4DRKA 1PINA 4ODQA 4R0XA 2PBCA 4DRQA 2XPBA 4DRJA 2M1IA 2MNTA 3O5JA 4DZ2A 4FAPA 3O5IA 4U84A 3KACA 2XP9A 2UZ5A 1ROUA 1Y0OA 3KAIA 1NMWA 2KGJA 2N87A 3H9RB 3LUOA 4ODNA 2RQSA 1JNTA 2KR7A 4DROA 2LJ4A 4G2PA 4LAYA 4TW7A 1FKKA 1FKTA 1J4HA 3TC5A 2KO7A 2MPHA 3O5FA 4W9QA 3JYJA 3I6CA 4DZ3A 2Y78A 3UQIA 4DRMA 5HTGA 3IKGA 1HXVA 2LPVA 4JYSA 3UI5A 1N1AA 3IKDA 1L1PA 4TX0A 2PV1A 1TCOC 3NTPA 4GGQA 2KE0A 2PPPA 2PPOA 1P5QA 4IPXA 4QT2A 2MLYA 4MGVA 5J6EA 2VCDA 3O5KA 2ZR6A 3CGNA 3UF8A 3UI6A 2ZQSA 2RUDA 3IK8A 4W9PA 4TW6A 3PRBA 1QPLA 4NNRA 1FKSA 3O5GA 1FKGA 2ZQTA 1J4IA 5HW7A 1FKHA 5D75A 2ITKA 3NI6A 4U86A 3EY6A 1T11A 4DT4A 2XPAA 1NSGA 3RGCA 4LAWA 4QT3A 2RUCA 3O5PA 3O5LA 1F40A 4DRPA 5DITA 2ZR4A 2AWGA 2KI3A 4O2TA 2DG4A 1B6CA 5B8IC 2DG3A 3KAGA 4ODLA 3O5DA 4ODOA 2RURA 4DRHA 3NRKA 4LAVA 1J6YA 4GIVA 3RFWA 4W9OA 2MLXA 3O5OA 2K8IA 1D7HA 1FKDA 2OFNA 1FKFA 2PV2A 2XP4A 4JFKA 4U85A 4J4OA 4TNSA 2MLZA 3MDYB 5GPGA 2IF4A 2RSEA 2XP7A 3FAPA 3O5QA 2XP6A 4JFJA 4ODPA 1BKFA 2XP8A 2F2DA 1NMVA 4MSPA 4ODKA 1U79A 1D7IA 2LKNA 2PPNA 1BL4A 5I98A 1KT1A 3B7XA 4J4NA 5HW6A 4IQCA 2XP3A 3WH0A 4DIPA 3KADA 3O5RA
chains in the Genus database with same CATH superfamily
1H0IA 1M5YA 3IHPA 3TDBA 2DKLA 2MROB 1LJYA 3QYEA 3ARXA 4F2LA 1Q6HA 3GRYA 1X6NA 3D8BA 3KAHA 1IY1A 1TR8A 4I8OA 2KNVA 3T38A 1OQYA 4IIWA 3FTDA 2KFWA 4PDGA 4JXJA 3MHVC 4D81A 2FFJA 2DAKA 1FKRA 3B7NA 1NO1A 1DGGA 2MF9A 3LQQA 4ZPXA 2HKJA 1N77A 4BF8A 3CGMA 1HJPA 1WIVA 1YSYA 1FKJA 2JNHA 3WKZA 3CGWA 3W4RA 1QUSA 4IBIA 2X4AA 1XNRM 1Z5BA 2I7NA 3DA1A 3HHYA 2PPOA 4IPXA 4QT2A 4GC9A 2O01F 5DYGA 2WLZA 3WHKA 1D0LA 1J4IA 4DUYM 4Z8XA 4EIWA 1HKMA 3SAVA 4L78A 4ODOA 4DRHA 4HARA 3VFDA 4C02B 1JB0F 2LVAA 2DSUA 3NBXX 4AI6A 3MDYB 4LG2A 3O5QA 4LJ9A 1IBLM 3JAMS 4S3JA 2P5TA 1XNQM 2DWNA 2OPFA 4JI8M 4P16A 3ODKA 3ARWA 3GPUA 3I01M 2VN1A 4LF6M 1EYMA 2M2AA 4JFIA 4GRIA 4HEOA 1HR0M 4S12A 3KSXA 3E4RA 4X65M 2K47A 2DI0A 3KCEA 2JWSA 1SYTA 4FWDA 2KZSA 2RKOA 4N19A 1XXHE 2A5YB 1L8QA 1QDTA 1W5SA 2YR0A 3KZ7A 4MGKE 1XB2B 7CATA 5BPVA 1G71A 2JA2A 1WB0A 1C1KA 1EIBA 2FAPA 1JR3A 2XPBA 1JNEA 4U84A 3GTYX 3FUTA 1IN6A 2HHHM 1E9SA 2QBYB 3HJSA 2XZUA 1R4GA 5C18A 4LFCM 2ZANA 2RGOA 1LL6A 3IKDA 2ZAMA 2PV1A 1TCOC 1FJGM 4LF5M 5A2QS 4L72B 3FKEA 1NJFA 5DEZA 3HU2A 3U6DA 2KRUA 2D7HA 2AWGA 2LH0A 1OGBA 4IJFA 2V6ZM 2BJVA 5EP3A 2DWMA 2LKNA 4LCBA 2JP7A 4Z6YA 3PVSA 2KNAA 5C1BA 2Q5AA 1IX5A 1K9TA 1PRBA 1NV8A 1LV7A 3FTFA 1ZK6A 2CV2A 3JR5A 1PJTA 3J80S 3B7QA 2F4EA 3O5MA 4FCWA 3J7BA 4D80A 1MU5A 1ORYB 3I4YA 1E9LA 2C98A 2D7EA 3SAWA 3GLFB 1HJVA 2C9OA 3U61B 2PBCA 4NSBA 1UM8A 3GQ5A 3GO8A 4IT6A 4X66M 1I94M 2UZ5A 3WL1A 2KGJA 4B7FA 3H9RB 1Z59A 2O9OA 2JY8A 4DRMA 4Q7JA 3UI5A 2BWEA 3ZH9B 2O25A 5BR8M 3NTPA 2B5UB 4GGQA 2XSZA 1IBKM 4KR0B 4R71A 4LFBM 4ZPWR 1PGYA 5FSWA 3KXEC 4MB7A 1ZMUA 1L1ZA 5DO2A 1E15A 2MJ5B 2XPAA 3K2LA 1S3SA 1L2CA 4QHSA 1IFYA 3J7AS 3ARPA 4LGYA 4L3NA 2PV2A 1FKDA 1KSFX 1YE9A 4I4LA 5DYIA 4DR5M 1QUTA 2L4EA 5IT9S 4LJ7A 4J4NA 3L27A 3U6EA 2Y0TA 5H37D 1NVMA 2JY7A 1W1TA 2XFSA 1ZQ9A 2DAGA 4GKKM 3L2AA 2N35A 2DXIA 4JI4M 5FTLA 1GPFA 2BJWA 3GPPA 3B8SA 1OAIA 2DZNB 2PV3A 3C3DA 2QENA 1NWSA 3KOZE 5DNYA 2EKKA 3B89A 3LW5F 3VAWA 1I4WA 1Q02A 3JR4A 1Z6TA 2UU9M 3BXWA 3GPKA 5EXTA 4MNLA 2CV0A 4JI7M 2C96A 1Q3CA 3TE6A 5HT1A 4UN2B 1E6NA 4B3SM 3U6CA 2HWJA 1AIPC 3GQ3A 3GLGA 5KO3A 4P17A 4MGYE 4LRSA 2N87A 3VLFB 2RQSA 3TC5A 4PCZA 1ZMWA 2EKFA 4MPKA 1QAQA 2LVQD 2UUCM 2Y20A 2P4VA 3SBJA 5LMNM 3O5KA 1E94E 2ZQSA 1E6RA 2JUJA 4W9PA 1QANA 1IN7A 3PRAA 3O5GA 1XC8A 2JZ0A 4D82A 2DWLA 4W5WA 3FRHA 2PI6A 1XHGA 5GQBA 4BB9A 2ZTCA 4LF4M 3F92A 3GLHB 1F40A 3KAGA 2G5GX 3AS1A 4L6V6 2MLXA 1LL7A 3LVVA 1WXQA 4Z2JA 3GPXA 1GL6A 2EA0A 4Z2HA 1G8PA 4CISA 2FH0A 1GL7A 5IREB 2JXNA 5L8RF 2DSVA 4M0WA 1YATA 4LAXA 5DIVA 1G3IA 2J7NA 2FNAA 2V1UA 5ITRA 5EP4A 3Q8GA 2H5XA 3E46A 1D2NA 4NSOB 2XSZD 1J4RA 1T6OA 2DT3A 4GC5A 1GKIA 4R7GA 2DAMA 1YW5A 1JR3E 2L7IA 3U6LA 2LVOC 2RRUA 3SFZA 1W26A 1GLNA 1N78A 1V92A 4LFAM 2RUQA 3QAUA 4RF1A 3GLGE 3SAUA 4Z2GA 3SHGB 1T43A 3OA5A 4DRKA 1W1PA 3AS0A 3HHWA 5HBFA 1HNWM 4NL4H 1ROUA 3LUOA 2EJSA 1W9VA 1PJSA 1IXRC 3J81S 3HU3A 2MPHA 5KPRA 1EE8A 4LJ8A 1UR8A 1HXVA 2Y78A 1W5TA 3Q8XA 3UK6A 2A3CA 1L1PA 3PR9A 1WGLA 4MAVA 3W0FA 3AQUA 4XBOA 4LF9M 1DO0A 4MH0E 3UF8A 2Z8YM 4FW9A 4IBDA 2ZQTA 3HHZA 1IBMM 2LTUA 3SARA 3EIPA 5FTKA 3WD4A 2D7GA 5LMUM 3VDUA 3KFUG 4GEWA 4JI2M 2ZR4A 4O2TA 2KI3A 2L6OA 4Q22A 4FCVA 4ODLA 4ML4A 1WGNA 2XP4A 3AFHA 4XAKA 1J7KA 2DAEA 3SHFA 3U5ZA 4G4OA 3FXYA 5IWAM 3AROA 2F5QA 4B08A 2Z7JA 3IG5A 3U6MA 4IQCA 8CATA 1RD6A 3SATA 3TWLA 4FWGA 2MH8A 1J09A 1GVNA 3RGPA 1QQWA 1TH4A 1NSFA 3HJQA 4NXMM 4UDMA 3GP1A 3KS4A 5EQTA 1Q6UA 4YY3M 5HW8A 2DNAA 1N32M 4IQ2A 2OLHA 3RM9A 1PBKA 3KABA 1QAMA 1XWIA 3I04M 2OOAA 3B9AA 3GRVA 4I81A 2F5OA 1HJWA 5BXJA 2OQ4A 4LZJA 2DPEA 4KO8A 5E26A 1GJTA 1IM2A 4GIPA 2F23A 3ZQJA 1LG2A 2QZ4A 2KO7A 2LWXA 1QYRA 3I6CA 3UQIA 2WLYA 4RKUF 1ITXA 3I51A 4URIA 2ZR6A 2E5LM 4B3RM 2B31A 5HW7A 1FKHA 1XMQM 4ANRA 1YUBA 1WJ7A 2DHYA 2G41A 2QSFX 3MJ5A 2K9DA 1XRVA 3FYCA 2Z3XA 3I4VA 3RFWA 4Y28F 3UZUA 3CHEA 4J4OA 1DGHB 3J2PB 2XGNA 2MLZA 2XP8A 4GH9A 3WD3A 1TDHA 3HX3A 2KA6B 2ZTDA 2C9CA 3KADA 3WD0A 3GLIB 4WIWA 1Q1CA 2C99A 1OFIA 3O5EA 1R5LA 3A98B 1E44A 2FKEA 5DIUA 2PN0A 4QOZC 3MMPA 1W1VA 2ZQVA 2A3BA 4X64M 2AOSA 4QIBA 3NWLA 2Z4RA 3A46A 4DV3M 3MK6A 3UI4A 4IJEA 3AOEC 4KT0F 2ZR5A 4TYOA 2D9FA 4DV0M 1IXSA 4F1IA 3PNVA 3RGSA 1PINA 4GHAA 4DRJA 5EP2A 2WM0A 3O5JA 1E32A 4Z2IA 3TPZA 1N75A 3FUXA 3KAIA 4OW0A 3DOAA 4GHLA 1MX0A 1VQ1A 1NV9A 4JYSA 3LCVB 1WAWA 4ZPTR 4NZCA 2KE0A 4HLQA 4CHTB 3UGJA 2FS1A 3GLIE 1EDQA 2DWZB 4IBEA 2YNMD 4NNRA 3HU1A 2ITKA 3NI6A 4U86A 2VF7A 5DITA 3VK7A 2XZFA 2DSZA 3LCUA 5KQDA 2DZOB 4JFKA 4U85A 1RU3A 2MGWA 4AY1A 2IUZA 5EP1A 3M0EA 4G3OA 4II7A 4LJ6A 3L26A 4DV7M 1NY5A 2I7PA 1N34M 1K3XA 2WK2A 4DV1M 5KPTA 1JVWA 1QPFA 1UR9A 3GQ4A 1A5TA 1QZ2A 1JCHB 4MGIE 4BBAA 4QOSA 4TUWA 3E21A 2C5RA 4PD2A 3WD1A 4JFMA 1ZL1A 4R3DA 1X6LA 1GRJA 4DUZM 1KT0A 1TGUA 4AQYM 4DWSA 2ESCA 4ODQA 3KP0E 2MNTA 3CF6E 3K8ZA 1KFVA 4FAPA 4DWSC 1DGBA 2LNHC 2KR7A 3VKGA 2YBTA 2R44A 4M0DA 3AOGA 1OIPA 3IKGA 3U6PA 3ARUA 4TX0A 3H4MA 4Z2LA 2DZLA 3FUVA 4OU7A 4DR7M 1IN8A 2XF3A 3C3EA 1OIZA 3W0LB 4KQZA 3RGCA 1SXJE 2DG3A 1TH2A 2RURA 5GPGA 1OTRA 1BKFA 1XXHB 5EXPA 2WZJA 2DAIA 4JN6A 4DR6M 3B7XA 2QNJA 5HW6A 1TFVA 2HAKA 1NHGC 4HBEA 4QNMA 4ODRA 3CTWB 2Z4SA 2OOBA 1KFWA 1L2DA 4LJ5A 4LJ4A 2QCUA 5JI3E 3T6PA 2VIIA 1ZAEA 3GLFA 1ROTA 2A3EA 4FWHA 3ARZA 1R2ZA 1ZV1A 4GKJM 3A45A 3HGIA 2QQ8A 3TL4X 4AG6A 2LBCA 4DRIA 4G4RA 2R4EA 1G59A 2UXBM 3R8FA 4G6ZA 3R9XB 1NMWA 1VG5A 1JNTA 1R7RA 3PNYA 2ETNA 3ARSA 4DZ3A 3KP1E 1ZBWA 1OJLA 2O92A 2PPPA 2BWBA 2CWBA 4MGVA 2UUAM 1XMOM 1LG1A 1NNJA 5D75A 2G8ZA 3GRRA 4LRTA 4DT4A 1NY6A 4IBKA 4DV6M 4NRVA 1B6CA 3O5DA 2LVPC 1J5EM 2XP7A 3L29A 2V1CA 2CHQA 2XFTA 2F2DA 4ODKA 1TH3A 2PPNA 1HKIA 5I98A 2R45A 3SC3A 4HBOA 2XEPA 4M9XA 4DIPA 2R62A 1SXJB 1GABA 4NOOB 2MR9A 2ZAOA 4NSRA 4OX9M 3OTOM 2L2SA 4DH0A 3JYMA 5DFLA 3RM8A 3AL0C 5HKGA 1PJQA 3B9EA 1F4IA 1JNSA 2M08A 2DG9A 4IT4A 2JY5A 3U60A 3PA7A 2VF8A 2Y21A 4WK9A 3ARVA 3SYKA 3ARRA 3ARTA 1NHWC 4JYAM 3H4JA 2Y0QA 1IY0A 3B7ZA 3B74A 1UFZA 2LHGA 4AW4A 1J4HA 4MNJA 4Z2KA 2OO9A 4AZFA 2DSWA 3JYJA 2LPVA 2Q2EB 3M6AA 1QVRA 1LTMA 3FTEA 1P5QA 2VCDA 2ZBKB 3QYBA 3SMPA 1N33M 4IBGA 1GJSA 2VQFM 4DV2M 3WQWA 4S3KA 3UJNA 1EHNA 3O5PA 2UXCM 3AOEA 4DR2M 4DV4M 5FLXS 4JI1M 4FCTA 3HJ8A 4HL4A 2KZUA 3FUUA 1XHBA 4JI0M 2CE7A 4R5EA 1D7IA 2QP9X 3U5ZB 3KOYE 3AV0A 2B3TA 2XP3A 3CHDA 5GKNA 2QHOB 1Z5AA 2W82A 3FD9A 3LMMA 1VDDA 5ITQA 4QHTA 1ZBVA 2L09A 2EUCA 1F8AB 2F5NA 2FDMA 4MNKA 3VDPA 1R9HA 4DRNA 1HQCA 3BBZA 4RNAA 3ARYA 2AHMA 2HL7A 2XP5A 2DT1A 3B9PA 2R46A 4ODMA 4A3VB 4NC6A 4DV5M 1IY2A 2M60A 3T1HM 3ALGA 1FKLA 1G41A 2KDLA 3FE3A 3FRIA 3O5IA 4MGHA 4ODNA 1FKTA 2YFQA 4LF7M 2RGHA 2F5PA 3CH9A 4MGZE 4DR3M 1Z5CA 1ZB5A 1PJIA 4CIZA 5J6EA 1H0GA 4B7GA 4L15A 4KODA 4ITQA 2RUDA 4TW6A 1QPLA 4JI5M 4QNRA 3HKPA 1SXJD 1W1YA 3LQRA 2YQZA 2A3AA 1G4AE 4DRPA 3NRKA 2X8AA 4GIVA 1H6UA 3KOWE 3KW6A 1D7HA 2OFNA 4WKAA 1CUKA 3PFIA 2CEAA 2O5RA 1HT1E 2RSEA 4JFJA 4GMQA 1QDRA 4WP2A 1IN4A 2JZVA 4KHPM 2EO2A 1ZMVA 2LGOA 1HQYE 3T1YM 1FFRA 4ZS6A 1OAOC 2KRKA 3HZJA 3BMBA 3TWKA 1FKBA 3HWSA 1FFQA 5ITYA 3WL0A 1O6IA 2DHRA 3LVWA 3GLIA 1NJGA 2L4FA 2J5YA 2CHVA 1VEGA 4DRQA 1L1TA 2M1IA 4RF0A 4B7HA 2XP9A 1BVSA 1DGHA 1Y0OA 4PDIA 3RE8A 2L7HA 2F4VM 4NXNM 3KSJA 4NRWA 2F5SA 5GPRA 3IK8A 2CUZA 3PRBA 1TF0B 4BLCA 3CHFA 1FKSA 4LZZA 4WJXA 1D0KA 1HT2E 4Q7NA 5FTMA 3DZDA 4FD2A 4P8VA 3O5LA 1WR1B 1ZBKA 2DG4A 4REZA 4LGMA 1J6YA 3J27B 1JNDA 4QZVB 1K3WA 3CZ8A 3AS3A 1Q3BA 4ODPA 3K9OA 1GUVA 3WH0A 2X49A 1SXJA 1FJDA 1R2YA 4CGYB 5F3WA 1OKSA 1JQJC 3NBIA 1E6ZA 4W5UA 4XK8F 3RMEA 3WIJA 3PRDA 3HY5A 5FTJA 1TDZA 4L4UA 3KS8A 4YHHM 2DENA 1WHCA 1OGGA 3PXGA 1FD9A 2UUBM 4M9SA 3DFZA 1Q6IA 1FNNA 1WNOA 1XXHA 2QBYA 3ZCBB 4LAYA 1ZU8A 2DT2A 2KXEA 1HNXM 3AS2A 4WKHA 1PM5A 1IQPA 4KLNA 1DGFA 2MLYA 4WURA 1KYIA 3RM4A 3WD2A 5DF0A 4IBBA 1QZEA 3FUWA 3M7GA 3TQSA 1MN3A 1T3TA 3EY6A 1T11A 5ITUA 4LAWA 5EJCA 4LF8M 2LXEA 1C7YA 5B8IC 3E9SA 3O5OA 2K8IA 2WSEF 3KOXE 4G4NA 3FAPA 2XP6A 2FE8A 1U79A 3EIHA 1BL4A 3SMSA 2R0IA 4ITZA 3IG8A 3FY1A 3TCZA 5HUAA 3KVWA 1PJJA 2VQEM 4FN2A 4K0KM 5EXXA 4ZPVR 3UQAA 1V34A 3JXVA 4TW8A 3CF0A 1LQ0A 1JR3D 1D6OA 1DO2A 2GNOA 3FTCA 3KAFA 2K6BA 3G6LA 4AKIA 5HWBA 1V33A 2QF8A 2CV1A 4DZ2A 3CF2A 5JH8A 3KACA 2QPAA 4DROA 4DWSD 3UMMA 4AKHA 1VEJA 2VDBB 1YLAA 4XGIA 2R65A 1AUAA 3QOKA 2NQ8C 3K1JA 3GLGB 4GITA 3ARQA 3TWMA 3V76A 3WHLA 2J7OA 5EXSA 1IXSB 2XH9A 3C9PA 3HHXA 2RUCA 3VKHA 4OVZB 5ITXA 3ZC7B 4L16A 1L2BA 5ITXE 2IF4A 1GOIA 4MSPA 1QAOA 4G4QA 3U6SA 2R6FA 2CP8A 4FVMA 4JFLA 2R18A 1LL4A 3GLHA 4AG5A 2R4JA 1NWUA 2YBUA 2JY6B 3BOSA 4JI3M 1FKIA 1R6BX 1Y8GA 2F21A 3K92A 1N36M 4MNMA 5KQ8A 3GRUA 3U60B 3GU0A 2H1RA 3GLHE 1P3QQ 2BNKA 4WKFA 1IXZA 1IN5A 3D8LA 2ZQUA 1FAPA 1EQ3A 1W9UA 3W67A 2LHCA 3C58A 5JI2E 1GO5A 4WW0A 2CRUA 1D2KA 1TTEA 5E6JA 4G2PA 2APLA 1NWRA 4CJ6A 3O5FA 4W9QA 5HTGA 1N1AA 1SG9A 1HKKA 5FTNA 4DR4M 3SASA 1W9PA 3VK8A 4IBCA 1Q39A 3T15A 3CHCA 3CGNA 3UI6A 2EULA 2KW0A 2ERCA 2L2DA 1NNUC 4P8XA 2KHHA 3L28A 2G8LA 3IECA 3U6OA 4JI6M 2UXDM 1VDLA 2DVWB 4W9OA 2CFOA 3EIEA 2ZM6M 4TNSA 4X62M 2DT0A 3U61A 1KT1A 2LVNC 4M9ZA 1NWTA 1ZBCA 3O5RA 1ZCNA 1D7JA 3L25A 4P8WA 3U6QA 5HWCA 3QWLA 1A7XA 1DV0A 1MJGM 5KPZA 4LY6A 4MTVA 4DWSB 2WSCF 2FOIC 1HJXA 3THGA 4PTMA 3AJIB 4G50A 4DR1M 1VEKA 2WSFF 4IBFA 1QZMA 3GLFE 2XLJA 1C9HA 3OOBA 3GPYA 3A42A 3KDSE 4L8RC 1K82A 3UQBA 3IHZA 2M5ZA 4R0XA 1NH6A 1HKJA 1OWQA 2KEBA 4MM3B 1SR0A 4B3MM 2LJ4A 4TW7A 3SYLA 1FKKA 4OVZA 1E6PA 3B9DA 4LGXA 1E9RA 1VF8A 5ITTA 1SXJC 1CTNA 1X37A 3K9PA 1D0MA 1OFHA 4AKGA 4P8UA 3FYDA 3W68A 2G3QA 5IZ7D 1FKGA 3ILKA 1EIJA 2JZ1A 1NSGA 4QT3A 4JV5M 4B3TM 4IBJA 1EFUB 3AKZA 4LAVA 4DBGB 3G6MA 1FKFA 4LJAA 2K0BX 3ALFA 4PT5A 2KNZA 3WQVA 1NMVA 4I5SA 2CHGA 1HNZM 2HCBA 2GQFA
chains in the Genus database with same CATH topology
1SXJA 4QNMA 3O5QA 4ODRA 4M0WA 3CTWB 1FJDA 1R2YA 1YATA 2Z4SA 4LAXA 5DIVA 1H0IA 1G3IA 4CGYB 2J7NA 5F3WA 2FNAA 1M5YA 2V1UA 1KFWA 3TDBA 5ITRA 1JQJC 5EP4A 1LJYA 3NBIA 1L2DA 4LJ5A 4LJ4A 1E6ZA 4W5UA 1D2NA 4NSOB 3ARXA 3RMEA 3WIJA 1Q6HA 2XSZD 3PRDA 2QCUA 3GRYA 5JI3E 1J4RA 2DT3A 4GC5A 1GKIA 4R7GA 5FTJA 3D8BA 1TDZA 1IY1A 2VIIA 4L4UA 1ZAEA 3KS8A 1X6NA 3KAHA 3GLFA 1ROTA 1YW5A 2A3EA 4I8OA 4FWHA 2L7IA 3T38A 3U6LA 4YHHM 4IIWA 3FTDA 2KFWA 4PDGA 4JXJA 3ARZA 3MHVC 4D81A 3SFZA 2FFJA 1W26A 1R2ZA 1GLNA 4GKJM 1N78A 1FKRA 1OGGA 1DGGA 2MF9A 3LQQA 3A45A 3HGIA 4LFAM 3PXGA 1FD9A 2RUQA 4ZPXA 2HKJA 3QAUA 2UUBM 3TL4X 4RF1A 1N77A 4AG6A 4M9SA 3CGMA 4BF8A 3SAUA 4Z2GA 3SHGB 3OA5A 1YSYA 3DFZA 1FKJA 1FNNA 1Q6IA 1W1PA 3WKZA 1WNOA 4DRIA 4DRKA 4G4RA 1XXHA 2R4EA 3AS0A 1G59A 2QBYA 3HHWA 2UXBM 3R8FA 4G6ZA 1HNWM 3R9XB 4ODKA 5HBFA 4NL4H 1ROUA 1NMWA 3ZCBB 3LUOA 4U85A 5J6EA 1W9VA 1JNTA 4LAYA 1ZU8A 2DT2A 1R7RA 1IXRC 2KXEA 3PNYA 3J81S 3RGCA 3HU3A 3W4RA 4IBIA 1HNXM 2MPHA 3AS2A 5KPRA 1EE8A 3ARSA 4WKHA 4LJ8A 2X4AA 1UR8A 1XNRM 1W5TA 1PM5A 2Y78A 4DZ3A 1HXVA 3Q8XA 1Z5BA 3UK6A 2A3CA 1IQPA 2I7NA 3DA1A 3KP1E 3HHYA 1ZBWA 1L1PA 1OJLA 3PR9A 4KLNA 2O92A 2PPPA 4MAVA 3W0FA 2PPOA 3AQUA 1DGFA 4XBOA 4LF9M 1DO0A 2MLYA 4GC9A 4WURA 4IPXA 4MGVA 1KYIA 4QT2A 3RM4A 4MH0E 3UF8A 5DYGA 2WLZA 3WD2A 3WHKA 4FW9A 4IBDA 2UUAM 1XMOM 1LG1A 5DF0A 4IBBA 3FUWA 3M7GA 1NNJA 3TQSA 3HHZA 1IBMM 3SARA 1J4IA 2ZQTA 5D75A 5FTKA 2G8ZA 3WD4A 1T3TA 2D7GA 3GRRA 4DUYM 4LRTA 1T11A 3EY6A 1NY6A 5ITUA 5LMUM 4DT4A 4LAWA 4Z8XA 5EJCA 4IBKA 3VDUA 4LF8M 3KFUG 4EIWA 4DV6M 4JI2M 4NRVA 1HKMA 2ZR4A 2KI3A 4O2TA 3SAVA 2LXEA 2L6OA 4L78A 4FCVA 1B6CA 4Q22A 5B8IC 3E9SA 4ODLA 4ODOA 3O5DA 4DRHA 4ML4A 4HARA 3VFDA 3O5OA 2K8IA 4C02B 2XP4A 2DSUA 3KOXE 1J5EM 3AFHA 4AI6A 4G4NA 1J7KA 3MDYB 4XAKA 3SHFA 3U5ZA 4G4OA 3L29A 2V1CA 4LJ9A 4LG2A 2XP6A 1IBLM 2XP7A 2CHQA 2XFTA 3FXYA 2FE8A 2F2DA 3JAMS 5IWAM 1U79A 2P5TA 2F5QA 1XNQM 3AROA 1TH3A 3EIHA 4B08A 2PPNA 1HKIA 2Z7JA 3IG5A 1BL4A 5I98A 2R45A 3U6MA 2DWNA 8CATA 4IQCA 3SC3A 1RD6A 3SATA 4HBOA 2XEPA 4M9XA 3TWLA 2OPFA 4FWGA 4DIPA 4JI8M 4P16A 3SMSA 2R62A 3ODKA 1J09A 3ARWA 3GPUA 4ITZA 1GVNA 3RGPA 2VN1A 4LF6M 1SXJB 1EYMA 2M2AA 4JFIA 3IG8A 4GRIA 3FY1A 1QQWA 1TH4A 4NOOB 1HR0M 3TCZA 4S12A 1NSFA 3HJQA 4NXMM 5HUAA 2ZAOA 4NSRA 3KSXA 4OX9M 1UR9A 3KVWA 1PJJA 4WKAA 3GP1A 3OTOM 2VQEM 2L2SA 3JYMA 4FN2A 3KS4A 4DH0A 3E4RA 3RM8A 3AL0C 5HKGA 5EQTA 4K0KM 5EXXA 4X65M 2K47A 1Q6UA 4YY3M 3B9EA 3KCEA 4ZPVR 5HW8A 3UQAA 1SYTA 4FWDA 3JXVA 1JNSA 2M08A 2KZSA 2RKOA 4N19A 4TW8A 1N32M 4IQ2A 2OLHA 2DG9A 2A5YB 4IT4A 1L8QA 1W5SA 2YR0A 3CF0A 1LQ0A 3KZ7A 1JR3D 3RM9A 4MGKE 1D6OA 1DO2A 1PBKA 3U60A 7CATA 3KABA 5BPVA 3PA7A 2JA2A 1QAMA 1WB0A 1XWIA 3FTCA 2Y21A 3GRVA 3B9AA 4WK9A 4I81A 2F5OA 3KAFA 1C1KA 1HJWA 3ARVA 4AKIA 1EIBA 3G6LA 5BXJA 3SYKA 2FAPA 5HWBA 3ARRA 2OQ4A 3ARTA 1NHWC 4JYAM 2Y0QA 1JR3A 2QF8A 2XPBA 4LZJA 2DPEA 1JNEA 2CV1A 3FAPA 4DZ2A 1IY0A 3CF2A 5JH8A 4U84A 3KACA 4KO8A 3FUTA 1IN6A 2QPAA 2HHHM 1E9SA 5E26A 2QBYB 4DROA 4MNLA 1IM2A 3HJSA 4GIPA 2XZUA 4DWSD 4AW4A 1LG2A 2QZ4A 5C18A 3UMMA 1J4HA 2KO7A 4MNJA 4LFCM 4AKHA 4Z2KA 2LWXA 4AZFA 2ZANA 1QYRA 2DSWA 3I6CA 2RGOA 3JYJA 3UQIA 2WLYA 2LPVA 4XGIA 2R65A 1LL6A 2Q2EB 1ITXA 3M6AA 3IKDA 2ZAMA 3QOKA 3I51A 2NQ8C 1TCOC 2PV1A 4URIA 1QVRA 3K1JA 1FJGM 3FTEA 1P5QA 3GLGB 2VCDA 4LF5M 2ZBKB 3SMPA 5A2QS 2ZR6A 4GITA 3ARQA 3TWMA 2E5LM 4S3JA 1N33M 4B3RM 4IBGA 2VQFM 4DV2M 3WQWA 4L72B 2B31A 4S3KA 3FKEA 3WHLA 1FKHA 1NJFA 5HW7A 1XMQM 2J7OA 3HU2A 5DEZA 5EXSA 1IXSB 1YUBA 2XH9A 3U6DA 3UJNA 3HHXA 1EHNA 2RUCA 2KRUA 3O5PA 2D7HA 2G41A 2UXCM 3AOEA 2AWGA 2LH0A 1OGBA 4DR2M 4DV4M 3MJ5A 4IJFA 5FLXS 3VKHA 4OVZB 1XRVA 3FYCA 2Z3XA 4JI1M 3I4VA 3RFWA 2V6ZM 5ITXA 3ZC7B 3UZUA 4L16A 4FCTA 1L2BA 3CHEA 3HJ8A 4J4OA 2BJVA 1DGHB 3J2PB 2XGNA 2MLZA 4HL4A 5ITXE 2KZUA 3FUUA 2IF4A 1XHBA 5EP3A 4JI0M 2CE7A 1GOIA 2XP8A 4R5EA 4MSPA 4GH9A 2DWMA 3WD3A 1D7IA 2LKNA 4LCBA 1TDHA 1QAOA 2QP9X 3U5ZB 4G4QA 3KOYE 3AV0A 4Z6YA 2XP3A 3CHDA 2KA6B 4MNMA 3U6SA 2C9CA 3KADA 3WD0A 3PVSA 4FVMA 5GKNA 3GLIB 1Z5AA 2W82A 3FD9A 2R18A 5C1BA 2Q5AA 3LMMA 4JFLA 4WIWA 1VDDA 1LL4A 1Q1CA 1IX5A 2C99A 5ITQA 1K9TA 1OFIA 4QHTA 1LV7A 1ZBVA 3O5EA 2L09A 3GLHA 2EUCA 2R4JA 3A98B 4AG5A 2F5NA 3FTFA 1F8AB 1NWUA 1ZK6A 2FDMA 2FKEA 2YBUA 4QOZC 5DIUA 1W1VA 3BOSA 2ZQVA 2CV2A 3VDPA 4X64M 3JR5A 2A3BA 2AOSA 4MNKA 3NWLA 4JI3M 1FKIA 4QIBA 1R9HA 1R6BX 2Z4RA 4DRNA 3J80S 1HQCA 3A46A 4DV3M 3K92A 2F21A 3MK6A 1N36M 2F4EA 4RNAA 3ARYA 3UI4A 5KQ8A 4FCWA 3O5MA 2AHMA 3GRUA 2HL7A 4IJEA 3U60B 3J7BA 2H1RA 3AOEC 2XP5A 4D80A 2DT1A 3B9PA 2ZR5A 2R46A 4ODMA 4A3VB 2BNKA 4TYOA 1MU5A 1ORYB 4WKFA 4DV5M 3I4YA 1E9LA 1IXZA 2D9FA 4DV0M 1IY2A 1IN5A 2C98A 3D8LA 2D7EA 3PNVA 2M60A 3SAWA 3T1HM 1FAPA 2ZQUA 3GLFB 1HJVA 3ALGA 1FKLA 1EQ3A 1G41A 1W9UA 3RGSA 1PINA 4GHAA 2C9OA 3U61B 2PBCA 4NSBA 3C58A 1UM8A 4DRJA 3GQ5A 5EP2A 2WM0A 5JI2E 3O5JA 3GO8A 4IT6A 1E32A 4X66M 3O5IA 3TPZA 1I94M 4Z2IA 1N75A 2UZ5A 3FUXA 4MGHA 3WL1A 4WW0A 3KAIA 2KGJA 4B7FA 3H9RB 4ODNA 1D2KA 1H0GA 1Z59A 5E6JA 4G2PA 4AY1A 4OW0A 1FKTA 3DOAA 2O9OA 2YFQA 4GHLA 4LF7M 1NWRA 1MX0A 2RGHA 2F5PA 3O5FA 4W9QA 3CH9A 4DRMA 5HTGA 4JYSA 4MGZE 3UI5A 1N1AA 4DR3M 1WAWA 3ZH9B 1Z5CA 5BR8M 1ZB5A 3NTPA 1HKKA 4ZPTR 4GGQA 4NZCA 2KE0A 5FTNA 1PJIA 4DR4M 3SASA 2XSZA 1IBKM 1W9PA 4HLQA 4CHTB 4B7GA 4IBCA 3UGJA 1Q39A 3VK8A 4L15A 4KODA 2DWZB 3T15A 4ITQA 1EDQA 3CGNA 3CHCA 3UI6A 4KR0B 2KW0A 4LFBM 4IBEA 2YNMD 2RUDA 4TW6A 4ZPWR 1QPLA 4NNRA 5FSWA 3HU1A 2ERCA 3KXEC 4MB7A 4JI5M 1L1ZA 5DO2A 1NNUC 4QNRA 3HKPA 1E15A 1SXJD 4P8XA 1W1YA 2ITKA 3NI6A 4U86A 3LQRA 2XPAA 2YQZA 2A3AA 3K2LA 1G4AE 3L28A 4DRPA 5DITA 1S3SA 3VK7A 2G8LA 3U6OA 4JI6M 2UXDM 2XZFA 2DSZA 1L2CA 4QHSA 2DVWB 3NRKA 2X8AA 5KQDA 3J7AS 4GIVA 3ARPA 4LGYA 2DZOB 4W9OA 4JFKA 1H6UA 3KOWE 2CFOA 3EIEA 3KW6A 1D7HA 1KSFX 1FKDA 2OFNA 2IUZA 2ZM6M 3PFIA 1YE9A 2CEAA 2O5RA 1HT1E 5EP1A 4TNSA 3M0EA 2RSEA 4I4LA 4II7A 4LJ6A 5DYIA 3L26A 4DR5M 4JFJA 4X62M 2DT0A 4DV7M 1NY5A 2I7PA 3U61A 5IT9S 4LJ7A 1KT1A 4J4NA 4GMQA 1N34M 4M9ZA 1K3XA 1NWTA 1ZBCA 3L27A 2WK2A 3O5RA 1IN4A 3U6EA 2Y0TA 1ZCNA 2JZVA 4DV1M 1D7JA 3L25A 4P8WA 4KHPM 5H37D 2EO2A 1NVMA 1W1TA 3U6QA 5KPTA 2XFSA 2DSVA 1ZQ9A 5HWCA 3QWLA 1JVWA 1A7XA 4GKKM 3GQ4A 1QPFA 3L2AA 5KPZA 2DXIA 4LY6A 5FTLA 4JI4M 1GPFA 1QZ2A 2LGOA 1HQYE 2BJWA 3GPPA 3B8SA 4MGIE 4BBAA 2DZNB 4QOSA 4MTVA 3T1YM 2C5RA 4TUWA 2PV3A 4PD2A 4DWSB 2QENA 1FFRA 1NWSA 3KOZE 5DNYA 4ZS6A 2FOIC 1HJXA 3VAWA 2KRKA 3WD1A 1I4WA 3THGA 4PTMA 3AJIB 1Z6TA 3JR4A 4DR1M 2UU9M 3TWKA 3BXWA 4G50A 4IBFA 1FKBA 1QZMA 3HWSA 3GPKA 2XLJA 5EXTA 1C9HA 3OOBA 1FFQA 2CV0A 4R3DA 1X6LA 4JI7M 5ITYA 1ZL1A 4JFMA 1O6IA 4DUZM 2DHRA 3LVWA 3GLIA 1KT0A 3WL0A 2C96A 3GPYA 3A42A 1TGUA 4L3NA 4AQYM 1Q3CA 3KDSE 3TE6A 2PV2A 1NJGA 5HT1A 4L8RC 1K82A 4DWSA 3IHZA 3UQBA 2ESCA 1E6NA 4ODQA 2CHVA 2M5ZA 3U6CA 4B3SM 4R0XA 3KP0E 4DRQA 1L1TA 2M1IA 2MNTA 4RF0A 3CF6E 3K8ZA 1KFVA 4B7HA 4FAPA 4DWSC 3GQ3A 3GLGA 1DGBA 1HKJA 1NH6A 2XP9A 5KO3A 1DGHA 4MGYE 1OWQA 2KEBA 1Y0OA 4PDIA 3RE8A 4LRSA 2N87A 4MM3B 2L7HA 2LNHC 3VLFB 1SR0A 4B3MM 2RQSA 2KR7A 2LJ4A 3VKGA 2F4VM 4TW7A 3SYLA 1FKKA 4OVZA 3TC5A 1E6PA 2YBTA 4M0DA 4PCZA 3B9DA 3AOGA 4NXNM 4LGXA 1E9RA 3KSJA 1VF8A 5ITTA 4NRWA 3IKGA 3U6PA 4MPKA 1QAQA 1SXJC 1CTNA 1X37A 3ARUA 4TX0A 2UUCM 2Y20A 3H4MA 4Z2LA 3SBJA 3FUVA 1OFHA 2F5SA 5LMNM 4AKGA 3O5KA 4P8UA 1E94E 2ZQSA 1E6RA 5GPRA 3FYDA 2CUZA 3IK8A 4W9PA 4OU7A 1QANA 4DR7M 1IN7A 3PRBA 4BLCA 3CHFA 1FKSA 3PRAA 3O5GA 1IN8A 2XF3A 5IZ7D 4LZZA 1FKGA 4WJXA 1HT2E 3ILKA 1XC8A 2DWLA 4D82A 4Q7NA 4W5WA 2PI6A 1XHGA 5FTMA 3W0LB 1NSGA 4KQZA 5GQBA 3DZDA 4FD2A 4BB9A 4LF4M 4P8VA 3O5LA 4QT3A 3GLHB 1ZBKA 1F40A 4JV5M 2DG4A 1SXJE 4B3TM 2DG3A 3KAGA 1TH2A 2G5GX 4IBJA 4REZA 3AKZA 2RURA 4LGMA 3AS1A 3J27B 1JNDA 4LAVA 3G6MA 1J6YA 2MLXA 4QZVB 1FKFA 1K3WA 4LJAA 3CZ8A 3ALFA 3AS3A 1LL7A 5GPGA 4PT5A 3LVVA 1Q3BA 4ODPA 3WQVA 1WXQA 4Z2JA 1BKFA 3GPXA 1GL6A 2EA0A 1XXHB 1GUVA 1NMVA 4Z2HA 5EXPA 1G8PA 4I5SA 4JN6A 4CISA 4DR6M 3B7XA 5HW6A 1GL7A 5IREB 1HNZM 1TFVA 2HCBA 3WH0A 1NHGC 4HBEA 2X49A 2CHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJD A;  4ODR A;  1ZCN A;  1YAT A;  2JZV A;  3ODK A;  1D7J A;  4ITZ A;  4JFL A;  4LAX A;  2Q5A A;  5DIV A;  2VN1 A;  1Q1C A;  1M5Y A;  1EYM A;  2M2A A;  4JFI A;  3TDB A;  5HWC A;  1JVW A;  3TCZ A;  1A7X A;  1QPF A;  2LGO A;  3O5E A;  1F8A B;  1QZ2 A;  1ZK6 A;  5HUA A;  2FKE A;  1Q6H A;  3PRD A;  5DIU A;  1J4R A;  2ZQV A;  2L2S A;  4FN2 A;  3JYM A;  4QIB A;  4DH0 A;  1FKI A;  1R9H A;  2PV3 A;  3KAH A;  4DRN A;  5HKG A;  1Q6U A;  1ROT A;  1YW5 A;  2F21 A;  3KCE A;  5HW8 A;  3UQA A;  3UI4 A;  2F4E A;  3JXV A;  3VAW A;  1JNS A;  2M08 A;  4N19 A;  2KFW A;  3O5M A;  4TW8 A;  4IQ2 A;  2DG9 A;  4G50 A;  2XP5 A;  1W26 A;  1FKB A;  2ZR5 A;  3KZ7 A;  4ODM A;  4C02 B;  4TYO A;  1FKR A;  3GPK A;  1D6O A;  1C9H A;  2D9F A;  2MF9 A;  1PBK A;  3OOB A;  4JFM A;  3KAB A;  1FD9 A;  2RUQ A;  3PA7 A;  1KT0 A;  4BF8 A;  3CGM A;  2ZQU A;  1FAP A;  3KAF A;  1EQ3 A;  1FKL A;  5HT1 A;  3UQB A;  5HWB A;  5BXJ A;  1Q6I A;  1FKJ A;  3IHZ A;  2FAP A;  4DRI A;  4DRK A;  1PIN A;  4ODQ A;  4R0X A;  2PBC A;  4DRQ A;  2XPB A;  4DRJ A;  2M1I A;  2MNT A;  3O5J A;  4DZ2 A;  4FAP A;  3O5I A;  4U84 A;  3KAC A;  2XP9 A;  2UZ5 A;  1ROU A;  1Y0O A;  3KAI A;  1NMW A;  2KGJ A;  2N87 A;  3H9R B;  3LUO A;  4ODN A;  2RQS A;  1JNT A;  2KR7 A;  4DRO A;  2LJ4 A;  4G2P A;  4LAY A;  4TW7 A;  1FKK A;  1FKT A;  1J4H A;  3TC5 A;  2KO7 A;  2MPH A;  3O5F A;  4W9Q A;  3JYJ A;  3I6C A;  4DZ3 A;  2Y78 A;  3UQI A;  4DRM A;  5HTG A;  3IKG A;  1HXV A;  2LPV A;  4JYS A;  3UI5 A;  1N1A A;  3IKD A;  1L1P A;  4TX0 A;  2PV1 A;  1TCO C;  3NTP A;  4GGQ A;  2KE0 A;  2PPP A;  2PPO A;  1P5Q A;  4IPX A;  4QT2 A;  2MLY A;  4MGV A;  5J6E A;  2VCD A;  3O5K A;  2ZR6 A;  3CGN A;  3UF8 A;  3UI6 A;  2ZQS A;  2RUD A;  3IK8 A;  4W9P A;  4TW6 A;  3PRB A;  1QPL A;  4NNR A;  1FKS A;  3O5G A;  1FKG A;  2ZQT A;  1J4I A;  5HW7 A;  1FKH A;  5D75 A;  2ITK A;  3NI6 A;  4U86 A;  3EY6 A;  1T11 A;  4DT4 A;  2XPA A;  1NSG A;  3RGC A;  4LAW A;  4QT3 A;  2RUC A;  3O5P A;  3O5L A;  1F40 A;  4DRP A;  5DIT A;  2ZR4 A;  2AWG A;  2KI3 A;  4O2T A;  2DG4 A;  1B6C A;  5B8I C;  2DG3 A;  3KAG A;  4ODL A;  3O5D A;  4ODO A;  2RUR A;  4DRH A;  3NRK A;  4LAV A;  1J6Y A;  4GIV A;  3RFW A;  4W9O A;  2MLX A;  3O5O A;  2K8I A;  1D7H A;  1FKD A;  2OFN A;  1FKF A;  2PV2 A;  2XP4 A;  4JFK A;  4U85 A;  4J4O A;  4TNS A;  2MLZ A;  3MDY B;  5GPG A;  2IF4 A;  2RSE A;  2XP7 A;  3FAP A;  3O5Q A;  2XP6 A;  4JFJ A;  4ODP A;  1BKF A;  2XP8 A;  2F2D A;  1NMV A;  4MSP A;  4ODK A;  1U79 A;  1D7I A;  2LKN A;  2PPN A;  1BL4 A;  5I98 A;  1KT1 A;  3B7X A;  4J4N A;  5HW6 A;  4IQC A;  2XP3 A;  3WH0 A;  4DIP A;  3KAD A;  3O5R A; 
#chains in the Genus database with same CATH topology
 1H0I A;  1M5Y A;  3IHP A;  3TDB A;  2DKL A;  2MRO B;  1LJY A;  3QYE A;  3ARX A;  4F2L A;  1Q6H A;  3GRY A;  1X6N A;  3D8B A;  3KAH A;  1IY1 A;  1TR8 A;  4I8O A;  2KNV A;  3T38 A;  1OQY A;  4IIW A;  3FTD A;  2KFW A;  4PDG A;  4JXJ A;  3MHV C;  4D81 A;  2FFJ A;  2DAK A;  1FKR A;  3B7N A;  1NO1 A;  1DGG A;  2MF9 A;  3LQQ A;  4ZPX A;  2HKJ A;  1N77 A;  4BF8 A;  3CGM A;  1HJP A;  1WIV A;  1YSY A;  1FKJ A;  2JNH A;  3WKZ A;  3CGW A;  3W4R A;  1QUS A;  4IBI A;  2X4A A;  1XNR M;  1Z5B A;  2I7N A;  3DA1 A;  3HHY A;  2PPO A;  4IPX A;  4QT2 A;  4GC9 A;  2O01 F;  5DYG A;  2WLZ A;  3WHK A;  1D0L A;  1J4I A;  4DUY M;  4Z8X A;  4EIW A;  1HKM A;  3SAV A;  4L78 A;  4ODO A;  4DRH A;  4HAR A;  3VFD A;  4C02 B;  1JB0 F;  2LVA A;  2DSU A;  3NBX X;  4AI6 A;  3MDY B;  4LG2 A;  3O5Q A;  4LJ9 A;  1IBL M;  3JAM S;  4S3J A;  2P5T A;  1XNQ M;  2DWN A;  2OPF A;  4JI8 M;  4P16 A;  3ODK A;  3ARW A;  3GPU A;  3I01 M;  2VN1 A;  4LF6 M;  1EYM A;  2M2A A;  4JFI A;  4GRI A;  4HEO A;  1HR0 M;  4S12 A;  3KSX A;  3E4R A;  4X65 M;  2K47 A;  2DI0 A;  3KCE A;  2JWS A;  1SYT A;  4FWD A;  2KZS A;  2RKO A;  4N19 A;  1XXH E;  2A5Y B;  1L8Q A;  1QDT A;  1W5S A;  2YR0 A;  3KZ7 A;  4MGK E;  1XB2 B;  7CAT A;  5BPV A;  1G71 A;  2JA2 A;  1WB0 A;  1C1K A;  1EIB A;  2FAP A;  1JR3 A;  2XPB A;  1JNE A;  4U84 A;  3GTY X;  3FUT A;  1IN6 A;  2HHH M;  1E9S A;  2QBY B;  3HJS A;  2XZU A;  1R4G A;  5C18 A;  4LFC M;  2ZAN A;  2RGO A;  1LL6 A;  3IKD A;  2ZAM A;  2PV1 A;  1TCO C;  1FJG M;  4LF5 M;  5A2Q S;  4L72 B;  3FKE A;  1NJF A;  5DEZ A;  3HU2 A;  3U6D A;  2KRU A;  2D7H A;  2AWG A;  2LH0 A;  1OGB A;  4IJF A;  2V6Z M;  2BJV A;  5EP3 A;  2DWM A;  2LKN A;  4LCB A;  2JP7 A;  4Z6Y A;  3PVS A;  2KNA A;  5C1B A;  2Q5A A;  1IX5 A;  1K9T A;  1PRB A;  1NV8 A;  1LV7 A;  3FTF A;  1ZK6 A;  2CV2 A;  3JR5 A;  1PJT A;  3J80 S;  3B7Q A;  2F4E A;  3O5M A;  4FCW A;  3J7B A;  4D80 A;  1MU5 A;  1ORY B;  3I4Y A;  1E9L A;  2C98 A;  2D7E A;  3SAW A;  3GLF B;  1HJV A;  2C9O A;  3U61 B;  2PBC A;  4NSB A;  1UM8 A;  3GQ5 A;  3GO8 A;  4IT6 A;  4X66 M;  1I94 M;  2UZ5 A;  3WL1 A;  2KGJ A;  4B7F A;  3H9R B;  1Z59 A;  2O9O A;  2JY8 A;  4DRM A;  4Q7J A;  3UI5 A;  2BWE A;  3ZH9 B;  2O25 A;  5BR8 M;  3NTP A;  2B5U B;  4GGQ A;  2XSZ A;  1IBK M;  4KR0 B;  4R71 A;  4LFB M;  4ZPW R;  1PGY A;  5FSW A;  3KXE C;  4MB7 A;  1ZMU A;  1L1Z A;  5DO2 A;  1E15 A;  2MJ5 B;  2XPA A;  3K2L A;  1S3S A;  1L2C A;  4QHS A;  1IFY A;  3J7A S;  3ARP A;  4LGY A;  4L3N A;  2PV2 A;  1FKD A;  1KSF X;  1YE9 A;  4I4L A;  5DYI A;  4DR5 M;  1QUT A;  2L4E A;  5IT9 S;  4LJ7 A;  4J4N A;  3L27 A;  3U6E A;  2Y0T A;  5H37 D;  1NVM A;  2JY7 A;  1W1T A;  2XFS A;  1ZQ9 A;  2DAG A;  4GKK M;  3L2A A;  2N35 A;  2DXI A;  4JI4 M;  5FTL A;  1GPF A;  2BJW A;  3GPP A;  3B8S A;  1OAI A;  2DZN B;  2PV3 A;  3C3D A;  2QEN A;  1NWS A;  3KOZ E;  5DNY A;  2EKK A;  3B89 A;  3LW5 F;  3VAW A;  1I4W A;  1Q02 A;  3JR4 A;  1Z6T A;  2UU9 M;  3BXW A;  3GPK A;  5EXT A;  4MNL A;  2CV0 A;  4JI7 M;  2C96 A;  1Q3C A;  3TE6 A;  5HT1 A;  4UN2 B;  1E6N A;  4B3S M;  3U6C A;  2HWJ A;  1AIP C;  3GQ3 A;  3GLG A;  5KO3 A;  4P17 A;  4MGY E;  4LRS A;  2N87 A;  3VLF B;  2RQS A;  3TC5 A;  4PCZ A;  1ZMW A;  2EKF A;  4MPK A;  1QAQ A;  2LVQ D;  2UUC M;  2Y20 A;  2P4V A;  3SBJ A;  5LMN M;  3O5K A;  1E94 E;  2ZQS A;  1E6R A;  2JUJ A;  4W9P A;  1QAN A;  1IN7 A;  3PRA A;  3O5G A;  1XC8 A;  2JZ0 A;  4D82 A;  2DWL A;  4W5W A;  3FRH A;  2PI6 A;  1XHG A;  5GQB A;  4BB9 A;  2ZTC A;  4LF4 M;  3F92 A;  3GLH B;  1F40 A;  3KAG A;  2G5G X;  3AS1 A;  4L6V 6;  2MLX A;  1LL7 A;  3LVV A;  1WXQ A;  4Z2J A;  3GPX A;  1GL6 A;  2EA0 A;  4Z2H A;  1G8P A;  4CIS A;  2FH0 A;  1GL7 A;  5IRE B;  2JXN A;  5L8R F;  2DSV A;  4M0W A;  1YAT A;  4LAX A;  5DIV A;  1G3I A;  2J7N A;  2FNA A;  2V1U A;  5ITR A;  5EP4 A;  3Q8G A;  2H5X A;  3E46 A;  1D2N A;  4NSO B;  2XSZ D;  1J4R A;  1T6O A;  2DT3 A;  4GC5 A;  1GKI A;  4R7G A;  2DAM A;  1YW5 A;  1JR3 E;  2L7I A;  3U6L A;  2LVO C;  2RRU A;  3SFZ A;  1W26 A;  1GLN A;  1N78 A;  1V92 A;  4LFA M;  2RUQ A;  3QAU A;  4RF1 A;  3GLG E;  3SAU A;  4Z2G A;  3SHG B;  1T43 A;  3OA5 A;  4DRK A;  1W1P A;  3AS0 A;  3HHW A;  5HBF A;  1HNW M;  4NL4 H;  1ROU A;  3LUO A;  2EJS A;  1W9V A;  1PJS A;  1IXR C;  3J81 S;  3HU3 A;  2MPH A;  5KPR A;  1EE8 A;  4LJ8 A;  1UR8 A;  1HXV A;  2Y78 A;  1W5T A;  3Q8X A;  3UK6 A;  2A3C A;  1L1P A;  3PR9 A;  1WGL A;  4MAV A;  3W0F A;  3AQU A;  4XBO A;  4LF9 M;  1DO0 A;  4MH0 E;  3UF8 A;  2Z8Y M;  4FW9 A;  4IBD A;  2ZQT A;  3HHZ A;  1IBM M;  2LTU A;  3SAR A;  3EIP A;  5FTK A;  3WD4 A;  2D7G A;  5LMU M;  3VDU A;  3KFU G;  4GEW A;  4JI2 M;  2ZR4 A;  4O2T A;  2KI3 A;  2L6O A;  4Q22 A;  4FCV A;  4ODL A;  4ML4 A;  1WGN A;  2XP4 A;  3AFH A;  4XAK A;  1J7K A;  2DAE A;  3SHF A;  3U5Z A;  4G4O A;  3FXY A;  5IWA M;  3ARO A;  2F5Q A;  4B08 A;  2Z7J A;  3IG5 A;  3U6M A;  4IQC A;  8CAT A;  1RD6 A;  3SAT A;  3TWL A;  4FWG A;  2MH8 A;  1J09 A;  1GVN A;  3RGP A;  1QQW A;  1TH4 A;  1NSF A;  3HJQ A;  4NXM M;  4UDM A;  3GP1 A;  3KS4 A;  5EQT A;  1Q6U A;  4YY3 M;  5HW8 A;  2DNA A;  1N32 M;  4IQ2 A;  2OLH A;  3RM9 A;  1PBK A;  3KAB A;  1QAM A;  1XWI A;  3I04 M;  2OOA A;  3B9A A;  3GRV A;  4I81 A;  2F5O A;  1HJW A;  5BXJ A;  2OQ4 A;  4LZJ A;  2DPE A;  4KO8 A;  5E26 A;  1GJT A;  1IM2 A;  4GIP A;  2F23 A;  3ZQJ A;  1LG2 A;  2QZ4 A;  2KO7 A;  2LWX A;  1QYR A;  3I6C A;  3UQI A;  2WLY A;  4RKU F;  1ITX A;  3I51 A;  4URI A;  2ZR6 A;  2E5L M;  4B3R M;  2B31 A;  5HW7 A;  1FKH A;  1XMQ M;  4ANR A;  1YUB A;  1WJ7 A;  2DHY A;  2G41 A;  2QSF X;  3MJ5 A;  2K9D A;  1XRV A;  3FYC A;  2Z3X A;  3I4V A;  3RFW A;  4Y28 F;  3UZU A;  3CHE A;  4J4O A;  1DGH B;  3J2P B;  2XGN A;  2MLZ A;  2XP8 A;  4GH9 A;  3WD3 A;  1TDH A;  3HX3 A;  2KA6 B;  2ZTD A;  2C9C A;  3KAD A;  3WD0 A;  3GLI B;  4WIW A;  1Q1C A;  2C99 A;  1OFI A;  3O5E A;  1R5L A;  3A98 B;  1E44 A;  2FKE A;  5DIU A;  2PN0 A;  4QOZ C;  3MMP A;  1W1V A;  2ZQV A;  2A3B A;  4X64 M;  2AOS A;  4QIB A;  3NWL A;  2Z4R A;  3A46 A;  4DV3 M;  3MK6 A;  3UI4 A;  4IJE A;  3AOE C;  4KT0 F;  2ZR5 A;  4TYO A;  2D9F A;  4DV0 M;  1IXS A;  4F1I A;  3PNV A;  3RGS A;  1PIN A;  4GHA A;  4DRJ A;  5EP2 A;  2WM0 A;  3O5J A;  1E32 A;  4Z2I A;  3TPZ A;  1N75 A;  3FUX A;  3KAI A;  4OW0 A;  3DOA A;  4GHL A;  1MX0 A;  1VQ1 A;  1NV9 A;  4JYS A;  3LCV B;  1WAW A;  4ZPT R;  4NZC A;  2KE0 A;  4HLQ A;  4CHT B;  3UGJ A;  2FS1 A;  3GLI E;  1EDQ A;  2DWZ B;  4IBE A;  2YNM D;  4NNR A;  3HU1 A;  2ITK A;  3NI6 A;  4U86 A;  2VF7 A;  5DIT A;  3VK7 A;  2XZF A;  2DSZ A;  3LCU A;  5KQD A;  2DZO B;  4JFK A;  4U85 A;  1RU3 A;  2MGW A;  4AY1 A;  2IUZ A;  5EP1 A;  3M0E A;  4G3O A;  4II7 A;  4LJ6 A;  3L26 A;  4DV7 M;  1NY5 A;  2I7P A;  1N34 M;  1K3X A;  2WK2 A;  4DV1 M;  5KPT A;  1JVW A;  1QPF A;  1UR9 A;  3GQ4 A;  1A5T A;  1QZ2 A;  1JCH B;  4MGI E;  4BBA A;  4QOS A;  4TUW A;  3E21 A;  2C5R A;  4PD2 A;  3WD1 A;  4JFM A;  1ZL1 A;  4R3D A;  1X6L A;  1GRJ A;  4DUZ M;  1KT0 A;  1TGU A;  4AQY M;  4DWS A;  2ESC A;  4ODQ A;  3KP0 E;  2MNT A;  3CF6 E;  3K8Z A;  1KFV A;  4FAP A;  4DWS C;  1DGB A;  2LNH C;  2KR7 A;  3VKG A;  2YBT A;  2R44 A;  4M0D A;  3AOG A;  1OIP A;  3IKG A;  3U6P A;  3ARU A;  4TX0 A;  3H4M A;  4Z2L A;  2DZL A;  3FUV A;  4OU7 A;  4DR7 M;  1IN8 A;  2XF3 A;  3C3E A;  1OIZ A;  3W0L B;  4KQZ A;  3RGC A;  1SXJ E;  2DG3 A;  1TH2 A;  2RUR A;  5GPG A;  1OTR A;  1BKF A;  1XXH B;  5EXP A;  2WZJ A;  2DAI A;  4JN6 A;  4DR6 M;  3B7X A;  2QNJ A;  5HW6 A;  1TFV A;  2HAK A;  1NHG C;  4HBE A;  4QNM A;  4ODR A;  3CTW B;  2Z4S A;  2OOB A;  1KFW A;  1L2D A;  4LJ5 A;  4LJ4 A;  2QCU A;  5JI3 E;  3T6P A;  2VII A;  1ZAE A;  3GLF A;  1ROT A;  2A3E A;  4FWH A;  3ARZ A;  1R2Z A;  1ZV1 A;  4GKJ M;  3A45 A;  3HGI A;  2QQ8 A;  3TL4 X;  4AG6 A;  2LBC A;  4DRI A;  4G4R A;  2R4E A;  1G59 A;  2UXB M;  3R8F A;  4G6Z A;  3R9X B;  1NMW A;  1VG5 A;  1JNT A;  1R7R A;  3PNY A;  2ETN A;  3ARS A;  4DZ3 A;  3KP1 E;  1ZBW A;  1OJL A;  2O92 A;  2PPP A;  2BWB A;  2CWB A;  4MGV A;  2UUA M;  1XMO M;  1LG1 A;  1NNJ A;  5D75 A;  2G8Z A;  3GRR A;  4LRT A;  4DT4 A;  1NY6 A;  4IBK A;  4DV6 M;  4NRV A;  1B6C A;  3O5D A;  2LVP C;  1J5E M;  2XP7 A;  3L29 A;  2V1C A;  2CHQ A;  2XFT A;  2F2D A;  4ODK A;  1TH3 A;  2PPN A;  1HKI A;  5I98 A;  2R45 A;  3SC3 A;  4HBO A;  2XEP A;  4M9X A;  4DIP A;  2R62 A;  1SXJ B;  1GAB A;  4NOO B;  2MR9 A;  2ZAO A;  4NSR A;  4OX9 M;  3OTO M;  2L2S A;  4DH0 A;  3JYM A;  5DFL A;  3RM8 A;  3AL0 C;  5HKG A;  1PJQ A;  3B9E A;  1F4I A;  1JNS A;  2M08 A;  2DG9 A;  4IT4 A;  2JY5 A;  3U60 A;  3PA7 A;  2VF8 A;  2Y21 A;  4WK9 A;  3ARV A;  3SYK A;  3ARR A;  3ART A;  1NHW C;  4JYA M;  3H4J A;  2Y0Q A;  1IY0 A;  3B7Z A;  3B74 A;  1UFZ A;  2LHG A;  4AW4 A;  1J4H A;  4MNJ A;  4Z2K A;  2OO9 A;  4AZF A;  2DSW A;  3JYJ A;  2LPV A;  2Q2E B;  3M6A A;  1QVR A;  1LTM A;  3FTE A;  1P5Q A;  2VCD A;  2ZBK B;  3QYB A;  3SMP A;  1N33 M;  4IBG A;  1GJS A;  2VQF M;  4DV2 M;  3WQW A;  4S3K A;  3UJN A;  1EHN A;  3O5P A;  2UXC M;  3AOE A;  4DR2 M;  4DV4 M;  5FLX S;  4JI1 M;  4FCT A;  3HJ8 A;  4HL4 A;  2KZU A;  3FUU A;  1XHB A;  4JI0 M;  2CE7 A;  4R5E A;  1D7I A;  2QP9 X;  3U5Z B;  3KOY E;  3AV0 A;  2B3T A;  2XP3 A;  3CHD A;  5GKN A;  2QHO B;  1Z5A A;  2W82 A;  3FD9 A;  3LMM A;  1VDD A;  5ITQ A;  4QHT A;  1ZBV A;  2L09 A;  2EUC A;  1F8A B;  2F5N A;  2FDM A;  4MNK A;  3VDP A;  1R9H A;  4DRN A;  1HQC A;  3BBZ A;  4RNA A;  3ARY A;  2AHM A;  2HL7 A;  2XP5 A;  2DT1 A;  3B9P A;  2R46 A;  4ODM A;  4A3V B;  4NC6 A;  4DV5 M;  1IY2 A;  2M60 A;  3T1H M;  3ALG A;  1FKL A;  1G41 A;  2KDL A;  3FE3 A;  3FRI A;  3O5I A;  4MGH A;  4ODN A;  1FKT A;  2YFQ A;  4LF7 M;  2RGH A;  2F5P A;  3CH9 A;  4MGZ E;  4DR3 M;  1Z5C A;  1ZB5 A;  1PJI A;  4CIZ A;  5J6E A;  1H0G A;  4B7G A;  4L15 A;  4KOD A;  4ITQ A;  2RUD A;  4TW6 A;  1QPL A;  4JI5 M;  4QNR A;  3HKP A;  1SXJ D;  1W1Y A;  3LQR A;  2YQZ A;  2A3A A;  1G4A E;  4DRP A;  3NRK A;  2X8A A;  4GIV A;  1H6U A;  3KOW E;  3KW6 A;  1D7H A;  2OFN A;  4WKA A;  1CUK A;  3PFI A;  2CEA A;  2O5R A;  1HT1 E;  2RSE A;  4JFJ A;  4GMQ A;  1QDR A;  4WP2 A;  1IN4 A;  2JZV A;  4KHP M;  2EO2 A;  1ZMV A;  2LGO A;  1HQY E;  3T1Y M;  1FFR A;  4ZS6 A;  1OAO C;  2KRK A;  3HZJ A;  3BMB A;  3TWK A;  1FKB A;  3HWS A;  1FFQ A;  5ITY A;  3WL0 A;  1O6I A;  2DHR A;  3LVW A;  3GLI A;  1NJG A;  2L4F A;  2J5Y A;  2CHV A;  1VEG A;  4DRQ A;  1L1T A;  2M1I A;  4RF0 A;  4B7H A;  2XP9 A;  1BVS A;  1DGH A;  1Y0O A;  4PDI A;  3RE8 A;  2L7H A;  2F4V M;  4NXN M;  3KSJ A;  4NRW A;  2F5S A;  5GPR A;  3IK8 A;  2CUZ A;  3PRB A;  1TF0 B;  4BLC A;  3CHF A;  1FKS A;  4LZZ A;  4WJX A;  1D0K A;  1HT2 E;  4Q7N A;  5FTM A;  3DZD A;  4FD2 A;  4P8V A;  3O5L A;  1WR1 B;  1ZBK A;  2DG4 A;  4REZ A;  4LGM A;  1J6Y A;  3J27 B;  1JND A;  4QZV B;  1K3W A;  3CZ8 A;  3AS3 A;  1Q3B A;  4ODP A;  3K9O A;  1GUV A;  3WH0 A;  2X49 A;  1SXJ A;  1FJD A;  1R2Y A;  4CGY B;  5F3W A;  1OKS A;  1JQJ C;  3NBI A;  1E6Z A;  4W5U A;  4XK8 F;  3RME A;  3WIJ A;  3PRD A;  3HY5 A;  5FTJ A;  1TDZ A;  4L4U A;  3KS8 A;  4YHH M;  2DEN A;  1WHC A;  1OGG A;  3PXG A;  1FD9 A;  2UUB M;  4M9S A;  3DFZ A;  1Q6I A;  1FNN A;  1WNO A;  1XXH A;  2QBY A;  3ZCB B;  4LAY A;  1ZU8 A;  2DT2 A;  2KXE A;  1HNX M;  3AS2 A;  4WKH A;  1PM5 A;  1IQP A;  4KLN A;  1DGF A;  2MLY A;  4WUR A;  1KYI A;  3RM4 A;  3WD2 A;  5DF0 A;  4IBB A;  1QZE A;  3FUW A;  3M7G A;  3TQS A;  1MN3 A;  1T3T A;  3EY6 A;  1T11 A;  5ITU A;  4LAW A;  5EJC A;  4LF8 M;  2LXE A;  1C7Y A;  5B8I C;  3E9S A;  3O5O A;  2K8I A;  2WSE F;  3KOX E;  4G4N A;  3FAP A;  2XP6 A;  2FE8 A;  1U79 A;  3EIH A;  1BL4 A;  3SMS A;  2R0I A;  4ITZ A;  3IG8 A;  3FY1 A;  3TCZ A;  5HUA A;  3KVW A;  1PJJ A;  2VQE M;  4FN2 A;  4K0K M;  5EXX A;  4ZPV R;  3UQA A;  1V34 A;  3JXV A;  4TW8 A;  3CF0 A;  1LQ0 A;  1JR3 D;  1D6O A;  1DO2 A;  2GNO A;  3FTC A;  3KAF A;  2K6B A;  3G6L A;  4AKI A;  5HWB A;  1V33 A;  2QF8 A;  2CV1 A;  4DZ2 A;  3CF2 A;  5JH8 A;  3KAC A;  2QPA A;  4DRO A;  4DWS D;  3UMM A;  4AKH A;  1VEJ A;  2VDB B;  1YLA A;  4XGI A;  2R65 A;  1AUA A;  3QOK A;  2NQ8 C;  3K1J A;  3GLG B;  4GIT A;  3ARQ A;  3TWM A;  3V76 A;  3WHL A;  2J7O A;  5EXS A;  1IXS B;  2XH9 A;  3C9P A;  3HHX A;  2RUC A;  3VKH A;  4OVZ B;  5ITX A;  3ZC7 B;  4L16 A;  1L2B A;  5ITX E;  2IF4 A;  1GOI A;  4MSP A;  1QAO A;  4G4Q A;  3U6S A;  2R6F A;  2CP8 A;  4FVM A;  4JFL A;  2R18 A;  1LL4 A;  3GLH A;  4AG5 A;  2R4J A;  1NWU A;  2YBU A;  2JY6 B;  3BOS A;  4JI3 M;  1FKI A;  1R6B X;  1Y8G A;  2F21 A;  3K92 A;  1N36 M;  4MNM A;  5KQ8 A;  3GRU A;  3U60 B;  3GU0 A;  2H1R A;  3GLH E;  1P3Q Q;  2BNK A;  4WKF A;  1IXZ A;  1IN5 A;  3D8L A;  2ZQU A;  1FAP A;  1EQ3 A;  1W9U A;  3W67 A;  2LHC A;  3C58 A;  5JI2 E;  1GO5 A;  4WW0 A;  2CRU A;  1D2K A;  1TTE A;  5E6J A;  4G2P A;  2APL A;  1NWR A;  4CJ6 A;  3O5F A;  4W9Q A;  5HTG A;  1N1A A;  1SG9 A;  1HKK A;  5FTN A;  4DR4 M;  3SAS A;  1W9P A;  3VK8 A;  4IBC A;  1Q39 A;  3T15 A;  3CHC A;  3CGN A;  3UI6 A;  2EUL A;  2KW0 A;  2ERC A;  2L2D A;  1NNU C;  4P8X A;  2KHH A;  3L28 A;  2G8L A;  3IEC A;  3U6O A;  4JI6 M;  2UXD M;  1VDL A;  2DVW B;  4W9O A;  2CFO A;  3EIE A;  2ZM6 M;  4TNS A;  4X62 M;  2DT0 A;  3U61 A;  1KT1 A;  2LVN C;  4M9Z A;  1NWT A;  1ZBC A;  3O5R A;  1ZCN A;  1D7J A;  3L25 A;  4P8W A;  3U6Q A;  5HWC A;  3QWL A;  1A7X A;  1DV0 A;  1MJG M;  5KPZ A;  4LY6 A;  4MTV A;  4DWS B;  2WSC F;  2FOI C;  1HJX A;  3THG A;  4PTM A;  3AJI B;  4G50 A;  4DR1 M;  1VEK A;  2WSF F;  4IBF A;  1QZM A;  3GLF E;  2XLJ A;  1C9H A;  3OOB A;  3GPY A;  3A42 A;  3KDS E;  4L8R C;  1K82 A;  3UQB A;  3IHZ A;  2M5Z A;  4R0X A;  1NH6 A;  1HKJ A;  1OWQ A;  2KEB A;  4MM3 B;  1SR0 A;  4B3M M;  2LJ4 A;  4TW7 A;  3SYL A;  1FKK A;  4OVZ A;  1E6P A;  3B9D A;  4LGX A;  1E9R A;  1VF8 A;  5ITT A;  1SXJ C;  1CTN A;  1X37 A;  3K9P A;  1D0M A;  1OFH A;  4AKG A;  4P8U A;  3FYD A;  3W68 A;  2G3Q A;  5IZ7 D;  1FKG A;  3ILK A;  1EIJ A;  2JZ1 A;  1NSG A;  4QT3 A;  4JV5 M;  4B3T M;  4IBJ A;  1EFU B;  3AKZ A;  4LAV A;  4DBG B;  3G6M A;  1FKF A;  4LJA A;  2K0B X;  3ALF A;  4PT5 A;  2KNZ A;  3WQV A;  1NMV A;  4I5S A;  2CHG A;  1HNZ M;  2HCB A;  2GQF A; 
#chains in the Genus database with same CATH homology
 1SXJ A;  4QNM A;  3O5Q A;  4ODR A;  4M0W A;  3CTW B;  1FJD A;  1R2Y A;  1YAT A;  2Z4S A;  4LAX A;  5DIV A;  1H0I A;  1G3I A;  4CGY B;  2J7N A;  5F3W A;  2FNA A;  1M5Y A;  2V1U A;  1KFW A;  3TDB A;  5ITR A;  1JQJ C;  5EP4 A;  1LJY A;  3NBI A;  1L2D A;  4LJ5 A;  4LJ4 A;  1E6Z A;  4W5U A;  1D2N A;  4NSO B;  3ARX A;  3RME A;  3WIJ A;  1Q6H A;  2XSZ D;  3PRD A;  2QCU A;  3GRY A;  5JI3 E;  1J4R A;  2DT3 A;  4GC5 A;  1GKI A;  4R7G A;  5FTJ A;  3D8B A;  1TDZ A;  1IY1 A;  2VII A;  4L4U A;  1ZAE A;  3KS8 A;  1X6N A;  3KAH A;  3GLF A;  1ROT A;  1YW5 A;  2A3E A;  4I8O A;  4FWH A;  2L7I A;  3T38 A;  3U6L A;  4YHH M;  4IIW A;  3FTD A;  2KFW A;  4PDG A;  4JXJ A;  3ARZ A;  3MHV C;  4D81 A;  3SFZ A;  2FFJ A;  1W26 A;  1R2Z A;  1GLN A;  4GKJ M;  1N78 A;  1FKR A;  1OGG A;  1DGG A;  2MF9 A;  3LQQ A;  3A45 A;  3HGI A;  4LFA M;  3PXG A;  1FD9 A;  2RUQ A;  4ZPX A;  2HKJ A;  3QAU A;  2UUB M;  3TL4 X;  4RF1 A;  1N77 A;  4AG6 A;  4M9S A;  3CGM A;  4BF8 A;  3SAU A;  4Z2G A;  3SHG B;  3OA5 A;  1YSY A;  3DFZ A;  1FKJ A;  1FNN A;  1Q6I A;  1W1P A;  3WKZ A;  1WNO A;  4DRI A;  4DRK A;  4G4R A;  1XXH A;  2R4E A;  3AS0 A;  1G59 A;  2QBY A;  3HHW A;  2UXB M;  3R8F A;  4G6Z A;  1HNW M;  3R9X B;  4ODK A;  5HBF A;  4NL4 H;  1ROU A;  1NMW A;  3ZCB B;  3LUO A;  4U85 A;  5J6E A;  1W9V A;  1JNT A;  4LAY A;  1ZU8 A;  2DT2 A;  1R7R A;  1IXR C;  2KXE A;  3PNY A;  3J81 S;  3RGC A;  3HU3 A;  3W4R A;  4IBI A;  1HNX M;  2MPH A;  3AS2 A;  5KPR A;  1EE8 A;  3ARS A;  4WKH A;  4LJ8 A;  2X4A A;  1UR8 A;  1XNR M;  1W5T A;  1PM5 A;  2Y78 A;  4DZ3 A;  1HXV A;  3Q8X A;  1Z5B A;  3UK6 A;  2A3C A;  1IQP A;  2I7N A;  3DA1 A;  3KP1 E;  3HHY A;  1ZBW A;  1L1P A;  1OJL A;  3PR9 A;  4KLN A;  2O92 A;  2PPP A;  4MAV A;  3W0F A;  2PPO A;  3AQU A;  1DGF A;  4XBO A;  4LF9 M;  1DO0 A;  2MLY A;  4GC9 A;  4WUR A;  4IPX A;  4MGV A;  1KYI A;  4QT2 A;  3RM4 A;  4MH0 E;  3UF8 A;  5DYG A;  2WLZ A;  3WD2 A;  3WHK A;  4FW9 A;  4IBD A;  2UUA M;  1XMO M;  1LG1 A;  5DF0 A;  4IBB A;  3FUW A;  3M7G A;  1NNJ A;  3TQS A;  3HHZ A;  1IBM M;  3SAR A;  1J4I A;  2ZQT A;  5D75 A;  5FTK A;  2G8Z A;  3WD4 A;  1T3T A;  2D7G A;  3GRR A;  4DUY M;  4LRT A;  1T11 A;  3EY6 A;  1NY6 A;  5ITU A;  5LMU M;  4DT4 A;  4LAW A;  4Z8X A;  5EJC A;  4IBK A;  3VDU A;  4LF8 M;  3KFU G;  4EIW A;  4DV6 M;  4JI2 M;  4NRV A;  1HKM A;  2ZR4 A;  2KI3 A;  4O2T A;  3SAV A;  2LXE A;  2L6O A;  4L78 A;  4FCV A;  1B6C A;  4Q22 A;  5B8I C;  3E9S A;  4ODL A;  4ODO A;  3O5D A;  4DRH A;  4ML4 A;  4HAR A;  3VFD A;  3O5O A;  2K8I A;  4C02 B;  2XP4 A;  2DSU A;  3KOX E;  1J5E M;  3AFH A;  4AI6 A;  4G4N A;  1J7K A;  3MDY B;  4XAK A;  3SHF A;  3U5Z A;  4G4O A;  3L29 A;  2V1C A;  4LJ9 A;  4LG2 A;  2XP6 A;  1IBL M;  2XP7 A;  2CHQ A;  2XFT A;  3FXY A;  2FE8 A;  2F2D A;  3JAM S;  5IWA M;  1U79 A;  2P5T A;  2F5Q A;  1XNQ M;  3ARO A;  1TH3 A;  3EIH A;  4B08 A;  2PPN A;  1HKI A;  2Z7J A;  3IG5 A;  1BL4 A;  5I98 A;  2R45 A;  3U6M A;  2DWN A;  8CAT A;  4IQC A;  3SC3 A;  1RD6 A;  3SAT A;  4HBO A;  2XEP A;  4M9X A;  3TWL A;  2OPF A;  4FWG A;  4DIP A;  4JI8 M;  4P16 A;  3SMS A;  2R62 A;  3ODK A;  1J09 A;  3ARW A;  3GPU A;  4ITZ A;  1GVN A;  3RGP A;  2VN1 A;  4LF6 M;  1SXJ B;  1EYM A;  2M2A A;  4JFI A;  3IG8 A;  4GRI A;  3FY1 A;  1QQW A;  1TH4 A;  4NOO B;  1HR0 M;  3TCZ A;  4S12 A;  1NSF A;  3HJQ A;  4NXM M;  5HUA A;  2ZAO A;  4NSR A;  3KSX A;  4OX9 M;  1UR9 A;  3KVW A;  1PJJ A;  4WKA A;  3GP1 A;  3OTO M;  2VQE M;  2L2S A;  3JYM A;  4FN2 A;  3KS4 A;  4DH0 A;  3E4R A;  3RM8 A;  3AL0 C;  5HKG A;  5EQT A;  4K0K M;  5EXX A;  4X65 M;  2K47 A;  1Q6U A;  4YY3 M;  3B9E A;  3KCE A;  4ZPV R;  5HW8 A;  3UQA A;  1SYT A;  4FWD A;  3JXV A;  1JNS A;  2M08 A;  2KZS A;  2RKO A;  4N19 A;  4TW8 A;  1N32 M;  4IQ2 A;  2OLH A;  2DG9 A;  2A5Y B;  4IT4 A;  1L8Q A;  1W5S A;  2YR0 A;  3CF0 A;  1LQ0 A;  3KZ7 A;  1JR3 D;  3RM9 A;  4MGK E;  1D6O A;  1DO2 A;  1PBK A;  3U60 A;  7CAT A;  3KAB A;  5BPV A;  3PA7 A;  2JA2 A;  1QAM A;  1WB0 A;  1XWI A;  3FTC A;  2Y21 A;  3GRV A;  3B9A A;  4WK9 A;  4I81 A;  2F5O A;  3KAF A;  1C1K A;  1HJW A;  3ARV A;  4AKI A;  1EIB A;  3G6L A;  5BXJ A;  3SYK A;  2FAP A;  5HWB A;  3ARR A;  2OQ4 A;  3ART A;  1NHW C;  4JYA M;  2Y0Q A;  1JR3 A;  2QF8 A;  2XPB A;  4LZJ A;  2DPE A;  1JNE A;  2CV1 A;  3FAP A;  4DZ2 A;  1IY0 A;  3CF2 A;  5JH8 A;  4U84 A;  3KAC A;  4KO8 A;  3FUT A;  1IN6 A;  2QPA A;  2HHH M;  1E9S A;  5E26 A;  2QBY B;  4DRO A;  4MNL A;  1IM2 A;  3HJS A;  4GIP A;  2XZU A;  4DWS D;  4AW4 A;  1LG2 A;  2QZ4 A;  5C18 A;  3UMM A;  1J4H A;  2KO7 A;  4MNJ A;  4LFC M;  4AKH A;  4Z2K A;  2LWX A;  4AZF A;  2ZAN A;  1QYR A;  2DSW A;  3I6C A;  2RGO A;  3JYJ A;  3UQI A;  2WLY A;  2LPV A;  4XGI A;  2R65 A;  1LL6 A;  2Q2E B;  1ITX A;  3M6A A;  3IKD A;  2ZAM A;  3QOK A;  3I51 A;  2NQ8 C;  1TCO C;  2PV1 A;  4URI A;  1QVR A;  3K1J A;  1FJG M;  3FTE A;  1P5Q A;  3GLG B;  2VCD A;  4LF5 M;  2ZBK B;  3SMP A;  5A2Q S;  2ZR6 A;  4GIT A;  3ARQ A;  3TWM A;  2E5L M;  4S3J A;  1N33 M;  4B3R M;  4IBG A;  2VQF M;  4DV2 M;  3WQW A;  4L72 B;  2B31 A;  4S3K A;  3FKE A;  3WHL A;  1FKH A;  1NJF A;  5HW7 A;  1XMQ M;  2J7O A;  3HU2 A;  5DEZ A;  5EXS A;  1IXS B;  1YUB A;  2XH9 A;  3U6D A;  3UJN A;  3HHX A;  1EHN A;  2RUC A;  2KRU A;  3O5P A;  2D7H A;  2G41 A;  2UXC M;  3AOE A;  2AWG A;  2LH0 A;  1OGB A;  4DR2 M;  4DV4 M;  3MJ5 A;  4IJF A;  5FLX S;  3VKH A;  4OVZ B;  1XRV A;  3FYC A;  2Z3X A;  4JI1 M;  3I4V A;  3RFW A;  2V6Z M;  5ITX A;  3ZC7 B;  3UZU A;  4L16 A;  4FCT A;  1L2B A;  3CHE A;  3HJ8 A;  4J4O A;  2BJV A;  1DGH B;  3J2P B;  2XGN A;  2MLZ A;  4HL4 A;  5ITX E;  2KZU A;  3FUU A;  2IF4 A;  1XHB A;  5EP3 A;  4JI0 M;  2CE7 A;  1GOI A;  2XP8 A;  4R5E A;  4MSP A;  4GH9 A;  2DWM A;  3WD3 A;  1D7I A;  2LKN A;  4LCB A;  1TDH A;  1QAO A;  2QP9 X;  3U5Z B;  4G4Q A;  3KOY E;  3AV0 A;  4Z6Y A;  2XP3 A;  3CHD A;  2KA6 B;  4MNM A;  3U6S A;  2C9C A;  3KAD A;  3WD0 A;  3PVS A;  4FVM A;  5GKN A;  3GLI B;  1Z5A A;  2W82 A;  3FD9 A;  2R18 A;  5C1B A;  2Q5A A;  3LMM A;  4JFL A;  4WIW A;  1VDD A;  1LL4 A;  1Q1C A;  1IX5 A;  2C99 A;  5ITQ A;  1K9T A;  1OFI A;  4QHT A;  1LV7 A;  1ZBV A;  3O5E A;  2L09 A;  3GLH A;  2EUC A;  2R4J A;  3A98 B;  4AG5 A;  2F5N A;  3FTF A;  1F8A B;  1NWU A;  1ZK6 A;  2FDM A;  2FKE A;  2YBU A;  4QOZ C;  5DIU A;  1W1V A;  3BOS A;  2ZQV A;  2CV2 A;  3VDP A;  4X64 M;  3JR5 A;  2A3B A;  2AOS A;  4MNK A;  3NWL A;  4JI3 M;  1FKI A;  4QIB A;  1R9H A;  1R6B X;  2Z4R A;  4DRN A;  3J80 S;  1HQC A;  3A46 A;  4DV3 M;  3K92 A;  2F21 A;  3MK6 A;  1N36 M;  2F4E A;  4RNA A;  3ARY A;  3UI4 A;  5KQ8 A;  4FCW A;  3O5M A;  2AHM A;  3GRU A;  2HL7 A;  4IJE A;  3U60 B;  3J7B A;  2H1R A;  3AOE C;  2XP5 A;  4D80 A;  2DT1 A;  3B9P A;  2ZR5 A;  2R46 A;  4ODM A;  4A3V B;  2BNK A;  4TYO A;  1MU5 A;  1ORY B;  4WKF A;  4DV5 M;  3I4Y A;  1E9L A;  1IXZ A;  2D9F A;  4DV0 M;  1IY2 A;  1IN5 A;  2C98 A;  3D8L A;  2D7E A;  3PNV A;  2M60 A;  3SAW A;  3T1H M;  1FAP A;  2ZQU A;  3GLF B;  1HJV A;  3ALG A;  1FKL A;  1EQ3 A;  1G41 A;  1W9U A;  3RGS A;  1PIN A;  4GHA A;  2C9O A;  3U61 B;  2PBC A;  4NSB A;  3C58 A;  1UM8 A;  4DRJ A;  3GQ5 A;  5EP2 A;  2WM0 A;  5JI2 E;  3O5J A;  3GO8 A;  4IT6 A;  1E32 A;  4X66 M;  3O5I A;  3TPZ A;  1I94 M;  4Z2I A;  1N75 A;  2UZ5 A;  3FUX A;  4MGH A;  3WL1 A;  4WW0 A;  3KAI A;  2KGJ A;  4B7F A;  3H9R B;  4ODN A;  1D2K A;  1H0G A;  1Z59 A;  5E6J A;  4G2P A;  4AY1 A;  4OW0 A;  1FKT A;  3DOA A;  2O9O A;  2YFQ A;  4GHL A;  4LF7 M;  1NWR A;  1MX0 A;  2RGH A;  2F5P A;  3O5F A;  4W9Q A;  3CH9 A;  4DRM A;  5HTG A;  4JYS A;  4MGZ E;  3UI5 A;  1N1A A;  4DR3 M;  1WAW A;  3ZH9 B;  1Z5C A;  5BR8 M;  1ZB5 A;  3NTP A;  1HKK A;  4ZPT R;  4GGQ A;  4NZC A;  2KE0 A;  5FTN A;  1PJI A;  4DR4 M;  3SAS A;  2XSZ A;  1IBK M;  1W9P A;  4HLQ A;  4CHT B;  4B7G A;  4IBC A;  3UGJ A;  1Q39 A;  3VK8 A;  4L15 A;  4KOD A;  2DWZ B;  3T15 A;  4ITQ A;  1EDQ A;  3CGN A;  3CHC A;  3UI6 A;  4KR0 B;  2KW0 A;  4LFB M;  4IBE A;  2YNM D;  2RUD A;  4TW6 A;  4ZPW R;  1QPL A;  4NNR A;  5FSW A;  3HU1 A;  2ERC A;  3KXE C;  4MB7 A;  4JI5 M;  1L1Z A;  5DO2 A;  1NNU C;  4QNR A;  3HKP A;  1E15 A;  1SXJ D;  4P8X A;  1W1Y A;  2ITK A;  3NI6 A;  4U86 A;  3LQR A;  2XPA A;  2YQZ A;  2A3A A;  3K2L A;  1G4A E;  3L28 A;  4DRP A;  5DIT A;  1S3S A;  3VK7 A;  2G8L A;  3U6O A;  4JI6 M;  2UXD M;  2XZF A;  2DSZ A;  1L2C A;  4QHS A;  2DVW B;  3NRK A;  2X8A A;  5KQD A;  3J7A S;  4GIV A;  3ARP A;  4LGY A;  2DZO B;  4W9O A;  4JFK A;  1H6U A;  3KOW E;  2CFO A;  3EIE A;  3KW6 A;  1D7H A;  1KSF X;  1FKD A;  2OFN A;  2IUZ A;  2ZM6 M;  3PFI A;  1YE9 A;  2CEA A;  2O5R A;  1HT1 E;  5EP1 A;  4TNS A;  3M0E A;  2RSE A;  4I4L A;  4II7 A;  4LJ6 A;  5DYI A;  3L26 A;  4DR5 M;  4JFJ A;  4X62 M;  2DT0 A;  4DV7 M;  1NY5 A;  2I7P A;  3U61 A;  5IT9 S;  4LJ7 A;  1KT1 A;  4J4N A;  4GMQ A;  1N34 M;  4M9Z A;  1K3X A;  1NWT A;  1ZBC A;  3L27 A;  2WK2 A;  3O5R A;  1IN4 A;  3U6E A;  2Y0T A;  1ZCN A;  2JZV A;  4DV1 M;  1D7J A;  3L25 A;  4P8W A;  4KHP M;  5H37 D;  2EO2 A;  1NVM A;  1W1T A;  3U6Q A;  5KPT A;  2XFS A;  2DSV A;  1ZQ9 A;  5HWC A;  3QWL A;  1JVW A;  1A7X A;  4GKK M;  3GQ4 A;  1QPF A;  3L2A A;  5KPZ A;  2DXI A;  4LY6 A;  5FTL A;  4JI4 M;  1GPF A;  1QZ2 A;  2LGO A;  1HQY E;  2BJW A;  3GPP A;  3B8S A;  4MGI E;  4BBA A;  2DZN B;  4QOS A;  4MTV A;  3T1Y M;  2C5R A;  4TUW A;  2PV3 A;  4PD2 A;  4DWS B;  2QEN A;  1FFR A;  1NWS A;  3KOZ E;  5DNY A;  4ZS6 A;  2FOI C;  1HJX A;  3VAW A;  2KRK A;  3WD1 A;  1I4W A;  3THG A;  4PTM A;  3AJI B;  1Z6T A;  3JR4 A;  4DR1 M;  2UU9 M;  3TWK A;  3BXW A;  4G50 A;  4IBF A;  1FKB A;  1QZM A;  3HWS A;  3GPK A;  2XLJ A;  5EXT A;  1C9H A;  3OOB A;  1FFQ A;  2CV0 A;  4R3D A;  1X6L A;  4JI7 M;  5ITY A;  1ZL1 A;  4JFM A;  1O6I A;  4DUZ M;  2DHR A;  3LVW A;  3GLI A;  1KT0 A;  3WL0 A;  2C96 A;  3GPY A;  3A42 A;  1TGU A;  4L3N A;  4AQY M;  1Q3C A;  3KDS E;  3TE6 A;  2PV2 A;  1NJG A;  5HT1 A;  4L8R C;  1K82 A;  4DWS A;  3IHZ A;  3UQB A;  2ESC A;  1E6N A;  4ODQ A;  2CHV A;  2M5Z A;  3U6C A;  4B3S M;  4R0X A;  3KP0 E;  4DRQ A;  1L1T A;  2M1I A;  2MNT A;  4RF0 A;  3CF6 E;  3K8Z A;  1KFV A;  4B7H A;  4FAP A;  4DWS C;  3GQ3 A;  3GLG A;  1DGB A;  1HKJ A;  1NH6 A;  2XP9 A;  5KO3 A;  1DGH A;  4MGY E;  1OWQ A;  2KEB A;  1Y0O A;  4PDI A;  3RE8 A;  4LRS A;  2N87 A;  4MM3 B;  2L7H A;  2LNH C;  3VLF B;  1SR0 A;  4B3M M;  2RQS A;  2KR7 A;  2LJ4 A;  3VKG A;  2F4V M;  4TW7 A;  3SYL A;  1FKK A;  4OVZ A;  3TC5 A;  1E6P A;  2YBT A;  4M0D A;  4PCZ A;  3B9D A;  3AOG A;  4NXN M;  4LGX A;  1E9R A;  3KSJ A;  1VF8 A;  5ITT A;  4NRW A;  3IKG A;  3U6P A;  4MPK A;  1QAQ A;  1SXJ C;  1CTN A;  1X37 A;  3ARU A;  4TX0 A;  2UUC M;  2Y20 A;  3H4M A;  4Z2L A;  3SBJ A;  3FUV A;  1OFH A;  2F5S A;  5LMN M;  4AKG A;  3O5K A;  4P8U A;  1E94 E;  2ZQS A;  1E6R A;  5GPR A;  3FYD A;  2CUZ A;  3IK8 A;  4W9P A;  4OU7 A;  1QAN A;  4DR7 M;  1IN7 A;  3PRB A;  4BLC A;  3CHF A;  1FKS A;  3PRA A;  3O5G A;  1IN8 A;  2XF3 A;  5IZ7 D;  4LZZ A;  1FKG A;  4WJX A;  1HT2 E;  3ILK A;  1XC8 A;  2DWL A;  4D82 A;  4Q7N A;  4W5W A;  2PI6 A;  1XHG A;  5FTM A;  3W0L B;  1NSG A;  4KQZ A;  5GQB A;  3DZD A;  4FD2 A;  4BB9 A;  4LF4 M;  4P8V A;  3O5L A;  4QT3 A;  3GLH B;  1ZBK A;  1F40 A;  4JV5 M;  2DG4 A;  1SXJ E;  4B3T M;  2DG3 A;  3KAG A;  1TH2 A;  2G5G X;  4IBJ A;  4REZ A;  3AKZ A;  2RUR A;  4LGM A;  3AS1 A;  3J27 B;  1JND A;  4LAV A;  3G6M A;  1J6Y A;  2MLX A;  4QZV B;  1FKF A;  1K3W A;  4LJA A;  3CZ8 A;  3ALF A;  3AS3 A;  1LL7 A;  5GPG A;  4PT5 A;  3LVV A;  1Q3B A;  4ODP A;  3WQV A;  1WXQ A;  4Z2J A;  1BKF A;  3GPX A;  1GL6 A;  2EA0 A;  1XXH B;  1GUV A;  1NMV A;  4Z2H A;  5EXP A;  1G8P A;  4I5S A;  4JN6 A;  4CIS A;  4DR6 M;  3B7X A;  5HW6 A;  1GL7 A;  5IRE B;  1HNZ M;  1TFV A;  2HCB A;  3WH0 A;  1NHG C;  4HBE A;  2X49 A;  2CHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...