3RFWA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally-related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
252
structure length
252
Chain Sequence
ATVATVNGKSISDTEVSEFFAPMLRGQDFKTLPDNQKKALIQQYIMQDLILQDAKKQNLEKDPLYTKELDRAKDAILVNVYQEKILNTIKIDAAKVKAFYDQNKDKYVKPARVQAKHILVATEKEAKDIINELKGLKGKELDAKFSELAKEKSIDPGSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTTPVKTNFGYHVILKENSQAKGQIKFDEVKQGIENGLKFEEFKKVINQKGQDLLNSAKVEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell-binding factor 2
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally-related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Chaperone
total genus 77
structure length 252
sequence length 252
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1040 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3rfwA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rfwA03
2L2SA 4DRIA 2PV2A 3LUOA 5HKGA 4ODMA 4QT2A 3TCZA 5HW6A 1FKJA 2PV1A 2ZR5A 2KR7A 3KAHA 3O5LA 3O5RA 4JFJA 4ODNA 3RGCA 3TC5A 1Q6IA 5BXJA 1QZ2A 3OOBA 1J6YA 1W26A 2XP4A 3KZ7A 3O5IA 3PRBA 4FAPA 1A7XA 4DRPA 4TW7A 1D7IA 2UZ5A 2KGJA 2XP8A 2XP3A 2MLXA 4IQ2A 4MSPA 2XP6A 2ZQSA 1ROUA 2OFNA 1P5QA 2RSEA 1NMWA 1FKBA 4GGQA 2MPHA 4DRJA 4DRQA 3CGMA 1JNTA 3O5PA 2LGOA 2RUCA 1BKFA 3WH0A 2ZQTA 3UQAA 1FKDA 4U85A 2F21A 3I6CA 4QIBA 4TYOA 1KT1A 2ZR6A 4ITZA 4W9OA 1FKTA 2PV3A 2Q5AA 3O5FA 3NTPA 3KACA 4TNSA 5HWBA 4MGVA 3O5QA 1FKSA 3CGNA 4ODQA 4R0XA 4ODOA 1QPFA 3O5EA 2KE0A 3KABA 1NMVA 2N87A 3UQIA 2KFWA 2MLZA 2XP9A 2ZR4A 2F2DA 3JXVA 2M2AA 4BF8A 5D75A 4DT4A 1L1PA 1D7HA 4LAWA 1FAPA 2ITKA 2KI3A 4IQCA 4JFMA 1YATA 4DZ2A 2XP5A 4N19A 1Q1CA 4W9QA 4G50A 1JNSA 1J4HA 2MF9A 3KAIA 3NRKA 1Q6HA 1FKIA 2PPOA 3JYMA 4TW6A 2LKNA 2AWGA 2FAPA 4DROA 4J4OA 1D6OA 2D9FA 2XPBA 3IKGA 2IF4A 2RUQA 4W9PA 1J4RA 5GPGA 4ODRA 1KT0A 2RUDA 1TCOC 4GIVA 1FKKA 3VAWA 2PPPA 4DIPA 4U86A 3H9RB 4NNRA 5HTGA 4LAXA 5HT1A 2Y78A 4JFLA 4DRNA 1Q6UA 1T11A 2DG3A 2F4EA 2LJ4A 3O5DA 3O5MA 4TW8A 2XP7A 4DRHA 1JVWA 4LAYA 5I98A 2MNTA 1FKGA 3IHZA 3TDBA 1FKFA 4LAVA 1N1AA 2ZQVA 5DIUA 1PBKA 1F8AB 4O2TA 3KAFA 1NSGA 1ROTA 1J4IA 3O5KA 2XPAA 1FJDA 1R9HA 3JYJA 3KCEA 1C9HA 2FKEA 5HWCA 1EQ3A 2DG4A 4FN2A 4ODLA 3UI6A 2LPVA 3NI6A 2K8IA 3RFWA 3KADA 3KAGA 5HW8A 1Y0OA 1ZK6A 4C02B 4DRKA 2KO7A 4IPXA 4G2PA 1D7JA 1F40A 4QT3A 5DITA 4DZ3A 2PBCA 3PA7A 1QPLA 5HUAA 1FKHA 4TX0A 3ODKA 3PRDA 1FKRA 3IK8A 1ZCNA 1FD9A 4JYSA 3UI4A 3MDYB 1EYMA 2PPNA 3UQBA 2M1IA 2RQSA 2DG9A 3O5JA 5HW7A 3GPKA 4JFKA 4DH0A 4DRMA 5DIVA 1BL4A 1B6CA 1YW5A 2RURA 2ZQUA 3FAPA 1PINA 3O5GA 2VCDA 4ODPA 4ODKA 3B7XA 3UF8A 2VN1A 1FKLA 5J6EA 4J4NA 1U79A 4JFIA 2M08A 4U84A 1HXVA 3EY6A 3IKDA 3O5OA 5B8IC 2JZVA 1M5YA 3UI5A 2MLYA
chains in the Genus database with same CATH superfamily
2V6ZM 4NRWA 2JXNA 1Z5AA 1QZ2A 1J6YA 1HKJA 4Z2HA 1VQ1A 3B7NA 1NVMA 3LVVA 4LRSA 3FUVA 3LW5F 3ZQJA 1NWTA 1SR0A 3DZDA 2XP6A 1NH6A 1HKIA 4MNMA 3U6QA 3THGA 2ZBKB 1ITXA 1OIZA 5EP1A 5HWBA 1HQYE 5FTKA 4R0XA 1ZMUA 3MJ5A 2OLHA 4JI4M 2FE8A 2QBYA 4LF7M 2L4EA 2XP5A 1FFQA 3NBXX 4G4RA 5GPRA 4IJFA 3ALFA 2BNKA 3W68A 1DGGA 2AWGA 4REZA 3WL1A 4MNKA 1O6IA 1DGHB 1J4RA 5E26A 4G4QA 4NNRA 1ZQ9A 4LZJA 4QOZC 4DRHA 2DXIA 1FKFA 2DSWA 3KAFA 2W82A 2QZ4A 1C9HA 4R5EA 2N35A 3RFWA 3M6AA 2L6OA 2GNOA 3ARSA 4M0WA 2OOAA 2DG9A 3CTWB 3CHFA 1NHWC 1IN6A 2R6FA 5FTLA 4B7HA 4PDIA 3U6OA 2QQ8A 1XHGA 2MLYA 2LVAA 3UMMA 1IXZA 3AL0C 4JFJA 3OOBA 1W26A 2XP4A 3WKZA 4FAPA 4QOSA 1YSYA 4NC6A 1TF0B 4XGIA 4ZPXA 1GVNA 4GRIA 4IBFA 2X49A 3HKPA 4Z2GA 4R3DA 2DSVA 3ARYA 4DV4M 2ZANA 2Q5AA 4FWDA 4LFAM 1R2ZA 3K9OA 4MGVA 3WHKA 1DO0A 4K0KM 3AS1A 2DSZA 3JXVA 3BXWA 3T1YM 3WD4A 3NRKA 1ZL1A 1SXJA 2PI6A 3IKGA 4WK9A 2HL7A 4IBEA 2OO9A 4GIVA 3V76A 1DV0A 1EE8A 4A3VB 3U60B 1FKGA 3TDBA 1V92A 3LVWA 3AKZA 3OTOM 4O2TA 4I81A 3FRHA 1W5SA 1N75A 3U6CA 5A2QS 1TFVA 3UI6A 3KADA 4JI2M 1T6OA 2DNAA 3SASA 1DGFA 3DA1A 3RM9A 3L26A 2LHGA 1LQ0A 4GIPA 4L3NA 3E21A 3QYBA 3VK8A 2VN1A 5J6EA 4J4NA 3QAUA 3M0EA 3U61A 1NWRA 3E46A 2Z8YM 4D81A 1NV9A 5IREB 3TWLA 5HKGA 2D7EA 3KAHA 4GITA 4ODNA 2ETNA 1EIJA 2LVNC 2JY7A 1VDLA 2MGWA 3HHYA 3O5IA 1X6LA 2FNAA 1QDRA 2YFQA 4LRTA 4WKAA 3GPYA 2OPFA 3F92A 4MPKA 3O5PA 2MROB 1XNQM 2G5GX 5EP2A 4G4NA 2LVOC 3RE8A 3FTCA 1RU3A 3MMPA 2CWBA 5FLXS 2DSUA 1FKSA 3L29A 1QYRA 3GPUA 2AHMA 2R0IA 1G3IA 2MF9A 1H6UA 3ARRA 1W1YA 2PPOA 2P4VA 2JWSA 3E9SA 3J7BA 2VF8A 2VIIA 1NY5A 2X4AA 3ARXA 3WD3A 3IECA 3VK7A 3AV0A 2ZTDA 2B31A 3RMEA 1HT1E 4B3RM 2LVQD 2DWLA 2XF3A 3EIPA 1NJGA 3GLFA 4AQYM 1PJJA 3CH9A 3WQVA 3A46A 2DT3A 4PCZA 2LWXA 1EQ3A 3KAGA 1ZV1A 1D2NA 1YE9A 2KEBA 3HU3A 2A3EA 3WHLA 5F3WA 4Q22A 3PRDA 2LVPC 1VG5A 5DIVA 2ZQUA 3Q8XA 4QHSA 1J09A 2WLYA 4AKHA 4ODMA 4LJ6A 2KR7A 5EQTA 3DOAA 4DRPA 2KXEA 4GH9A 1IY0A 4DRJA 1FKBA 3IG5A 3WH0A 3KS8A 4NRVA 3SMSA 5IT9S 3J27B 4F2LA 4KO8A 1AIPC 1S3SA 3SFZA 1WAWA 2R45A 2APLA 1Q02A 1XXHA 2PN0A 3KABA 1NMVA 2ZR4A 1QAOA 4IBIA 1IBLM 2KI3A 1E94E 1YATA 1NNUC 4QZVB 7CATA 1P3QQ 2LXEA 1G41A 1T3TA 1JNSA 3U6LA 4DV1M 4LZZA 1GKIA 2IF4A 1LG2A 1K3WA 1QAMA 2H1RA 4FCTA 4LAXA 2B3TA 3U6MA 3KDSE 1JVWA 1Q3CA 2ZQVA 4MM3B 3KFUG 4JI0M 4ODLA 2ZTCA 5FTNA 2ERCA 1FFRA 2KO7A 2EA0A 4QT3A 4DR3M 3IK8A 3HHXA 2PPNA 2K0BX 2KRUA 4HL4A 1C1KA 2DVWB 3TQSA 1LG1A 3ALGA 2MH8A 4MB7A 3EY6A 2EUCA 2I7PA 3CHCA 3GLFE 4L8RC 1JNDA 1ZAEA 1JCHB 3TPZA 3GLHA 3VFDA 3QOKA 5IZ7D 4D82A 2DWMA 1Y8GA 2DENA 2XZUA 4JYAM 1D0KA 3R8FA 3U6SA 3JR5A 1VEKA 3KOWE 1LL7A 2Z4SA 1FNNA 4LGYA 3RM8A 4QIBA 2A3CA 4GKKM 1NHGC 2FS1A 4L4UA 1ZBWA 4I8OA 2KFWA 3WIJA 1TGUA 2M2AA 4I5SA 3HJ8A 4FW9A 4DT4A 3RGSA 2LHCA 3GLIA 3JR4A 4MGYE 1W1PA 3KAIA 2LKNA 4LJAA 1NWSA 4NL4H 4GHAA 4Q7NA 3VAWA 4Z2IA 3TE6A 1Q6UA 2DG3A 2YBUA 2DKLA 2O25A 4UN2B 3IHZA 3CF0A 3NBIA 4JI5M 1PBKA 1XXHE 5KQ8A 2NQ8C 4DWSA 1J4IA 3PVSA 4BB9A 1K82A 1HNXM 3HGIA 2K6BA 1W9UA 5JI3E 4DR7M 3L28A 5HBFA 4DZ3A 4AKIA 5HUAA 4IBJA 4M9ZA 1QZEA 2UXBM 3GLGE 1BVSA 4LGXA 4LJ7A 3ILKA 3RGPA 2BJVA 4X64M 1EIBA 1DGHA 3C58A 1WIVA 3UZUA 4HARA 5KO3A 3O5OA 3J80S 2LBCA 1M5YA 2XSZD 3O5RA 1HJPA 3FXYA 2WSEF 4G3OA 2FOIC 2CV2A 5EP3A 3T6PA 2ZQSA 1QZMA 4MNLA 1OGGA 4S3KA 3QYEA 3FD9A 2Z7JA 1HKMA 4JI6M 1IBKM 3FTDA 5GQBA 4LJ9A 4TNSA 3KACA 2DAIA 3HX3A 2KE0A 2FDMA 4MGKE 1GABA 3K92A 1L1PA 2DWZB 1N78A 2R65A 3GLHE 1PGYA 4DR6M 4IBCA 3GPPA 4DV7M 2C9OA 2QENA 1Z5CA 3JYMA 1WNOA 3VKHA 1L2CA 5EP4A 1H0IA 2KW0A 3PFIA 2OOBA 3H9RB 4DUZM 3HU2A 2F4EA 2AOSA 3O5MA 4LF8M 2XP7A 3VDPA 4GHLA 3I4VA 2DAMA 1GJTA 1NSGA 1ORYB 2RRUA 5EXSA 1CUKA 5HWCA 2QNJA 4GMQA 3GLIE 1N32M 1J7KA 1NV8A 4DRKA 2VQFM 4LFBM 1UR9A 3UQBA 2B5UB 1IQPA 4DRMA 2RKOA 1XC8A 3UF8A 2KRKA 1AUAA 4U84A 3HHWA 3U60A 1E6RA 1W9PA 3O5LA 3PXGA 4GEWA 2UUCM 3MK6A 2R4JA 3GRYA 2KGJA 2XP8A 3WD0A 4W5WA 1GJSA 1PJIA 5KPZA 4GC5A 1NMWA 4DRQA 3W67A 4XBOA 2MPHA 1JNTA 1HNWM 5FTJA 1HQCA 3I6CA 1KYIA 3AS3A 4ITZA 2M60A 2KNZA 2DT1A 3UJNA 4ODOA 3J7AS 1QPFA 4HLQA 4OX9M 3W4RA 4S3JA 1C7YA 1PJTA 3GPXA 1XMOM 1Q6HA 3SHGB 1EFUB 4W9PA 1GRJA 1XHBA 1FKKA 4DIPA 2HAKA 1R6BX 1T11A 2C99A 3B9DA 1IXSA 3Q8GA 1F8AB 3KXEC 1ROTA 4QNRA 3JYJA 2KA6B 1HNZM 2G8ZA 2DG4A 4B08A 3NI6A 2K8IA 1N36M 4I4LA 3W0FA 2DT0A 2WZJA 3ZCBB 1MJGM 3FUXA 2M5ZA 4OVZB 3K9PA 2Y0QA 4MNJA 1UM8A 4Z2JA 1JQJC 3AS2A 1D0MA 1PINA 4ODPA 1Q3BA 1OFIA 4JFIA 1JB0F 4KHPM 3SYLA 1RD6A 1E44A 2Y21A 5ITYA 1L2BA 3K2LA 2JY6B 4RNAA 3RGCA 1V33A 3ARZA 4TW7A 2UZ5A 2XP3A 2WLZA 4LCBA 1P5QA 3HHZA 4DR5M 2L7HA 4OU7A 3J81S 1QUSA 4DV6M 3U5ZA 1FKTA 2QPAA 2R46A 1W1VA 4ODQA 2CHVA 1ZBKA 2H5XA 2FH0A 4URIA 1QAQA 2X8AA 3KOYE 1G4AE 2CHGA 2JY8A 4LF4M 2XFSA 5IWAM 1F4IA 2KNAA 2J5YA 2FAPA 4AG5A 4DV5M 1KT0A 1D2KA 4IBKA 3KP1E 4BBAA 1ZB5A 2ZAOA 3WL0A 1XNRM 3R9XB 2C9CA 1NSFA 3KOXE 3KVWA 1W9VA 3O5KA 3KCEA 4Q7JA 3IHPA 4ANRA 3BMBA 3PR9A 3L2AA 1Q39A 5DITA 3H4JA 3TWMA 4Y28F 1TR8A 5HW7A 1WJ7A 5ITRA 4NSOB 1BL4A 2O5RA 3GO8A 2DZOB 3FAPA 8CATA 4ODKA 2GQFA 5ITTA 2JNHA 1MU5A 1G71A 1OIPA 3SMPA 1OQYA 3AFHA 2A5YB 1IBMM 1SG9A 2A3BA 4RKUF 4ITQA 3VLFB 5JI2E 1L1TA 3CF2A 1FJGM 1CTNA 3L27A 2MLXA 4IQ2A 1SXJE 4HBOA 3SAVA 2CE7A 3LCUA 2LGOA 1BKFA 2ZQTA 2F21A 3C3DA 2R44A 2L09A 3HJSA 3U61B 4G4OA 2J7NA 3O5EA 2DWNA 2N87A 3SYKA 4BF8A 5KPTA 5D75A 5DO2A 1OAIA 1LL6A 5EXPA 2O01F 2UUAM 3PNYA 2MJ5B 3SATA 4HBEA 2PPPA 3B9AA 1N34M 4R71A 3GTYX 1R2YA 3FTEA 2L7IA 4WIWA 2D7GA 4M9XA 3SBJA 1XMQM 1QQWA 4MAVA 1HT2E 5ITXA 4LG2A 1K9TA 3SAWA 4LY6A 3RM4A 1TH4A 2JP7A 2Z4RA 4AW4A 1E9SA 2XZFA 2UUBM 1YW5A 1LTMA 5DYIA 3B7XA 1GPFA 1XB2B 4ZPWR 5DYGA 3ARWA 3SHFA 1WB0A 4KR0B 2YQZA 5JH8A 1A7XA 4LGMA 4MSPA 2YR0A 2ZAMA 2CP8A 4FCVA 4B3SM 1HJXA 4TUWA 1FKDA 2ZR6A 2EKKA 3VKGA 2HHHM 4LJ8A 3KW6A 1VDDA 2XP9A 2C98A 2WSFF 2BWBA 2D7HA 4LFCM 2ITKA 3HZJA 4IQCA 4UDMA 4DZ2A 2UXCM 4N19A 4TW6A 2L4FA 3FUWA 3B7QA 4X66M 1TCOC 1NO1A 4AY1A 5C1BA 2Y78A 1QDTA 1L8QA 3D8LA 3O5DA 4TW8A 2EULA 4XAKA 5EXTA 2RGHA 4MGIE 3B74A 4WP2A 4M0DA 2XPAA 4DWSD 3LQQA 4XK8F 3K1JA 3GQ5A 4L16A 3B8SA 1QPLA 3ODKA 2O9OA 1GLNA 2G8LA 3GLGB 4JI1M 3AROA 2RQSA 1OAOC 4DH0A 4IT6A 4JV5M 3BBZA 4RF1A 1X6NA 1JR3A 2IUZA 1E32A 2HKJA 4Z6YA 1A5TA 4B3MM 4AI6A 4QT2A 3SC3A 1Q6IA 3KP0E 1YUBA 5ITXE 1UFZA 1HKKA 4QNMA 3U6DA 4DV3M 4JN6A 2C96A 1ROUA 2QHOB 2DAKA 3CGMA 4Z2LA 1XRVA 3U6PA 5FSWA 4PTMA 3A98B 2V1UA 1TH2A 4DUYM 4W5UA 3ARVA 3D8BA 4PDGA 3O5QA 1R4GA 1IX5A 3IG8A 3GLHB 1FAPA 1PRBA 4NOOB 3GRUA 4DV2M 1NNJA 4G50A 3GU0A 5GPGA 3I4YA 3GP1A 2MNTA 1MX0A 2DAGA 1IN4A 4IT4A 1QUTA 5BPVA 1R9HA 1G59A 3FYDA 3GLIB 2EJSA 1ZK6A 1D7JA 1E9RA 1R7RA 4FWGA 2C5RA 2L2DA 4JYSA 2M1IA 3HWSA 3T38A 3FUUA 4LJ4A 4DV0M 3BOSA 2DHRA 3LQRA 3O5GA 3I51A 4P17A 1FKLA 2F5SA 1HXVA 1TTEA 4ML4A 5BR8M 4DWSB 3LUOA 3M7GA 4RF0A 4MH0E 1ZBCA 2YBTA 2R4EA 2XGNA 2KNVA 3TL4X 2DZNB 5DFLA 3B89A 4GGQA 1GO5A 2RSEA 1K3XA 2CFOA 2F4VM 3ARQA 3UQAA 4LJ5A 3NWLA 2MR9A 1SYTA 3FUTA 4TYOA 2FFJA 4W9OA 1ZU8A 1WGLA 4OVZA 3L25A 1JR3E 3NTPA 3FRIA 4NSRA 4P16A 2QP9X 3WD2A 3T1HM 4LF6M 1D7HA 1GL6A 4LAWA 2JZ0A 1KFVA 4FVMA 1T43A 3ZC7B 4MTVA 2JUJA 1GUVA 2CUZA 2HWJA 2VDBB 1QANA 4WKFA 3GQ4A 3A45A 2VF7A 3KSJA 5KPRA 1Z6TA 1TH3A 1OWQA 2LTUA 1ZMVA 5ITQA 3K8ZA 4P8XA 1FJDA 3A42A 4CGYB 4IJEA 2F5OA 1Y0OA 1G8PA 1ZBVA 3EIEA 1SXJD 1X37A 3UGJA 2DZLA 1E15A 1TDHA 1EYMA 5KQDA 3FTFA 4ZS6A 1L2DA 2J7OA 3MHVC 2RURA 3FYCA 1OKSA 4B3TM 3HY5A 3KSXA 1L1ZA 3LCVB 2WM0A 2QBYB 4AG6A 1VEGA 3FY1A 2G3QA 1VF8A 1OGBA 2I7NA 1FKJA 5HW6A 1WHCA 1J5EM 5H37D 4JI8M 2Y0TA 1NY6A 1D7IA 3J2PB 4LF5M 2XLJA 1LJYA 1MN3A 4X62M 2RUCA 2XH9A 1IXRC 4U85A 1OTRA 3B9EA 1KT1A 4B7GA 3SAUA 1IFYA 4OW0A 3DFZA 1W1TA 1IN5A 4KLNA 2K9DA 4B7FA 2UU9M 3PRAA 2F5QA 3KOZE 1OFHA 1UR8A 4F1IA 5EXXA 2XFTA 4IBDA 4DWSC 4HEOA 1D6OA 5EJCA 2XPBA 5DEZA 2RUQA 1IY2A 3LMMA 1LV7A 5HTGA 3AOEC 4DR4M 4LAYA 4X65M 4NSBA 2YNMD 1NJFA 2CV1A 4KQZA 1Z5BA 2A3AA 4FN2A 3U6EA 1IN8A 4DBGB 4WJXA 2KHHA 2CV0A 4WKHA 4QHTA 4TX0A 4WURA 5C18A 1YLAA 3UI4A 1WR1B 4CIZA 4PT5A 4IBGA 5GKNA 1B6CA 1N77A 3GRRA 2VCDA 1EHNA 1JNEA 4YY3M 4G6ZA 3FE3A 1IXSB 3UI5A 4DRIA 2PV2A 1DO2A 3OA5A 2QF8A 3TCZA 4FD2A 3GQ3A 3AOGA 4AKGA 3B7ZA 4ZPVR 1V34A 2F5PA 1SXJB 4L72B 2E5LM 4MGHA 1IN7A 2Q2EB 1Z59A 2CRUA 2LNHC 4II7A 3O5FA 2R18A 1PJSA 3CHDA 3CGNA 3EIHA 2G41A 1DGBA 3CGWA 2WSCF 1Q1CA 3CF6E 3KS4A 4P8UA 4J4OA 3ARTA 2D9FA 5FTMA 2BJWA 2LH0A 4ODRA 4P8WA 4U86A 1I4WA 4JFLA 1E6PA 3G6MA 1I94M 3U5ZB 3HU1A 4LAVA 4ZPTR 3ZH9B 2FKEA 2JY5A 1E6NA 4G2PA 2PBCA 2O92A 1FKHA 4NXMM 1FKRA 3G6LA 1IM2A 1E6ZA 1FD9A 3MDYB 1R5LA 4NXNM 2ZM6M 2DHYA 3E4RA 3PNVA 2M08A 1E9LA 4LF9M 4IBBA 2L2SA 4CJ6A 4R7GA 2KDLA 2CHQA 2PV1A 2ZR5A 3UK6A 3TC5A 5DF0A 5BXJA 2K47A 4D80A 3PRBA 1WGNA 1KFWA 2KZSA 4L15A 2OFNA 4WW0A 2ESCA 4P8VA 4CHTB 4AZFA 4JI3M 1VEJA 3GLGA 5LMNM 2JA2A 4KT0F 3GLFB 4BLCA 2PV3A 3AJIB 3UQIA 3AQUA 3TWKA 1LL4A 4JFMA 4JI7M 2R62A 1J4HA 4DROA 1FKIA 3AS0A 2QSFX 4NZCA 1SXJC 5DNYA 5HT1A 5I98A 4CISA 3WQWA 2DI0A 3SARA 4Z8XA 3ARUA 3HJQA 5HW8A 5LMUM 4C02B 2BWEA 5L8RF 3PA7A 3QWLA 1TDZA 3GRVA 3O5JA 4JFKA 3VDUA 4FCWA 1XXHB 4S12A 2RGOA 1JR3D 1U79A 4EIWA 1NWUA 4PD2A 2XEPA 1IY1A 1W5TA 4M9SA 2VQEM 4L6V6 3W0LB 3KZ7A 3T15A 2QCUA 2P5TA 2DAEA 1KSFX 3CHEA 1HJWA 2V1CA 4GKJM 2JZ1A 2HCBA 1N33M 3C9PA 3FKEA 1GL7A 2Z3XA 2MLZA 2F2DA 1PM5A 4DR1M 2KZUA 2EKFA 5E6JA 1D0LA 4GC9A 1PJQA 4KODA 4L78A 1HR0M 4W9QA 1ZMWA 1XWIA 2EO2A 1GOIA 2OQ4A 2RUDA 3AOEA 5ITUA 4JXJA 4DRNA 2LJ4A 4DR2M 2CEAA 2DT2A 3I04M 1N1AA 5DIUA 2UXDM 1OJLA 1EDQA 2F5NA 4Z2KA 4MGZE 3WD1A 2LPVA 3JAMS 4IPXA 3B9PA 3CZ8A 1F40A 2DPEA 2F23A 2Y20A 3I01M 3ARPA 1ZCNA 1QVRA 1HJVA 3H4MA 3GPKA 4YHHM 2WK2A 4FWHA 1H0GA 3C3EA 4IIWA 1WXQA 3IKDA 5B8IC 2JZVA 2XSZA
chains in the Genus database with same CATH topology
2V6ZM 4NRWA 1Z5AA 1QZ2A 1J6YA 1HKJA 4Z2HA 1NVMA 3LVVA 4LRSA 3FUVA 1NWTA 1SR0A 3DZDA 2XP6A 1NH6A 1HKIA 4MNMA 3U6QA 3THGA 2ZBKB 1ITXA 5EP1A 5HWBA 1HQYE 5FTKA 4R0XA 3MJ5A 2OLHA 4JI4M 2FE8A 2QBYA 4LF7M 2XP5A 1FFQA 4G4RA 5GPRA 4IJFA 3ALFA 2BNKA 1DGGA 2AWGA 4REZA 3WL1A 4MNKA 1O6IA 1DGHB 1J4RA 5E26A 4G4QA 4NNRA 1ZQ9A 4LZJA 4QOZC 4DRHA 2DXIA 1FKFA 2DSWA 3KAFA 2W82A 2QZ4A 1C9HA 4R5EA 3RFWA 3M6AA 2L6OA 3ARSA 4M0WA 2DG9A 3CTWB 3CHFA 1NHWC 1IN6A 5FTLA 4B7HA 4PDIA 3U6OA 1XHGA 2MLYA 3UMMA 1IXZA 3AL0C 4JFJA 3OOBA 1W26A 2XP4A 3WKZA 4FAPA 4QOSA 1YSYA 4XGIA 4ZPXA 1GVNA 4GRIA 4IBFA 2X49A 3HKPA 4Z2GA 4R3DA 2DSVA 3ARYA 4DV4M 2ZANA 2Q5AA 4FWDA 4LFAM 1R2ZA 4MGVA 3WHKA 1DO0A 4K0KM 3AS1A 2DSZA 3JXVA 3BXWA 3T1YM 3WD4A 3NRKA 1ZL1A 1SXJA 2PI6A 3IKGA 4WK9A 2HL7A 4IBEA 4GIVA 1EE8A 4A3VB 3U60B 1FKGA 3TDBA 3LVWA 3AKZA 3OTOM 4O2TA 4I81A 1W5SA 1N75A 3U6CA 5A2QS 1TFVA 3UI6A 3KADA 4JI2M 3SASA 1DGFA 3DA1A 3RM9A 3L26A 1LQ0A 4GIPA 4L3NA 3VK8A 2VN1A 5J6EA 4J4NA 3QAUA 3M0EA 3U61A 1NWRA 4D81A 5IREB 3TWLA 5HKGA 2D7EA 3KAHA 4GITA 4ODNA 3HHYA 3O5IA 1X6LA 2FNAA 2YFQA 4LRTA 4WKAA 3GPYA 2OPFA 4MPKA 3O5PA 1XNQM 2G5GX 5EP2A 4G4NA 3RE8A 3FTCA 5FLXS 2DSUA 1FKSA 3L29A 1QYRA 3GPUA 2AHMA 1G3IA 2MF9A 1H6UA 3ARRA 1W1YA 2PPOA 3J7BA 3E9SA 2VIIA 1NY5A 2X4AA 3ARXA 3WD3A 3VK7A 3AV0A 2B31A 3RMEA 1HT1E 4B3RM 2DWLA 2XF3A 1NJGA 3GLFA 4AQYM 1PJJA 3CH9A 3WQVA 3A46A 2DT3A 4PCZA 2LWXA 1EQ3A 3KAGA 1D2NA 1YE9A 2KEBA 3HU3A 2A3EA 3WHLA 5F3WA 4Q22A 3PRDA 5DIVA 2ZQUA 3Q8XA 4QHSA 1J09A 2WLYA 4AKHA 4ODMA 4LJ6A 2KR7A 5EQTA 3DOAA 4DRPA 2KXEA 4GH9A 1IY0A 4DRJA 1FKBA 3IG5A 3WH0A 3KS8A 4NRVA 3SMSA 5IT9S 3J27B 4KO8A 3SFZA 1S3SA 1WAWA 2R45A 1XXHA 3KABA 1NMVA 2ZR4A 1QAOA 4IBIA 1IBLM 2KI3A 1E94E 1YATA 1NNUC 4QZVB 7CATA 2LXEA 1G41A 1T3TA 1JNSA 3U6LA 4DV1M 4LZZA 1GKIA 2IF4A 1LG2A 1K3WA 1QAMA 2H1RA 4FCTA 4LAXA 3U6MA 3KDSE 1JVWA 1Q3CA 2ZQVA 4MM3B 3KFUG 4JI0M 4ODLA 5FTNA 2ERCA 1FFRA 2KO7A 2EA0A 4QT3A 4DR3M 3IK8A 3HHXA 2PPNA 2KRUA 4HL4A 1C1KA 2DVWB 3TQSA 1LG1A 3ALGA 4MB7A 3EY6A 2EUCA 2I7PA 3CHCA 4L8RC 1JNDA 1ZAEA 3TPZA 3GLHA 3VFDA 3QOKA 5IZ7D 4D82A 2DWMA 2XZUA 4JYAM 3R8FA 3U6SA 3JR5A 3KOWE 1LL7A 2Z4SA 1FNNA 4LGYA 3RM8A 4QIBA 2A3CA 4GKKM 1NHGC 4L4UA 1ZBWA 4I8OA 2KFWA 3WIJA 1TGUA 2M2AA 4I5SA 3HJ8A 4FW9A 4DT4A 3RGSA 3GLIA 3JR4A 4MGYE 1W1PA 3KAIA 2LKNA 4LJAA 1NWSA 4NL4H 4GHAA 4Q7NA 3VAWA 4Z2IA 3TE6A 1Q6UA 2DG3A 2YBUA 3IHZA 3CF0A 3NBIA 4JI5M 1PBKA 5KQ8A 2NQ8C 4DWSA 1J4IA 3PVSA 4BB9A 1K82A 1HNXM 3HGIA 1W9UA 5JI3E 4DR7M 3L28A 5HBFA 4DZ3A 4AKIA 5HUAA 4IBJA 4M9ZA 2UXBM 4LGXA 4LJ7A 3ILKA 3RGPA 2BJVA 4X64M 1EIBA 1DGHA 3C58A 3UZUA 4HARA 5KO3A 3O5OA 3J80S 1M5YA 2XSZD 3O5RA 3FXYA 2FOIC 2CV2A 5EP3A 2ZQSA 1QZMA 4MNLA 1OGGA 4S3KA 3FD9A 2Z7JA 1HKMA 4JI6M 1IBKM 3FTDA 5GQBA 4LJ9A 4TNSA 3KACA 2KE0A 2FDMA 4MGKE 3K92A 1L1PA 2DWZB 1N78A 2R65A 4DR6M 4IBCA 3GPPA 4DV7M 2C9OA 2QENA 1Z5CA 3JYMA 1WNOA 3VKHA 1L2CA 5EP4A 1H0IA 2KW0A 3PFIA 3H9RB 4DUZM 3HU2A 2F4EA 2AOSA 3O5MA 4LF8M 2XP7A 3VDPA 4GHLA 3I4VA 1NSGA 1ORYB 5EXSA 5HWCA 4GMQA 1N32M 1J7KA 4DRKA 2VQFM 4LFBM 1UR9A 3UQBA 1IQPA 4DRMA 2RKOA 1XC8A 3UF8A 2KRKA 4U84A 3HHWA 3U60A 1E6RA 1W9PA 3O5LA 3PXGA 2UUCM 3MK6A 2R4JA 3GRYA 2KGJA 2XP8A 3WD0A 4W5WA 1PJIA 5KPZA 4GC5A 4DRQA 1NMWA 4XBOA 2MPHA 1JNTA 1HNWM 5FTJA 1HQCA 3I6CA 1KYIA 3AS3A 4ITZA 2M60A 2DT1A 3UJNA 4ODOA 3J7AS 1QPFA 4HLQA 4OX9M 3W4RA 4S3JA 3GPXA 1XMOM 1Q6HA 3SHGB 4W9PA 1XHBA 1FKKA 4DIPA 1R6BX 1T11A 2C99A 3B9DA 1F8AB 3KXEC 1ROTA 4QNRA 3JYJA 2KA6B 1HNZM 2G8ZA 2DG4A 4B08A 3NI6A 2K8IA 1N36M 4I4LA 3W0FA 2DT0A 3ZCBB 3FUXA 2M5ZA 4OVZB 2Y0QA 4MNJA 1UM8A 4Z2JA 1JQJC 3AS2A 1PINA 4ODPA 1Q3BA 1OFIA 4JFIA 4KHPM 3SYLA 1RD6A 2Y21A 5ITYA 1L2BA 3K2LA 4RNAA 3RGCA 3ARZA 4TW7A 2UZ5A 2XP3A 2WLZA 4LCBA 1P5QA 3HHZA 4DR5M 2L7HA 4OU7A 3J81S 4DV6M 3U5ZA 1FKTA 2QPAA 2R46A 1W1VA 4ODQA 2CHVA 1ZBKA 4URIA 1QAQA 2X8AA 3KOYE 1G4AE 2CHGA 4LF4M 2XFSA 5IWAM 2FAPA 4AG5A 4DV5M 1KT0A 1D2KA 4IBKA 3KP1E 4BBAA 1ZB5A 2ZAOA 3WL0A 1XNRM 3R9XB 2C9CA 1NSFA 3KOXE 3KVWA 1W9VA 3O5KA 3KCEA 3PR9A 3L2AA 1Q39A 5DITA 3TWMA 5HW7A 5ITRA 4NSOB 1BL4A 2O5RA 3GO8A 2DZOB 3FAPA 8CATA 4ODKA 5ITTA 1MU5A 3SMPA 3AFHA 2A5YB 1IBMM 2A3BA 4ITQA 3VLFB 5JI2E 1L1TA 3CF2A 1FJGM 1CTNA 3L27A 2MLXA 4IQ2A 1SXJE 4HBOA 3SAVA 2CE7A 2LGOA 1BKFA 2ZQTA 2F21A 2L09A 3HJSA 3U61B 4G4OA 2J7NA 3O5EA 2DWNA 2N87A 3SYKA 4BF8A 5KPTA 5D75A 5DO2A 1LL6A 5EXPA 2UUAM 3PNYA 3SATA 4HBEA 2PPPA 3B9AA 1N34M 1R2YA 3FTEA 2L7IA 4WIWA 2D7GA 4M9XA 3SBJA 1XMQM 1QQWA 4MAVA 1HT2E 5ITXA 4LG2A 1K9TA 3SAWA 4LY6A 3RM4A 1TH4A 2Z4RA 4AW4A 1E9SA 2XZFA 2UUBM 1YW5A 5DYIA 3B7XA 1GPFA 4ZPWR 5DYGA 3ARWA 3SHFA 1WB0A 4KR0B 2YQZA 5JH8A 1A7XA 4LGMA 4MSPA 2YR0A 2ZAMA 4FCVA 4B3SM 1HJXA 4TUWA 1FKDA 2ZR6A 3VKGA 2HHHM 4LJ8A 3KW6A 1VDDA 2XP9A 2C98A 2D7HA 4LFCM 2ITKA 4IQCA 4DZ2A 2UXCM 4N19A 4TW6A 3FUWA 4X66M 1TCOC 4AY1A 5C1BA 2Y78A 1L8QA 3D8LA 3O5DA 4TW8A 4XAKA 5EXTA 2RGHA 4MGIE 4M0DA 2XPAA 4DWSD 3LQQA 3K1JA 3GQ5A 4L16A 3B8SA 1QPLA 3ODKA 2O9OA 1GLNA 2G8LA 3GLGB 4JI1M 3AROA 2RQSA 4DH0A 4IT6A 4JV5M 4RF1A 1X6NA 1JR3A 2IUZA 1E32A 2HKJA 4Z6YA 4B3MM 4AI6A 4QT2A 3SC3A 1Q6IA 3KP0E 1YUBA 5ITXE 1HKKA 4QNMA 3U6DA 4DV3M 4JN6A 2C96A 1ROUA 3CGMA 4Z2LA 1XRVA 3U6PA 5FSWA 4PTMA 3A98B 2V1UA 1TH2A 4DUYM 4W5UA 3ARVA 3D8BA 4PDGA 3O5QA 1IX5A 3IG8A 3GLHB 1FAPA 4NOOB 3GRUA 4DV2M 1NNJA 4G50A 5GPGA 3I4YA 3GP1A 2MNTA 1MX0A 1IN4A 4IT4A 5BPVA 1R9HA 1G59A 3FYDA 3GLIB 1ZK6A 1D7JA 1E9RA 1R7RA 4FWGA 2C5RA 4JYSA 2M1IA 3HWSA 3T38A 3FUUA 4LJ4A 4DV0M 3BOSA 2DHRA 3LQRA 3O5GA 3I51A 1FKLA 2F5SA 1HXVA 4ML4A 5BR8M 4DWSB 3LUOA 3M7GA 4RF0A 4MH0E 1ZBCA 2YBTA 2R4EA 2XGNA 3TL4X 2DZNB 4GGQA 2RSEA 1K3XA 2CFOA 2F4VM 3ARQA 3UQAA 4LJ5A 3NWLA 1SYTA 3FUTA 4TYOA 2FFJA 4W9OA 1ZU8A 4OVZA 3L25A 3NTPA 4NSRA 4P16A 2QP9X 3WD2A 3T1HM 4LF6M 1D7HA 1GL6A 4LAWA 1KFVA 4FVMA 3ZC7B 4MTVA 1GUVA 2CUZA 1QANA 4WKFA 3GQ4A 3A45A 3KSJA 5KPRA 1Z6TA 1TH3A 1OWQA 5ITQA 3K8ZA 4P8XA 1FJDA 3A42A 4CGYB 4IJEA 2F5OA 1Y0OA 1G8PA 1ZBVA 3EIEA 1SXJD 1X37A 3UGJA 1E15A 1TDHA 1EYMA 5KQDA 3FTFA 4ZS6A 1L2DA 2J7OA 3MHVC 2RURA 3FYCA 4B3TM 3KSXA 1L1ZA 2WM0A 2QBYB 4AG6A 3FY1A 1VF8A 1OGBA 2I7NA 1FKJA 5HW6A 1J5EM 5H37D 4JI8M 2Y0TA 1NY6A 1D7IA 3J2PB 4LF5M 2XLJA 1LJYA 4X62M 2RUCA 2XH9A 1IXRC 4U85A 3B9EA 1KT1A 4B7GA 3SAUA 4OW0A 3DFZA 1W1TA 1IN5A 4KLNA 4B7FA 2UU9M 3PRAA 2F5QA 3KOZE 1OFHA 1UR8A 5EXXA 2XFTA 4IBDA 4DWSC 1D6OA 5EJCA 2XPBA 5DEZA 2RUQA 1IY2A 3LMMA 1LV7A 5HTGA 3AOEC 4DR4M 4LAYA 4X65M 4NSBA 2YNMD 1NJFA 2CV1A 4KQZA 1Z5BA 2A3AA 4FN2A 3U6EA 1IN8A 4WJXA 2CV0A 4WKHA 4QHTA 4TX0A 4WURA 5C18A 3UI4A 4PT5A 4IBGA 5GKNA 1B6CA 1N77A 3GRRA 2VCDA 1EHNA 1JNEA 4YY3M 4G6ZA 1IXSB 3UI5A 4DRIA 2PV2A 1DO2A 3OA5A 2QF8A 3TCZA 4FD2A 3GQ3A 3AOGA 4AKGA 4ZPVR 2F5PA 1SXJB 4L72B 2E5LM 4MGHA 1IN7A 2Q2EB 1Z59A 2LNHC 4II7A 3O5FA 2R18A 3CHDA 3CGNA 3EIHA 2G41A 1DGBA 1Q1CA 3CF6E 3KS4A 4P8UA 4J4OA 3ARTA 2D9FA 5FTMA 2BJWA 2LH0A 4ODRA 4P8WA 4U86A 1I4WA 4JFLA 1E6PA 3G6MA 1I94M 3U5ZB 3HU1A 4LAVA 4ZPTR 3ZH9B 2FKEA 1E6NA 4G2PA 2PBCA 2O92A 1FKHA 4NXMM 1FKRA 3G6LA 1IM2A 1E6ZA 1FD9A 3MDYB 4NXNM 2ZM6M 3E4RA 3PNVA 2M08A 1E9LA 4LF9M 4IBBA 2L2SA 4R7GA 2CHQA 2PV1A 2ZR5A 3UK6A 3TC5A 5DF0A 5BXJA 2K47A 4D80A 3PRBA 1KFWA 2KZSA 4L15A 2OFNA 4WW0A 2ESCA 4P8VA 4CHTB 4AZFA 4JI3M 3GLGA 5LMNM 2JA2A 3GLFB 4BLCA 2PV3A 3AJIB 3UQIA 3AQUA 3TWKA 1LL4A 4JFMA 4JI7M 2R62A 1J4HA 4DROA 1FKIA 3AS0A 4NZCA 1SXJC 5DNYA 5HT1A 5I98A 4CISA 3WQWA 3SARA 4Z8XA 3ARUA 3HJQA 5HW8A 5LMUM 4C02B 3PA7A 3QWLA 1TDZA 3GRVA 3O5JA 4JFKA 3VDUA 4FCWA 1XXHB 4S12A 2RGOA 1JR3D 1U79A 4EIWA 1NWUA 4PD2A 2XEPA 1IY1A 1W5TA 4M9SA 2VQEM 3W0LB 3KZ7A 3T15A 2QCUA 2P5TA 1KSFX 3CHEA 1HJWA 2V1CA 4GKJM 2HCBA 1N33M 3FKEA 1GL7A 2Z3XA 2MLZA 2F2DA 1PM5A 4DR1M 2KZUA 5E6JA 4GC9A 4KODA 1HR0M 4L78A 4W9QA 1XWIA 2EO2A 1GOIA 2OQ4A 2RUDA 3AOEA 5ITUA 4JXJA 4DRNA 2LJ4A 4DR2M 2CEAA 2DT2A 1N1AA 5DIUA 2UXDM 1OJLA 1EDQA 2F5NA 4Z2KA 4MGZE 3WD1A 2LPVA 3JAMS 4IPXA 3B9PA 3CZ8A 1F40A 2DPEA 2Y20A 3ARPA 1ZCNA 1QVRA 1HJVA 3H4MA 3GPKA 4YHHM 2WK2A 4FWHA 1H0GA 4IIWA 1WXQA 3IKDA 5B8IC 2JZVA 2XSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2S A;  4DRI A;  2PV2 A;  3LUO A;  5HKG A;  4ODM A;  4QT2 A;  3TCZ A;  5HW6 A;  1FKJ A;  2PV1 A;  2ZR5 A;  2KR7 A;  3KAH A;  3O5L A;  3O5R A;  4JFJ A;  4ODN A;  3RGC A;  3TC5 A;  1Q6I A;  5BXJ A;  1QZ2 A;  3OOB A;  1J6Y A;  1W26 A;  2XP4 A;  3KZ7 A;  3O5I A;  3PRB A;  4FAP A;  1A7X A;  4DRP A;  4TW7 A;  1D7I A;  2UZ5 A;  2KGJ A;  2XP8 A;  2XP3 A;  2MLX A;  4IQ2 A;  4MSP A;  2XP6 A;  2ZQS A;  1ROU A;  2OFN A;  1P5Q A;  2RSE A;  1NMW A;  1FKB A;  4GGQ A;  2MPH A;  4DRJ A;  4DRQ A;  3CGM A;  1JNT A;  3O5P A;  2LGO A;  2RUC A;  1BKF A;  3WH0 A;  2ZQT A;  3UQA A;  1FKD A;  4U85 A;  2F21 A;  3I6C A;  4QIB A;  4TYO A;  1KT1 A;  2ZR6 A;  4ITZ A;  4W9O A;  1FKT A;  2PV3 A;  2Q5A A;  3O5F A;  3NTP A;  3KAC A;  4TNS A;  5HWB A;  4MGV A;  3O5Q A;  1FKS A;  3CGN A;  4ODQ A;  4R0X A;  4ODO A;  1QPF A;  3O5E A;  2KE0 A;  3KAB A;  1NMV A;  2N87 A;  3UQI A;  2KFW A;  2MLZ A;  2XP9 A;  2ZR4 A;  2F2D A;  3JXV A;  2M2A A;  4BF8 A;  5D75 A;  4DT4 A;  1L1P A;  1D7H A;  4LAW A;  1FAP A;  2ITK A;  2KI3 A;  4IQC A;  4JFM A;  1YAT A;  4DZ2 A;  2XP5 A;  4N19 A;  1Q1C A;  4W9Q A;  4G50 A;  1JNS A;  1J4H A;  2MF9 A;  3KAI A;  3NRK A;  1Q6H A;  1FKI A;  2PPO A;  3JYM A;  4TW6 A;  2LKN A;  2AWG A;  2FAP A;  4DRO A;  4J4O A;  1D6O A;  2D9F A;  2XPB A;  3IKG A;  2IF4 A;  2RUQ A;  4W9P A;  1J4R A;  5GPG A;  4ODR A;  1KT0 A;  2RUD A;  1TCO C;  4GIV A;  1FKK A;  3VAW A;  2PPP A;  4DIP A;  4U86 A;  3H9R B;  4NNR A;  5HTG A;  4LAX A;  5HT1 A;  2Y78 A;  4JFL A;  4DRN A;  1Q6U A;  1T11 A;  2DG3 A;  2F4E A;  2LJ4 A;  3O5D A;  3O5M A;  4TW8 A;  2XP7 A;  4DRH A;  1JVW A;  4LAY A;  5I98 A;  2MNT A;  1FKG A;  3IHZ A;  3TDB A;  1FKF A;  4LAV A;  1N1A A;  2ZQV A;  5DIU A;  1PBK A;  1F8A B;  4O2T A;  3KAF A;  1NSG A;  1ROT A;  1J4I A;  3O5K A;  2XPA A;  1FJD A;  1R9H A;  3JYJ A;  3KCE A;  1C9H A;  2FKE A;  5HWC A;  1EQ3 A;  2DG4 A;  4FN2 A;  4ODL A;  3UI6 A;  2LPV A;  3NI6 A;  2K8I A;  3RFW A;  3KAD A;  3KAG A;  5HW8 A;  1Y0O A;  1ZK6 A;  4C02 B;  4DRK A;  2KO7 A;  4IPX A;  4G2P A;  1D7J A;  1F40 A;  4QT3 A;  5DIT A;  4DZ3 A;  2PBC A;  3PA7 A;  1QPL A;  5HUA A;  1FKH A;  4TX0 A;  3ODK A;  3PRD A;  1FKR A;  3IK8 A;  1ZCN A;  1FD9 A;  4JYS A;  3UI4 A;  3MDY B;  1EYM A;  2PPN A;  3UQB A;  2M1I A;  2RQS A;  2DG9 A;  3O5J A;  5HW7 A;  3GPK A;  4JFK A;  4DH0 A;  4DRM A;  5DIV A;  1BL4 A;  1B6C A;  1YW5 A;  2RUR A;  2ZQU A;  3FAP A;  1PIN A;  3O5G A;  2VCD A;  4ODP A;  4ODK A;  3B7X A;  3UF8 A;  2VN1 A;  1FKL A;  5J6E A;  4J4N A;  1U79 A;  4JFI A;  2M08 A;  4U84 A;  1HXV A;  3EY6 A;  3IKD A;  3O5O A;  5B8I C;  2JZV A;  1M5Y A;  3UI5 A;  2MLY A; 
#chains in the Genus database with same CATH topology
 2V6Z M;  4NRW A;  2JXN A;  1Z5A A;  1QZ2 A;  1J6Y A;  1HKJ A;  4Z2H A;  1VQ1 A;  3B7N A;  1NVM A;  3LVV A;  4LRS A;  3FUV A;  3LW5 F;  3ZQJ A;  1NWT A;  1SR0 A;  3DZD A;  2XP6 A;  1NH6 A;  1HKI A;  4MNM A;  3U6Q A;  3THG A;  2ZBK B;  1ITX A;  1OIZ A;  5EP1 A;  5HWB A;  1HQY E;  5FTK A;  4R0X A;  1ZMU A;  3MJ5 A;  2OLH A;  4JI4 M;  2FE8 A;  2QBY A;  4LF7 M;  2L4E A;  2XP5 A;  1FFQ A;  3NBX X;  4G4R A;  5GPR A;  4IJF A;  3ALF A;  2BNK A;  3W68 A;  1DGG A;  2AWG A;  4REZ A;  3WL1 A;  4MNK A;  1O6I A;  1DGH B;  1J4R A;  5E26 A;  4G4Q A;  4NNR A;  1ZQ9 A;  4LZJ A;  4QOZ C;  4DRH A;  2DXI A;  1FKF A;  2DSW A;  3KAF A;  2W82 A;  2QZ4 A;  1C9H A;  4R5E A;  2N35 A;  3RFW A;  3M6A A;  2L6O A;  2GNO A;  3ARS A;  4M0W A;  2OOA A;  2DG9 A;  3CTW B;  3CHF A;  1NHW C;  1IN6 A;  2R6F A;  5FTL A;  4B7H A;  4PDI A;  3U6O A;  2QQ8 A;  1XHG A;  2MLY A;  2LVA A;  3UMM A;  1IXZ A;  3AL0 C;  4JFJ A;  3OOB A;  1W26 A;  2XP4 A;  3WKZ A;  4FAP A;  4QOS A;  1YSY A;  4NC6 A;  1TF0 B;  4XGI A;  4ZPX A;  1GVN A;  4GRI A;  4IBF A;  2X49 A;  3HKP A;  4Z2G A;  4R3D A;  2DSV A;  3ARY A;  4DV4 M;  2ZAN A;  2Q5A A;  4FWD A;  4LFA M;  1R2Z A;  3K9O A;  4MGV A;  3WHK A;  1DO0 A;  4K0K M;  3AS1 A;  2DSZ A;  3JXV A;  3BXW A;  3T1Y M;  3WD4 A;  3NRK A;  1ZL1 A;  1SXJ A;  2PI6 A;  3IKG A;  4WK9 A;  2HL7 A;  4IBE A;  2OO9 A;  4GIV A;  3V76 A;  1DV0 A;  1EE8 A;  4A3V B;  3U60 B;  1FKG A;  3TDB A;  1V92 A;  3LVW A;  3AKZ A;  3OTO M;  4O2T A;  4I81 A;  3FRH A;  1W5S A;  1N75 A;  3U6C A;  5A2Q S;  1TFV A;  3UI6 A;  3KAD A;  4JI2 M;  1T6O A;  2DNA A;  3SAS A;  1DGF A;  3DA1 A;  3RM9 A;  3L26 A;  2LHG A;  1LQ0 A;  4GIP A;  4L3N A;  3E21 A;  3QYB A;  3VK8 A;  2VN1 A;  5J6E A;  4J4N A;  3QAU A;  3M0E A;  3U61 A;  1NWR A;  3E46 A;  2Z8Y M;  4D81 A;  1NV9 A;  5IRE B;  3TWL A;  5HKG A;  2D7E A;  3KAH A;  4GIT A;  4ODN A;  2ETN A;  1EIJ A;  2LVN C;  2JY7 A;  1VDL A;  2MGW A;  3HHY A;  3O5I A;  1X6L A;  2FNA A;  1QDR A;  2YFQ A;  4LRT A;  4WKA A;  3GPY A;  2OPF A;  3F92 A;  4MPK A;  3O5P A;  2MRO B;  1XNQ M;  2G5G X;  5EP2 A;  4G4N A;  2LVO C;  3RE8 A;  3FTC A;  1RU3 A;  3MMP A;  2CWB A;  5FLX S;  2DSU A;  1FKS A;  3L29 A;  1QYR A;  3GPU A;  2AHM A;  2R0I A;  1G3I A;  2MF9 A;  1H6U A;  3ARR A;  1W1Y A;  2PPO A;  2P4V A;  2JWS A;  3E9S A;  3J7B A;  2VF8 A;  2VII A;  1NY5 A;  2X4A A;  3ARX A;  3WD3 A;  3IEC A;  3VK7 A;  3AV0 A;  2ZTD A;  2B31 A;  3RME A;  1HT1 E;  4B3R M;  2LVQ D;  2DWL A;  2XF3 A;  3EIP A;  1NJG A;  3GLF A;  4AQY M;  1PJJ A;  3CH9 A;  3WQV A;  3A46 A;  2DT3 A;  4PCZ A;  2LWX A;  1EQ3 A;  3KAG A;  1ZV1 A;  1D2N A;  1YE9 A;  2KEB A;  3HU3 A;  2A3E A;  3WHL A;  5F3W A;  4Q22 A;  3PRD A;  2LVP C;  1VG5 A;  5DIV A;  2ZQU A;  3Q8X A;  4QHS A;  1J09 A;  2WLY A;  4AKH A;  4ODM A;  4LJ6 A;  2KR7 A;  5EQT A;  3DOA A;  4DRP A;  2KXE A;  4GH9 A;  1IY0 A;  4DRJ A;  1FKB A;  3IG5 A;  3WH0 A;  3KS8 A;  4NRV A;  3SMS A;  5IT9 S;  3J27 B;  4F2L A;  4KO8 A;  1AIP C;  1S3S A;  3SFZ A;  1WAW A;  2R45 A;  2APL A;  1Q02 A;  1XXH A;  2PN0 A;  3KAB A;  1NMV A;  2ZR4 A;  1QAO A;  4IBI A;  1IBL M;  2KI3 A;  1E94 E;  1YAT A;  1NNU C;  4QZV B;  7CAT A;  1P3Q Q;  2LXE A;  1G41 A;  1T3T A;  1JNS A;  3U6L A;  4DV1 M;  4LZZ A;  1GKI A;  2IF4 A;  1LG2 A;  1K3W A;  1QAM A;  2H1R A;  4FCT A;  4LAX A;  2B3T A;  3U6M A;  3KDS E;  1JVW A;  1Q3C A;  2ZQV A;  4MM3 B;  3KFU G;  4JI0 M;  4ODL A;  2ZTC A;  5FTN A;  2ERC A;  1FFR A;  2KO7 A;  2EA0 A;  4QT3 A;  4DR3 M;  3IK8 A;  3HHX A;  2PPN A;  2K0B X;  2KRU A;  4HL4 A;  1C1K A;  2DVW B;  3TQS A;  1LG1 A;  3ALG A;  2MH8 A;  4MB7 A;  3EY6 A;  2EUC A;  2I7P A;  3CHC A;  3GLF E;  4L8R C;  1JND A;  1ZAE A;  1JCH B;  3TPZ A;  3GLH A;  3VFD A;  3QOK A;  5IZ7 D;  4D82 A;  2DWM A;  1Y8G A;  2DEN A;  2XZU A;  4JYA M;  1D0K A;  3R8F A;  3U6S A;  3JR5 A;  1VEK A;  3KOW E;  1LL7 A;  2Z4S A;  1FNN A;  4LGY A;  3RM8 A;  4QIB A;  2A3C A;  4GKK M;  1NHG C;  2FS1 A;  4L4U A;  1ZBW A;  4I8O A;  2KFW A;  3WIJ A;  1TGU A;  2M2A A;  4I5S A;  3HJ8 A;  4FW9 A;  4DT4 A;  3RGS A;  2LHC A;  3GLI A;  3JR4 A;  4MGY E;  1W1P A;  3KAI A;  2LKN A;  4LJA A;  1NWS A;  4NL4 H;  4GHA A;  4Q7N A;  3VAW A;  4Z2I A;  3TE6 A;  1Q6U A;  2DG3 A;  2YBU A;  2DKL A;  2O25 A;  4UN2 B;  3IHZ A;  3CF0 A;  3NBI A;  4JI5 M;  1PBK A;  1XXH E;  5KQ8 A;  2NQ8 C;  4DWS A;  1J4I A;  3PVS A;  4BB9 A;  1K82 A;  1HNX M;  3HGI A;  2K6B A;  1W9U A;  5JI3 E;  4DR7 M;  3L28 A;  5HBF A;  4DZ3 A;  4AKI A;  5HUA A;  4IBJ A;  4M9Z A;  1QZE A;  2UXB M;  3GLG E;  1BVS A;  4LGX A;  4LJ7 A;  3ILK A;  3RGP A;  2BJV A;  4X64 M;  1EIB A;  1DGH A;  3C58 A;  1WIV A;  3UZU A;  4HAR A;  5KO3 A;  3O5O A;  3J80 S;  2LBC A;  1M5Y A;  2XSZ D;  3O5R A;  1HJP A;  3FXY A;  2WSE F;  4G3O A;  2FOI C;  2CV2 A;  5EP3 A;  3T6P A;  2ZQS A;  1QZM A;  4MNL A;  1OGG A;  4S3K A;  3QYE A;  3FD9 A;  2Z7J A;  1HKM A;  4JI6 M;  1IBK M;  3FTD A;  5GQB A;  4LJ9 A;  4TNS A;  3KAC A;  2DAI A;  3HX3 A;  2KE0 A;  2FDM A;  4MGK E;  1GAB A;  3K92 A;  1L1P A;  2DWZ B;  1N78 A;  2R65 A;  3GLH E;  1PGY A;  4DR6 M;  4IBC A;  3GPP A;  4DV7 M;  2C9O A;  2QEN A;  1Z5C A;  3JYM A;  1WNO A;  3VKH A;  1L2C A;  5EP4 A;  1H0I A;  2KW0 A;  3PFI A;  2OOB A;  3H9R B;  4DUZ M;  3HU2 A;  2F4E A;  2AOS A;  3O5M A;  4LF8 M;  2XP7 A;  3VDP A;  4GHL A;  3I4V A;  2DAM A;  1GJT A;  1NSG A;  1ORY B;  2RRU A;  5EXS A;  1CUK A;  5HWC A;  2QNJ A;  4GMQ A;  3GLI E;  1N32 M;  1J7K A;  1NV8 A;  4DRK A;  2VQF M;  4LFB M;  1UR9 A;  3UQB A;  2B5U B;  1IQP A;  4DRM A;  2RKO A;  1XC8 A;  3UF8 A;  2KRK A;  1AUA A;  4U84 A;  3HHW A;  3U60 A;  1E6R A;  1W9P A;  3O5L A;  3PXG A;  4GEW A;  2UUC M;  3MK6 A;  2R4J A;  3GRY A;  2KGJ A;  2XP8 A;  3WD0 A;  4W5W A;  1GJS A;  1PJI A;  5KPZ A;  4GC5 A;  1NMW A;  4DRQ A;  3W67 A;  4XBO A;  2MPH A;  1JNT A;  1HNW M;  5FTJ A;  1HQC A;  3I6C A;  1KYI A;  3AS3 A;  4ITZ A;  2M60 A;  2KNZ A;  2DT1 A;  3UJN A;  4ODO A;  3J7A S;  1QPF A;  4HLQ A;  4OX9 M;  3W4R A;  4S3J A;  1C7Y A;  1PJT A;  3GPX A;  1XMO M;  1Q6H A;  3SHG B;  1EFU B;  4W9P A;  1GRJ A;  1XHB A;  1FKK A;  4DIP A;  2HAK A;  1R6B X;  1T11 A;  2C99 A;  3B9D A;  1IXS A;  3Q8G A;  1F8A B;  3KXE C;  1ROT A;  4QNR A;  3JYJ A;  2KA6 B;  1HNZ M;  2G8Z A;  2DG4 A;  4B08 A;  3NI6 A;  2K8I A;  1N36 M;  4I4L A;  3W0F A;  2DT0 A;  2WZJ A;  3ZCB B;  1MJG M;  3FUX A;  2M5Z A;  4OVZ B;  3K9P A;  2Y0Q A;  4MNJ A;  1UM8 A;  4Z2J A;  1JQJ C;  3AS2 A;  1D0M A;  1PIN A;  4ODP A;  1Q3B A;  1OFI A;  4JFI A;  1JB0 F;  4KHP M;  3SYL A;  1RD6 A;  1E44 A;  2Y21 A;  5ITY A;  1L2B A;  3K2L A;  2JY6 B;  4RNA A;  3RGC A;  1V33 A;  3ARZ A;  4TW7 A;  2UZ5 A;  2XP3 A;  2WLZ A;  4LCB A;  1P5Q A;  3HHZ A;  4DR5 M;  2L7H A;  4OU7 A;  3J81 S;  1QUS A;  4DV6 M;  3U5Z A;  1FKT A;  2QPA A;  2R46 A;  1W1V A;  4ODQ A;  2CHV A;  1ZBK A;  2H5X A;  2FH0 A;  4URI A;  1QAQ A;  2X8A A;  3KOY E;  1G4A E;  2CHG A;  2JY8 A;  4LF4 M;  2XFS A;  5IWA M;  1F4I A;  2KNA A;  2J5Y A;  2FAP A;  4AG5 A;  4DV5 M;  1KT0 A;  1D2K A;  4IBK A;  3KP1 E;  4BBA A;  1ZB5 A;  2ZAO A;  3WL0 A;  1XNR M;  3R9X B;  2C9C A;  1NSF A;  3KOX E;  3KVW A;  1W9V A;  3O5K A;  3KCE A;  4Q7J A;  3IHP A;  4ANR A;  3BMB A;  3PR9 A;  3L2A A;  1Q39 A;  5DIT A;  3H4J A;  3TWM A;  4Y28 F;  1TR8 A;  5HW7 A;  1WJ7 A;  5ITR A;  4NSO B;  1BL4 A;  2O5R A;  3GO8 A;  2DZO B;  3FAP A;  8CAT A;  4ODK A;  2GQF A;  5ITT A;  2JNH A;  1MU5 A;  1G71 A;  1OIP A;  3SMP A;  1OQY A;  3AFH A;  2A5Y B;  1IBM M;  1SG9 A;  2A3B A;  4RKU F;  4ITQ A;  3VLF B;  5JI2 E;  1L1T A;  3CF2 A;  1FJG M;  1CTN A;  3L27 A;  2MLX A;  4IQ2 A;  1SXJ E;  4HBO A;  3SAV A;  2CE7 A;  3LCU A;  2LGO A;  1BKF A;  2ZQT A;  2F21 A;  3C3D A;  2R44 A;  2L09 A;  3HJS A;  3U61 B;  4G4O A;  2J7N A;  3O5E A;  2DWN A;  2N87 A;  3SYK A;  4BF8 A;  5KPT A;  5D75 A;  5DO2 A;  1OAI A;  1LL6 A;  5EXP A;  2O01 F;  2UUA M;  3PNY A;  2MJ5 B;  3SAT A;  4HBE A;  2PPP A;  3B9A A;  1N34 M;  4R71 A;  3GTY X;  1R2Y A;  3FTE A;  2L7I A;  4WIW A;  2D7G A;  4M9X A;  3SBJ A;  1XMQ M;  1QQW A;  4MAV A;  1HT2 E;  5ITX A;  4LG2 A;  1K9T A;  3SAW A;  4LY6 A;  3RM4 A;  1TH4 A;  2JP7 A;  2Z4R A;  4AW4 A;  1E9S A;  2XZF A;  2UUB M;  1YW5 A;  1LTM A;  5DYI A;  3B7X A;  1GPF A;  1XB2 B;  4ZPW R;  5DYG A;  3ARW A;  3SHF A;  1WB0 A;  4KR0 B;  2YQZ A;  5JH8 A;  1A7X A;  4LGM A;  4MSP A;  2YR0 A;  2ZAM A;  2CP8 A;  4FCV A;  4B3S M;  1HJX A;  4TUW A;  1FKD A;  2ZR6 A;  2EKK A;  3VKG A;  2HHH M;  4LJ8 A;  3KW6 A;  1VDD A;  2XP9 A;  2C98 A;  2WSF F;  2BWB A;  2D7H A;  4LFC M;  2ITK A;  3HZJ A;  4IQC A;  4UDM A;  4DZ2 A;  2UXC M;  4N19 A;  4TW6 A;  2L4F A;  3FUW A;  3B7Q A;  4X66 M;  1TCO C;  1NO1 A;  4AY1 A;  5C1B A;  2Y78 A;  1QDT A;  1L8Q A;  3D8L A;  3O5D A;  4TW8 A;  2EUL A;  4XAK A;  5EXT A;  2RGH A;  4MGI E;  3B74 A;  4WP2 A;  4M0D A;  2XPA A;  4DWS D;  3LQQ A;  4XK8 F;  3K1J A;  3GQ5 A;  4L16 A;  3B8S A;  1QPL A;  3ODK A;  2O9O A;  1GLN A;  2G8L A;  3GLG B;  4JI1 M;  3ARO A;  2RQS A;  1OAO C;  4DH0 A;  4IT6 A;  4JV5 M;  3BBZ A;  4RF1 A;  1X6N A;  1JR3 A;  2IUZ A;  1E32 A;  2HKJ A;  4Z6Y A;  1A5T A;  4B3M M;  4AI6 A;  4QT2 A;  3SC3 A;  1Q6I A;  3KP0 E;  1YUB A;  5ITX E;  1UFZ A;  1HKK A;  4QNM A;  3U6D A;  4DV3 M;  4JN6 A;  2C96 A;  1ROU A;  2QHO B;  2DAK A;  3CGM A;  4Z2L A;  1XRV A;  3U6P A;  5FSW A;  4PTM A;  3A98 B;  2V1U A;  1TH2 A;  4DUY M;  4W5U A;  3ARV A;  3D8B A;  4PDG A;  3O5Q A;  1R4G A;  1IX5 A;  3IG8 A;  3GLH B;  1FAP A;  1PRB A;  4NOO B;  3GRU A;  4DV2 M;  1NNJ A;  4G50 A;  3GU0 A;  5GPG A;  3I4Y A;  3GP1 A;  2MNT A;  1MX0 A;  2DAG A;  1IN4 A;  4IT4 A;  1QUT A;  5BPV A;  1R9H A;  1G59 A;  3FYD A;  3GLI B;  2EJS A;  1ZK6 A;  1D7J A;  1E9R A;  1R7R A;  4FWG A;  2C5R A;  2L2D A;  4JYS A;  2M1I A;  3HWS A;  3T38 A;  3FUU A;  4LJ4 A;  4DV0 M;  3BOS A;  2DHR A;  3LQR A;  3O5G A;  3I51 A;  4P17 A;  1FKL A;  2F5S A;  1HXV A;  1TTE A;  4ML4 A;  5BR8 M;  4DWS B;  3LUO A;  3M7G A;  4RF0 A;  4MH0 E;  1ZBC A;  2YBT A;  2R4E A;  2XGN A;  2KNV A;  3TL4 X;  2DZN B;  5DFL A;  3B89 A;  4GGQ A;  1GO5 A;  2RSE A;  1K3X A;  2CFO A;  2F4V M;  3ARQ A;  3UQA A;  4LJ5 A;  3NWL A;  2MR9 A;  1SYT A;  3FUT A;  4TYO A;  2FFJ A;  4W9O A;  1ZU8 A;  1WGL A;  4OVZ A;  3L25 A;  1JR3 E;  3NTP A;  3FRI A;  4NSR A;  4P16 A;  2QP9 X;  3WD2 A;  3T1H M;  4LF6 M;  1D7H A;  1GL6 A;  4LAW A;  2JZ0 A;  1KFV A;  4FVM A;  1T43 A;  3ZC7 B;  4MTV A;  2JUJ A;  1GUV A;  2CUZ A;  2HWJ A;  2VDB B;  1QAN A;  4WKF A;  3GQ4 A;  3A45 A;  2VF7 A;  3KSJ A;  5KPR A;  1Z6T A;  1TH3 A;  1OWQ A;  2LTU A;  1ZMV A;  5ITQ A;  3K8Z A;  4P8X A;  1FJD A;  3A42 A;  4CGY B;  4IJE A;  2F5O A;  1Y0O A;  1G8P A;  1ZBV A;  3EIE A;  1SXJ D;  1X37 A;  3UGJ A;  2DZL A;  1E15 A;  1TDH A;  1EYM A;  5KQD A;  3FTF A;  4ZS6 A;  1L2D A;  2J7O A;  3MHV C;  2RUR A;  3FYC A;  1OKS A;  4B3T M;  3HY5 A;  3KSX A;  1L1Z A;  3LCV B;  2WM0 A;  2QBY B;  4AG6 A;  1VEG A;  3FY1 A;  2G3Q A;  1VF8 A;  1OGB A;  2I7N A;  1FKJ A;  5HW6 A;  1WHC A;  1J5E M;  5H37 D;  4JI8 M;  2Y0T A;  1NY6 A;  1D7I A;  3J2P B;  4LF5 M;  2XLJ A;  1LJY A;  1MN3 A;  4X62 M;  2RUC A;  2XH9 A;  1IXR C;  4U85 A;  1OTR A;  3B9E A;  1KT1 A;  4B7G A;  3SAU A;  1IFY A;  4OW0 A;  3DFZ A;  1W1T A;  1IN5 A;  4KLN A;  2K9D A;  4B7F A;  2UU9 M;  3PRA A;  2F5Q A;  3KOZ E;  1OFH A;  1UR8 A;  4F1I A;  5EXX A;  2XFT A;  4IBD A;  4DWS C;  4HEO A;  1D6O A;  5EJC A;  2XPB A;  5DEZ A;  2RUQ A;  1IY2 A;  3LMM A;  1LV7 A;  5HTG A;  3AOE C;  4DR4 M;  4LAY A;  4X65 M;  4NSB A;  2YNM D;  1NJF A;  2CV1 A;  4KQZ A;  1Z5B A;  2A3A A;  4FN2 A;  3U6E A;  1IN8 A;  4DBG B;  4WJX A;  2KHH A;  2CV0 A;  4WKH A;  4QHT A;  4TX0 A;  4WUR A;  5C18 A;  1YLA A;  3UI4 A;  1WR1 B;  4CIZ A;  4PT5 A;  4IBG A;  5GKN A;  1B6C A;  1N77 A;  3GRR A;  2VCD A;  1EHN A;  1JNE A;  4YY3 M;  4G6Z A;  3FE3 A;  1IXS B;  3UI5 A;  4DRI A;  2PV2 A;  1DO2 A;  3OA5 A;  2QF8 A;  3TCZ A;  4FD2 A;  3GQ3 A;  3AOG A;  4AKG A;  3B7Z A;  4ZPV R;  1V34 A;  2F5P A;  1SXJ B;  4L72 B;  2E5L M;  4MGH A;  1IN7 A;  2Q2E B;  1Z59 A;  2CRU A;  2LNH C;  4II7 A;  3O5F A;  2R18 A;  1PJS A;  3CHD A;  3CGN A;  3EIH A;  2G41 A;  1DGB A;  3CGW A;  2WSC F;  1Q1C A;  3CF6 E;  3KS4 A;  4P8U A;  4J4O A;  3ART A;  2D9F A;  5FTM A;  2BJW A;  2LH0 A;  4ODR A;  4P8W A;  4U86 A;  1I4W A;  4JFL A;  1E6P A;  3G6M A;  1I94 M;  3U5Z B;  3HU1 A;  4LAV A;  4ZPT R;  3ZH9 B;  2FKE A;  2JY5 A;  1E6N A;  4G2P A;  2PBC A;  2O92 A;  1FKH A;  4NXM M;  1FKR A;  3G6L A;  1IM2 A;  1E6Z A;  1FD9 A;  3MDY B;  1R5L A;  4NXN M;  2ZM6 M;  2DHY A;  3E4R A;  3PNV A;  2M08 A;  1E9L A;  4LF9 M;  4IBB A;  2L2S A;  4CJ6 A;  4R7G A;  2KDL A;  2CHQ A;  2PV1 A;  2ZR5 A;  3UK6 A;  3TC5 A;  5DF0 A;  5BXJ A;  2K47 A;  4D80 A;  3PRB A;  1WGN A;  1KFW A;  2KZS A;  4L15 A;  2OFN A;  4WW0 A;  2ESC A;  4P8V A;  4CHT B;  4AZF A;  4JI3 M;  1VEJ A;  3GLG A;  5LMN M;  2JA2 A;  4KT0 F;  3GLF B;  4BLC A;  2PV3 A;  3AJI B;  3UQI A;  3AQU A;  3TWK A;  1LL4 A;  4JFM A;  4JI7 M;  2R62 A;  1J4H A;  4DRO A;  1FKI A;  3AS0 A;  2QSF X;  4NZC A;  1SXJ C;  5DNY A;  5HT1 A;  5I98 A;  4CIS A;  3WQW A;  2DI0 A;  3SAR A;  4Z8X A;  3ARU A;  3HJQ A;  5HW8 A;  5LMU M;  4C02 B;  2BWE A;  5L8R F;  3PA7 A;  3QWL A;  1TDZ A;  3GRV A;  3O5J A;  4JFK A;  3VDU A;  4FCW A;  1XXH B;  4S12 A;  2RGO A;  1JR3 D;  1U79 A;  4EIW A;  1NWU A;  4PD2 A;  2XEP A;  1IY1 A;  1W5T A;  4M9S A;  2VQE M;  4L6V 6;  3W0L B;  3KZ7 A;  3T15 A;  2QCU A;  2P5T A;  2DAE A;  1KSF X;  3CHE A;  1HJW A;  2V1C A;  4GKJ M;  2JZ1 A;  2HCB A;  1N33 M;  3C9P A;  3FKE A;  1GL7 A;  2Z3X A;  2MLZ A;  2F2D A;  1PM5 A;  4DR1 M;  2KZU A;  2EKF A;  5E6J A;  1D0L A;  4GC9 A;  1PJQ A;  4KOD A;  4L78 A;  1HR0 M;  4W9Q A;  1ZMW A;  1XWI A;  2EO2 A;  1GOI A;  2OQ4 A;  2RUD A;  3AOE A;  5ITU A;  4JXJ A;  4DRN A;  2LJ4 A;  4DR2 M;  2CEA A;  2DT2 A;  3I04 M;  1N1A A;  5DIU A;  2UXD M;  1OJL A;  1EDQ A;  2F5N A;  4Z2K A;  4MGZ E;  3WD1 A;  2LPV A;  3JAM S;  4IPX A;  3B9P A;  3CZ8 A;  1F40 A;  2DPE A;  2F23 A;  2Y20 A;  3I01 M;  3ARP A;  1ZCN A;  1QVR A;  1HJV A;  3H4M A;  3GPK A;  4YHH M;  2WK2 A;  4FWH A;  1H0G A;  3C3E A;  4IIW A;  1WXQ A;  3IKD A;  5B8I C;  2JZV A;  2XSZ A; 
#chains in the Genus database with same CATH homology
 2V6Z M;  4NRW A;  1Z5A A;  1QZ2 A;  1J6Y A;  1HKJ A;  4Z2H A;  1NVM A;  3LVV A;  4LRS A;  3FUV A;  1NWT A;  1SR0 A;  3DZD A;  2XP6 A;  1NH6 A;  1HKI A;  4MNM A;  3U6Q A;  3THG A;  2ZBK B;  1ITX A;  5EP1 A;  5HWB A;  1HQY E;  5FTK A;  4R0X A;  3MJ5 A;  2OLH A;  4JI4 M;  2FE8 A;  2QBY A;  4LF7 M;  2XP5 A;  1FFQ A;  4G4R A;  5GPR A;  4IJF A;  3ALF A;  2BNK A;  1DGG A;  2AWG A;  4REZ A;  3WL1 A;  4MNK A;  1O6I A;  1DGH B;  1J4R A;  5E26 A;  4G4Q A;  4NNR A;  1ZQ9 A;  4LZJ A;  4QOZ C;  4DRH A;  2DXI A;  1FKF A;  2DSW A;  3KAF A;  2W82 A;  2QZ4 A;  1C9H A;  4R5E A;  3RFW A;  3M6A A;  2L6O A;  3ARS A;  4M0W A;  2DG9 A;  3CTW B;  3CHF A;  1NHW C;  1IN6 A;  5FTL A;  4B7H A;  4PDI A;  3U6O A;  1XHG A;  2MLY A;  3UMM A;  1IXZ A;  3AL0 C;  4JFJ A;  3OOB A;  1W26 A;  2XP4 A;  3WKZ A;  4FAP A;  4QOS A;  1YSY A;  4XGI A;  4ZPX A;  1GVN A;  4GRI A;  4IBF A;  2X49 A;  3HKP A;  4Z2G A;  4R3D A;  2DSV A;  3ARY A;  4DV4 M;  2ZAN A;  2Q5A A;  4FWD A;  4LFA M;  1R2Z A;  4MGV A;  3WHK A;  1DO0 A;  4K0K M;  3AS1 A;  2DSZ A;  3JXV A;  3BXW A;  3T1Y M;  3WD4 A;  3NRK A;  1ZL1 A;  1SXJ A;  2PI6 A;  3IKG A;  4WK9 A;  2HL7 A;  4IBE A;  4GIV A;  1EE8 A;  4A3V B;  3U60 B;  1FKG A;  3TDB A;  3LVW A;  3AKZ A;  3OTO M;  4O2T A;  4I81 A;  1W5S A;  1N75 A;  3U6C A;  5A2Q S;  1TFV A;  3UI6 A;  3KAD A;  4JI2 M;  3SAS A;  1DGF A;  3DA1 A;  3RM9 A;  3L26 A;  1LQ0 A;  4GIP A;  4L3N A;  3VK8 A;  2VN1 A;  5J6E A;  4J4N A;  3QAU A;  3M0E A;  3U61 A;  1NWR A;  4D81 A;  5IRE B;  3TWL A;  5HKG A;  2D7E A;  3KAH A;  4GIT A;  4ODN A;  3HHY A;  3O5I A;  1X6L A;  2FNA A;  2YFQ A;  4LRT A;  4WKA A;  3GPY A;  2OPF A;  4MPK A;  3O5P A;  1XNQ M;  2G5G X;  5EP2 A;  4G4N A;  3RE8 A;  3FTC A;  5FLX S;  2DSU A;  1FKS A;  3L29 A;  1QYR A;  3GPU A;  2AHM A;  1G3I A;  2MF9 A;  1H6U A;  3ARR A;  1W1Y A;  2PPO A;  3J7B A;  3E9S A;  2VII A;  1NY5 A;  2X4A A;  3ARX A;  3WD3 A;  3VK7 A;  3AV0 A;  2B31 A;  3RME A;  1HT1 E;  4B3R M;  2DWL A;  2XF3 A;  1NJG A;  3GLF A;  4AQY M;  1PJJ A;  3CH9 A;  3WQV A;  3A46 A;  2DT3 A;  4PCZ A;  2LWX A;  1EQ3 A;  3KAG A;  1D2N A;  1YE9 A;  2KEB A;  3HU3 A;  2A3E A;  3WHL A;  5F3W A;  4Q22 A;  3PRD A;  5DIV A;  2ZQU A;  3Q8X A;  4QHS A;  1J09 A;  2WLY A;  4AKH A;  4ODM A;  4LJ6 A;  2KR7 A;  5EQT A;  3DOA A;  4DRP A;  2KXE A;  4GH9 A;  1IY0 A;  4DRJ A;  1FKB A;  3IG5 A;  3WH0 A;  3KS8 A;  4NRV A;  3SMS A;  5IT9 S;  3J27 B;  4KO8 A;  3SFZ A;  1S3S A;  1WAW A;  2R45 A;  1XXH A;  3KAB A;  1NMV A;  2ZR4 A;  1QAO A;  4IBI A;  1IBL M;  2KI3 A;  1E94 E;  1YAT A;  1NNU C;  4QZV B;  7CAT A;  2LXE A;  1G41 A;  1T3T A;  1JNS A;  3U6L A;  4DV1 M;  4LZZ A;  1GKI A;  2IF4 A;  1LG2 A;  1K3W A;  1QAM A;  2H1R A;  4FCT A;  4LAX A;  3U6M A;  3KDS E;  1JVW A;  1Q3C A;  2ZQV A;  4MM3 B;  3KFU G;  4JI0 M;  4ODL A;  5FTN A;  2ERC A;  1FFR A;  2KO7 A;  2EA0 A;  4QT3 A;  4DR3 M;  3IK8 A;  3HHX A;  2PPN A;  2KRU A;  4HL4 A;  1C1K A;  2DVW B;  3TQS A;  1LG1 A;  3ALG A;  4MB7 A;  3EY6 A;  2EUC A;  2I7P A;  3CHC A;  4L8R C;  1JND A;  1ZAE A;  3TPZ A;  3GLH A;  3VFD A;  3QOK A;  5IZ7 D;  4D82 A;  2DWM A;  2XZU A;  4JYA M;  3R8F A;  3U6S A;  3JR5 A;  3KOW E;  1LL7 A;  2Z4S A;  1FNN A;  4LGY A;  3RM8 A;  4QIB A;  2A3C A;  4GKK M;  1NHG C;  4L4U A;  1ZBW A;  4I8O A;  2KFW A;  3WIJ A;  1TGU A;  2M2A A;  4I5S A;  3HJ8 A;  4FW9 A;  4DT4 A;  3RGS A;  3GLI A;  3JR4 A;  4MGY E;  1W1P A;  3KAI A;  2LKN A;  4LJA A;  1NWS A;  4NL4 H;  4GHA A;  4Q7N A;  3VAW A;  4Z2I A;  3TE6 A;  1Q6U A;  2DG3 A;  2YBU A;  3IHZ A;  3CF0 A;  3NBI A;  4JI5 M;  1PBK A;  5KQ8 A;  2NQ8 C;  4DWS A;  1J4I A;  3PVS A;  4BB9 A;  1K82 A;  1HNX M;  3HGI A;  1W9U A;  5JI3 E;  4DR7 M;  3L28 A;  5HBF A;  4DZ3 A;  4AKI A;  5HUA A;  4IBJ A;  4M9Z A;  2UXB M;  4LGX A;  4LJ7 A;  3ILK A;  3RGP A;  2BJV A;  4X64 M;  1EIB A;  1DGH A;  3C58 A;  3UZU A;  4HAR A;  5KO3 A;  3O5O A;  3J80 S;  1M5Y A;  2XSZ D;  3O5R A;  3FXY A;  2FOI C;  2CV2 A;  5EP3 A;  2ZQS A;  1QZM A;  4MNL A;  1OGG A;  4S3K A;  3FD9 A;  2Z7J A;  1HKM A;  4JI6 M;  1IBK M;  3FTD A;  5GQB A;  4LJ9 A;  4TNS A;  3KAC A;  2KE0 A;  2FDM A;  4MGK E;  3K92 A;  1L1P A;  2DWZ B;  1N78 A;  2R65 A;  4DR6 M;  4IBC A;  3GPP A;  4DV7 M;  2C9O A;  2QEN A;  1Z5C A;  3JYM A;  1WNO A;  3VKH A;  1L2C A;  5EP4 A;  1H0I A;  2KW0 A;  3PFI A;  3H9R B;  4DUZ M;  3HU2 A;  2F4E A;  2AOS A;  3O5M A;  4LF8 M;  2XP7 A;  3VDP A;  4GHL A;  3I4V A;  1NSG A;  1ORY B;  5EXS A;  5HWC A;  4GMQ A;  1N32 M;  1J7K A;  4DRK A;  2VQF M;  4LFB M;  1UR9 A;  3UQB A;  1IQP A;  4DRM A;  2RKO A;  1XC8 A;  3UF8 A;  2KRK A;  4U84 A;  3HHW A;  3U60 A;  1E6R A;  1W9P A;  3O5L A;  3PXG A;  2UUC M;  3MK6 A;  2R4J A;  3GRY A;  2KGJ A;  2XP8 A;  3WD0 A;  4W5W A;  1PJI A;  5KPZ A;  4GC5 A;  4DRQ A;  1NMW A;  4XBO A;  2MPH A;  1JNT A;  1HNW M;  5FTJ A;  1HQC A;  3I6C A;  1KYI A;  3AS3 A;  4ITZ A;  2M60 A;  2DT1 A;  3UJN A;  4ODO A;  3J7A S;  1QPF A;  4HLQ A;  4OX9 M;  3W4R A;  4S3J A;  3GPX A;  1XMO M;  1Q6H A;  3SHG B;  4W9P A;  1XHB A;  1FKK A;  4DIP A;  1R6B X;  1T11 A;  2C99 A;  3B9D A;  1F8A B;  3KXE C;  1ROT A;  4QNR A;  3JYJ A;  2KA6 B;  1HNZ M;  2G8Z A;  2DG4 A;  4B08 A;  3NI6 A;  2K8I A;  1N36 M;  4I4L A;  3W0F A;  2DT0 A;  3ZCB B;  3FUX A;  2M5Z A;  4OVZ B;  2Y0Q A;  4MNJ A;  1UM8 A;  4Z2J A;  1JQJ C;  3AS2 A;  1PIN A;  4ODP A;  1Q3B A;  1OFI A;  4JFI A;  4KHP M;  3SYL A;  1RD6 A;  2Y21 A;  5ITY A;  1L2B A;  3K2L A;  4RNA A;  3RGC A;  3ARZ A;  4TW7 A;  2UZ5 A;  2XP3 A;  2WLZ A;  4LCB A;  1P5Q A;  3HHZ A;  4DR5 M;  2L7H A;  4OU7 A;  3J81 S;  4DV6 M;  3U5Z A;  1FKT A;  2QPA A;  2R46 A;  1W1V A;  4ODQ A;  2CHV A;  1ZBK A;  4URI A;  1QAQ A;  2X8A A;  3KOY E;  1G4A E;  2CHG A;  4LF4 M;  2XFS A;  5IWA M;  2FAP A;  4AG5 A;  4DV5 M;  1KT0 A;  1D2K A;  4IBK A;  3KP1 E;  4BBA A;  1ZB5 A;  2ZAO A;  3WL0 A;  1XNR M;  3R9X B;  2C9C A;  1NSF A;  3KOX E;  3KVW A;  1W9V A;  3O5K A;  3KCE A;  3PR9 A;  3L2A A;  1Q39 A;  5DIT A;  3TWM A;  5HW7 A;  5ITR A;  4NSO B;  1BL4 A;  2O5R A;  3GO8 A;  2DZO B;  3FAP A;  8CAT A;  4ODK A;  5ITT A;  1MU5 A;  3SMP A;  3AFH A;  2A5Y B;  1IBM M;  2A3B A;  4ITQ A;  3VLF B;  5JI2 E;  1L1T A;  3CF2 A;  1FJG M;  1CTN A;  3L27 A;  2MLX A;  4IQ2 A;  1SXJ E;  4HBO A;  3SAV A;  2CE7 A;  2LGO A;  1BKF A;  2ZQT A;  2F21 A;  2L09 A;  3HJS A;  3U61 B;  4G4O A;  2J7N A;  3O5E A;  2DWN A;  2N87 A;  3SYK A;  4BF8 A;  5KPT A;  5D75 A;  5DO2 A;  1LL6 A;  5EXP A;  2UUA M;  3PNY A;  3SAT A;  4HBE A;  2PPP A;  3B9A A;  1N34 M;  1R2Y A;  3FTE A;  2L7I A;  4WIW A;  2D7G A;  4M9X A;  3SBJ A;  1XMQ M;  1QQW A;  4MAV A;  1HT2 E;  5ITX A;  4LG2 A;  1K9T A;  3SAW A;  4LY6 A;  3RM4 A;  1TH4 A;  2Z4R A;  4AW4 A;  1E9S A;  2XZF A;  2UUB M;  1YW5 A;  5DYI A;  3B7X A;  1GPF A;  4ZPW R;  5DYG A;  3ARW A;  3SHF A;  1WB0 A;  4KR0 B;  2YQZ A;  5JH8 A;  1A7X A;  4LGM A;  4MSP A;  2YR0 A;  2ZAM A;  4FCV A;  4B3S M;  1HJX A;  4TUW A;  1FKD A;  2ZR6 A;  3VKG A;  2HHH M;  4LJ8 A;  3KW6 A;  1VDD A;  2XP9 A;  2C98 A;  2D7H A;  4LFC M;  2ITK A;  4IQC A;  4DZ2 A;  2UXC M;  4N19 A;  4TW6 A;  3FUW A;  4X66 M;  1TCO C;  4AY1 A;  5C1B A;  2Y78 A;  1L8Q A;  3D8L A;  3O5D A;  4TW8 A;  4XAK A;  5EXT A;  2RGH A;  4MGI E;  4M0D A;  2XPA A;  4DWS D;  3LQQ A;  3K1J A;  3GQ5 A;  4L16 A;  3B8S A;  1QPL A;  3ODK A;  2O9O A;  1GLN A;  2G8L A;  3GLG B;  4JI1 M;  3ARO A;  2RQS A;  4DH0 A;  4IT6 A;  4JV5 M;  4RF1 A;  1X6N A;  1JR3 A;  2IUZ A;  1E32 A;  2HKJ A;  4Z6Y A;  4B3M M;  4AI6 A;  4QT2 A;  3SC3 A;  1Q6I A;  3KP0 E;  1YUB A;  5ITX E;  1HKK A;  4QNM A;  3U6D A;  4DV3 M;  4JN6 A;  2C96 A;  1ROU A;  3CGM A;  4Z2L A;  1XRV A;  3U6P A;  5FSW A;  4PTM A;  3A98 B;  2V1U A;  1TH2 A;  4DUY M;  4W5U A;  3ARV A;  3D8B A;  4PDG A;  3O5Q A;  1IX5 A;  3IG8 A;  3GLH B;  1FAP A;  4NOO B;  3GRU A;  4DV2 M;  1NNJ A;  4G50 A;  5GPG A;  3I4Y A;  3GP1 A;  2MNT A;  1MX0 A;  1IN4 A;  4IT4 A;  5BPV A;  1R9H A;  1G59 A;  3FYD A;  3GLI B;  1ZK6 A;  1D7J A;  1E9R A;  1R7R A;  4FWG A;  2C5R A;  4JYS A;  2M1I A;  3HWS A;  3T38 A;  3FUU A;  4LJ4 A;  4DV0 M;  3BOS A;  2DHR A;  3LQR A;  3O5G A;  3I51 A;  1FKL A;  2F5S A;  1HXV A;  4ML4 A;  5BR8 M;  4DWS B;  3LUO A;  3M7G A;  4RF0 A;  4MH0 E;  1ZBC A;  2YBT A;  2R4E A;  2XGN A;  3TL4 X;  2DZN B;  4GGQ A;  2RSE A;  1K3X A;  2CFO A;  2F4V M;  3ARQ A;  3UQA A;  4LJ5 A;  3NWL A;  1SYT A;  3FUT A;  4TYO A;  2FFJ A;  4W9O A;  1ZU8 A;  4OVZ A;  3L25 A;  3NTP A;  4NSR A;  4P16 A;  2QP9 X;  3WD2 A;  3T1H M;  4LF6 M;  1D7H A;  1GL6 A;  4LAW A;  1KFV A;  4FVM A;  3ZC7 B;  4MTV A;  1GUV A;  2CUZ A;  1QAN A;  4WKF A;  3GQ4 A;  3A45 A;  3KSJ A;  5KPR A;  1Z6T A;  1TH3 A;  1OWQ A;  5ITQ A;  3K8Z A;  4P8X A;  1FJD A;  3A42 A;  4CGY B;  4IJE A;  2F5O A;  1Y0O A;  1G8P A;  1ZBV A;  3EIE A;  1SXJ D;  1X37 A;  3UGJ A;  1E15 A;  1TDH A;  1EYM A;  5KQD A;  3FTF A;  4ZS6 A;  1L2D A;  2J7O A;  3MHV C;  2RUR A;  3FYC A;  4B3T M;  3KSX A;  1L1Z A;  2WM0 A;  2QBY B;  4AG6 A;  3FY1 A;  1VF8 A;  1OGB A;  2I7N A;  1FKJ A;  5HW6 A;  1J5E M;  5H37 D;  4JI8 M;  2Y0T A;  1NY6 A;  1D7I A;  3J2P B;  4LF5 M;  2XLJ A;  1LJY A;  4X62 M;  2RUC A;  2XH9 A;  1IXR C;  4U85 A;  3B9E A;  1KT1 A;  4B7G A;  3SAU A;  4OW0 A;  3DFZ A;  1W1T A;  1IN5 A;  4KLN A;  4B7F A;  2UU9 M;  3PRA A;  2F5Q A;  3KOZ E;  1OFH A;  1UR8 A;  5EXX A;  2XFT A;  4IBD A;  4DWS C;  1D6O A;  5EJC A;  2XPB A;  5DEZ A;  2RUQ A;  1IY2 A;  3LMM A;  1LV7 A;  5HTG A;  3AOE C;  4DR4 M;  4LAY A;  4X65 M;  4NSB A;  2YNM D;  1NJF A;  2CV1 A;  4KQZ A;  1Z5B A;  2A3A A;  4FN2 A;  3U6E A;  1IN8 A;  4WJX A;  2CV0 A;  4WKH A;  4QHT A;  4TX0 A;  4WUR A;  5C18 A;  3UI4 A;  4PT5 A;  4IBG A;  5GKN A;  1B6C A;  1N77 A;  3GRR A;  2VCD A;  1EHN A;  1JNE A;  4YY3 M;  4G6Z A;  1IXS B;  3UI5 A;  4DRI A;  2PV2 A;  1DO2 A;  3OA5 A;  2QF8 A;  3TCZ A;  4FD2 A;  3GQ3 A;  3AOG A;  4AKG A;  4ZPV R;  2F5P A;  1SXJ B;  4L72 B;  2E5L M;  4MGH A;  1IN7 A;  2Q2E B;  1Z59 A;  2LNH C;  4II7 A;  3O5F A;  2R18 A;  3CHD A;  3CGN A;  3EIH A;  2G41 A;  1DGB A;  1Q1C A;  3CF6 E;  3KS4 A;  4P8U A;  4J4O A;  3ART A;  2D9F A;  5FTM A;  2BJW A;  2LH0 A;  4ODR A;  4P8W A;  4U86 A;  1I4W A;  4JFL A;  1E6P A;  3G6M A;  1I94 M;  3U5Z B;  3HU1 A;  4LAV A;  4ZPT R;  3ZH9 B;  2FKE A;  1E6N A;  4G2P A;  2PBC A;  2O92 A;  1FKH A;  4NXM M;  1FKR A;  3G6L A;  1IM2 A;  1E6Z A;  1FD9 A;  3MDY B;  4NXN M;  2ZM6 M;  3E4R A;  3PNV A;  2M08 A;  1E9L A;  4LF9 M;  4IBB A;  2L2S A;  4R7G A;  2CHQ A;  2PV1 A;  2ZR5 A;  3UK6 A;  3TC5 A;  5DF0 A;  5BXJ A;  2K47 A;  4D80 A;  3PRB A;  1KFW A;  2KZS A;  4L15 A;  2OFN A;  4WW0 A;  2ESC A;  4P8V A;  4CHT B;  4AZF A;  4JI3 M;  3GLG A;  5LMN M;  2JA2 A;  3GLF B;  4BLC A;  2PV3 A;  3AJI B;  3UQI A;  3AQU A;  3TWK A;  1LL4 A;  4JFM A;  4JI7 M;  2R62 A;  1J4H A;  4DRO A;  1FKI A;  3AS0 A;  4NZC A;  1SXJ C;  5DNY A;  5HT1 A;  5I98 A;  4CIS A;  3WQW A;  3SAR A;  4Z8X A;  3ARU A;  3HJQ A;  5HW8 A;  5LMU M;  4C02 B;  3PA7 A;  3QWL A;  1TDZ A;  3GRV A;  3O5J A;  4JFK A;  3VDU A;  4FCW A;  1XXH B;  4S12 A;  2RGO A;  1JR3 D;  1U79 A;  4EIW A;  1NWU A;  4PD2 A;  2XEP A;  1IY1 A;  1W5T A;  4M9S A;  2VQE M;  3W0L B;  3KZ7 A;  3T15 A;  2QCU A;  2P5T A;  1KSF X;  3CHE A;  1HJW A;  2V1C A;  4GKJ M;  2HCB A;  1N33 M;  3FKE A;  1GL7 A;  2Z3X A;  2MLZ A;  2F2D A;  1PM5 A;  4DR1 M;  2KZU A;  5E6J A;  4GC9 A;  4KOD A;  1HR0 M;  4L78 A;  4W9Q A;  1XWI A;  2EO2 A;  1GOI A;  2OQ4 A;  2RUD A;  3AOE A;  5ITU A;  4JXJ A;  4DRN A;  2LJ4 A;  4DR2 M;  2CEA A;  2DT2 A;  1N1A A;  5DIU A;  2UXD M;  1OJL A;  1EDQ A;  2F5N A;  4Z2K A;  4MGZ E;  3WD1 A;  2LPV A;  3JAM S;  4IPX A;  3B9P A;  3CZ8 A;  1F40 A;  2DPE A;  2Y20 A;  3ARP A;  1ZCN A;  1QVR A;  1HJV A;  3H4M A;  3GPK A;  4YHH M;  2WK2 A;  4FWH A;  1H0G A;  4IIW A;  1WXQ A;  3IKD A;  5B8I C;  2JZV A;  2XSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...