3RFWA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally-related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
252
structure length
252
Chain Sequence
ATVATVNGKSISDTEVSEFFAPMLRGQDFKTLPDNQKKALIQQYIMQDLILQDAKKQNLEKDPLYTKELDRAKDAILVNVYQEKILNTIKIDAAKVKAFYDQNKDKYVKPARVQAKHILVATEKEAKDIINELKGLKGKELDAKFSELAKEKSIDPGSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTTPVKTNFGYHVILKENSQAKGQIKFDEVKQGIENGLKFEEFKKVINQKGQDLLNSAKVEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally-related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Chaperone
molecule keywords Cell-binding factor 2
total genus 77
structure length 252
sequence length 252
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1040 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3rfwA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rfwA03
3O5RA 2XPAA 1PINA 2FKEA 2LGOA 3KAIA 2MF9A 4ODQA 4W9OA 2KO7A 2XP4A 4DRMA 2PV2A 4IQ2A 2JZVA 1FKHA 2PPOA 3PRBA 1FKRA 1J4IA 1KT1A 2M08A 1YATA 4J4NA 4DRNA 3O5PA 4DT4A 1EQ3A 4LAWA 5HW6A 2XP6A 2ZQTA 5GPGA 4DROA 5HWBA 2RUDA 2Y78A 2RURA 1BL4A 2KFWA 5J6EA 4IPXA 4JFMA 4DRKA 5HKGA 3VAWA 4J4OA 5B8IC 1FKSA 1U79A 3NRKA 4JFIA 4DZ2A 1A7XA 3KACA 1Q6IA 3TC5A 4W9QA 2F21A 3UQAA 4ODMA 1FKBA 3RFWA 4FN2A 3O5QA 3TDBA 2DG3A 2MLXA 3O5IA 4ODOA 2AWGA 2MLYA 3IHZA 2LPVA 1M5YA 3JYMA 4TYOA 1FD9A 4DRPA 3B7XA 3O5KA 3UI6A 4LAVA 1ZCNA 1EYMA 1Q6UA 1FKFA 1FKIA 1TCOC 2ZQVA 3ODKA 3WH0A 3KABA 1FKDA 1L1PA 2KR7A 3JYJA 3KAGA 3O5JA 3UQBA 3OOBA 5DIVA 1T11A 1ROTA 1FKLA 2D9FA 2OFNA 4U84A 1FAPA 2MPHA 2UZ5A 2F4EA 3UI4A 5HW8A 2PV3A 5BXJA 4DRQA 2DG9A 2PV1A 4LAYA 2N87A 1NSGA 1BKFA 1YW5A 3TCZA 3CGMA 1HXVA 3UF8A 2K8IA 3MDYB 1W26A 2F2DA 4TW8A 3IKDA 2Q5AA 4U85A 3NTPA 3O5LA 1J4HA 4TX0A 5D75A 4C02B 2DG4A 3LUOA 2XP7A 3RGCA 1QZ2A 1D7JA 1Y0OA 2PBCA 2VCDA 4TW7A 1J6YA 2ZQSA 5HW7A 3KCEA 3H9RB 4BF8A 4DH0A 3PA7A 2L2SA 1FKTA 1QPLA 1FKKA 1JVWA 2PPNA 4JFJA 1JNSA 4TW6A 2XP3A 3GPKA 4ITZA 3O5GA 2MNTA 5DIUA 4DRIA 4DRHA 1N1AA 2XP9A 2ZR5A 2RSEA 4R0XA 1ROUA 2XPBA 4G50A 3O5MA 5DITA 1P5QA 2VN1A 2RQSA 4ODKA 4ODRA 5HWCA 1D7IA 1PBKA 3UI5A 1NMWA 3CGNA 4GGQA 1B6CA 2FAPA 3JXVA 1F40A 1D7HA 1Q1CA 4NNRA 3I6CA 3PRDA 3O5EA 4MGVA 2KI3A 3KAHA 4GIVA 4G2PA 2M2AA 2ITKA 3O5DA 4QT2A 1FKGA 4DRJA 2M1IA 3EY6A 3IK8A 4IQCA 3KZ7A 5HUAA 4MSPA 3UQIA 5I98A 1D6OA 2LKNA 1FKJA 1C9HA 3KADA 4LAXA 3NI6A 5HTGA 4U86A 1J4RA 2ZQUA 2KE0A 1QPFA 2LJ4A 1FJDA 4FAPA 2XP8A 4JYSA 4W9PA 4DZ3A 2IF4A 1ZK6A 3IKGA 3KAFA 2PPPA 3FAPA 5HT1A 1R9HA 4ODPA 4QIBA 2RUQA 1F8AB 1NMVA 4TNSA 3O5OA 2MLZA 2ZR6A 4DIPA 1Q6HA 1KT0A 4ODNA 3O5FA 4JFKA 4QT3A 2KGJA 4N19A 2ZR4A 4JFLA 1JNTA 2RUCA 4O2TA 2XP5A 4ODLA
chains in the Genus database with same CATH superfamily
4ODQA 4R7GA 3BBZA 1XHGA 1J4IA 4AZFA 2OOAA 4P16A 2UU9M 8CATA 2Y78A 2ERCA 3B7NA 5DFLA 3FD9A 4R3DA 1WGNA 5B8IC 1NJGA 4M9SA 1H0IA 3FE3A 2CV1A 1FJGM 5DEZA 3K2LA 1FKDA 3AL0C 4PDGA 2DAGA 3HJQA 2QF8A 3GPUA 1BKFA 4PDIA 2DVWB 3FTDA 1J5EM 4JI4M 2ZQSA 2B31A 4P8UA 1JNSA 3C58A 1MJGM 4DV0M 2F5SA 2EA0A 4REZA 3HKPA 3UI5A 1E9RA 3KVWA 1TTEA 2QENA 2UUCM 4DR1M 4FW9A 4DR3M 1HNZM 1FKGA 1N32M 3ARPA 4G4NA 5BPVA 4AKGA 3HHXA 4CHTB 1J4RA 5LMNM 3WHLA 3WD4A 1MX0A 3KSJA 3LW5F 4CIZA 3AOEC 3GLHB 4FCVA 1R2YA 4GHAA 3HY5A 2XZUA 4W9OA 2L2DA 1PJJA 1E32A 4DV2M 1PM5A 2F23A 2DWNA 2F5PA 2DSWA 2LTUA 4KODA 1NHGC 2CUZA 5J6EA 3K8ZA 1DGBA 3KP1E 1XXHB 1AIPC 2MLXA 4L4UA 4LJ8A 1JCHB 2YBUA 1Z5AA 2MGWA 2KR7A 3W68A 4LF6M 2UZ5A 3RGPA 5HW8A 3LVVA 2W82A 4IBKA 3UF8A 4IBBA 2FDMA 3IKDA 5E26A 3IG8A 5IWAM 4C02B 2EKFA 1TH2A 5HW7A 2KNVA 3FY1A 3SYKA 1R6BX 4AG6A 4ITZA 4LFCM 2XPBA 3GLFA 1PRBA 4HL4A 2HAKA 2BWBA 3B9EA 4JI2M 1GOIA 1B6CA 4KLNA 3JXVA 4NSOB 2WLYA 1Y8GA 4RF0A 3WL0A 3B9AA 4PTMA 1IX5A 4ZPXA 1FKJA 1OQYA 1C9HA 1HT2E 2KNZA 3A42A 3QYBA 1QAQA 4DWSD 3C3DA 1R9HA 3A46A 4TNSA 2MLZA 3KXEC 3THGA 3GLFE 2XSZD 3NWLA 2IUZA 2XP5A 2O9OA 4ZS6A 3KAIA 3LMMA 1L8QA 4JN6A 4MTVA 1LV7A 1LL6A 4DT4A 4DROA 1YLAA 2O5RA 5ITUA 1OAIA 2A3EA 4GKJM 5DYIA 1BL4A 1EDQA 1JR3A 3GLIA 3NRKA 1VEKA 1A7XA 2ESCA 2ZAMA 4JI8M 2H1RA 4G4QA 4Q22A 4FWHA 3CGWA 4GMQA 1ZCNA 1FKIA 1TCOC 3SYLA 1XNQM 3M0EA 5FTNA 4IBIA 1E6PA 1FAPA 3FRHA 4G4RA 1NNUC 4R71A 4LAYA 5EQTA 1NSGA 2ZM6M 4FWGA 4TW8A 1NJFA 2LWXA 4GH9A 3LVWA 4UN2B 3ARSA 2DG4A 1CUKA 4DWSC 3WHKA 1QZ2A 4BF8A 4M9ZA 2CWBA 2CP8A 2A3CA 3ARUA 1LG1A 2BNKA 3U6PA 4ODRA 4LFAM 3SMSA 3PRDA 4MGVA 1DGHB 4IBJA 3SAVA 3UMMA 2PN0A 4IQCA 5A2QS 3TWLA 1N34M 1NH6A 2LHGA 3KP0E 2YNMD 4QNMA 1IXSA 1IN6A 1F8AB 3HU1A 4L15A 3HU2A 4MNLA 4HBOA 3L28A 2KGJA 2I7NA 2L09A 4AKHA 2Y21A 2DT0A 1FKHA 1NV8A 3PRBA 1GJTA 5LMUM 4Z2KA 4QNRA 4RKUF 3RE8A 4LAWA 3SHFA 1GL6A 4JFMA 1IBMM 4J4OA 2DHYA 2JA2A 3TC5A 4M9XA 4ODMA 3VDUA 3SASA 3U6LA 2Y0QA 1ZL1A 2CV0A 2Y0TA 2JY8A 1L1PA 5E6JA 3O5JA 3PRAA 3ZH9B 3BXWA 1IY1A 3MDYB 3KSXA 3AFHA 2D7EA 5ITRA 1L2BA 3HHWA 3GPKA 3I04M 2RSEA 1L1TA 1V92A 3FYDA 2WM0A 1L1ZA 1PJIA 1F40A 3FTFA 1R5LA 5JH8A 3SC3A 4Z8XA 3U6CA 4DRJA 3EY6A 2WK2A 1GJSA 1FFQA 2WSFF 1JNDA 1K82A 1X6LA 2FNAA 3VK7A 3FKEA 1VG5A 3LCVB 4QT3A 4JI5M 2DXIA 1X37A 1ZBKA 2C99A 3FUWA 3UJNA 1YATA 1XRVA 3U6MA 4LG2A 3U61B 2DT1A 3AKZA 1ZMVA 1Z5CA 1FKSA 1PGYA 4FN2A 1Z6TA 4LJ4A 2UXBM 3T38A 2ZTCA 3JYMA 1GUVA 4DRPA 3UI6A 2KZUA 1NY5A 2CEAA 4MB7A 3KAGA 4QHTA 3DA1A 4U85A 3O5LA 2VF7A 2UXDM 3RGCA 1D7JA 4MNJA 4QOZC 2OLHA 2EO2A 1ORYB 1MN3A 2ZAOA 1IXSB 1Z59A 3LQQA 2XH9A 3GLGB 2JY7A 4JV5M 5EXXA 2YFQA 1Q3BA 2A3AA 5ITYA 1SXJA 3KAHA 4BLCA 4PCZA 2M1IA 5JI3E 5HUAA 4LAXA 2Q2EB 1EIBA 2ZQUA 3FTCA 1ZK6A 5HT1A 4ODPA 4L78A 3QAUA 1QANA 1QDRA 2HL7A 1QAOA 3ZQJA 3HU3A 4X66M 1SXJE 1VDLA 2JZVA 1DGHA 1QAMA 4LGYA 2WSCF 4BB9A 3ARTA 2L7IA 1KFVA 1O6IA 4YHHM 3DZDA 4MGZE 1OWQA 3B7ZA 3SMPA 3TE6A 3VAWA 4D81A 4JFIA 1XB2B 1E44A 2DSUA 3RFWA 1T43A 4B3TM 3O5QA 3IHPA 1JQJC 2LVAA 1G8PA 2AWGA 2J7OA 1NSFA 3JYJA 3T15A 4EIWA 2PV3A 2NQ8C 4JI1M 3ARRA 2DENA 4LFBM 5D75A 3LUOA 4TW7A 1D0MA 4G3OA 3PA7A 1FKTA 5DIUA 4DRHA 2C5RA 1XMOM 2ZR5A 3E4RA 4HEOA 3HJ8A 4LJ5A 2DWZB 1SXJD 1Q3CA 3RM8A 3L27A 4G2PA 3ARWA 4QT2A 4DR7M 2CHVA 2VDBB 4AW4A 1TH4A 1W9PA 1HKJA 1K3XA 1GVNA 3U61A 2IF4A 3IKGA 3SHGB 1UM8A 1NNJA 5GPRA 3O5FA 2RRUA 4LJ7A 2JP7A 2HHHM 4JI3M 2K6BA 2XPAA 3NBXX 3TPZA 2QP9X 3L26A 1HT1E 3SARA 2XFSA 2KFWA 4ZPWR 1T3TA 5HKGA 1SXJB 2BJWA 2QCUA 3RM9A 3KOZE 1LJYA 2QPAA 1L2CA 2C96A 3ODKA 4GITA 2LHCA 4LGXA 3HJSA 2H5XA 3LCUA 1ROTA 4TUWA 4LRTA 3K1JA 2PV1A 4WKHA 3CGMA 2C9OA 3TWMA 1ZMWA 5EJCA 3GQ5A 4AY1A 3A98B 2XP7A 1EIJA 2K9DA 2XLJA 3KOXE 3L25A 3O5GA 2MNTA 4L8RC 3CHCA 4WP2A 2V1CA 4JI0M 2DWMA 1Q1CA 4NNRA 1D2KA 3I6CA 3U6EA 1RD6A 4IJEA 2R62A 3IK8A 4P17A 5KPRA 3OA5A 2F5QA 5I98A 3G6MA 2DSZA 4U86A 3K92A 1FJDA 3D8BA 4XGIA 2O25A 2WSEF 1NMVA 3PNYA 1PJQA 4B3MM 4KO8A 4DV5M 2X49A 2PI6A 1IN4A 1WR1B 3O5RA 2DPEA 3U5ZA 4G4OA 2KO7A 2V1UA 1Q02A 2ZTDA 1E6RA 1KT1A 2R45A 3SFZA 5GPGA 4YY3M 1U79A 2EUCA 3TL4X 4DV3M 5DYGA 2DAIA 3VK8A 2JZ1A 1XXHA 3B89A 3B7XA 4WW0A 4LAVA 1NWTA 5L8RF 2ZQVA 4LF4M 1TF0B 5IREB 1OGBA 5DO2A 2LNHC 1OKSA 4NOOB 3GRVA 4JXJA 1I94M 3WQVA 1ZBWA 4GEWA 4DR2M 3CF6E 4FCTA 2Q5AA 1QUTA 1NV9A 1ZU8A 1E6ZA 5C1BA 2BJVA 3F92A 4I4LA 2L2SA 4DV6M 4LJAA 4B08A 4Y28F 2A3BA 4Q7JA 1P5QA 2DKLA 2Z3XA 2LBCA 1PBKA 1NVMA 2FFJA 1QUSA 2D7HA 4OVZB 4G6ZA 2XGNA 4L16A 1HKIA 2ITKA 3O5DA 1WHCA 4MSPA 3HHYA 2FS1A 3KADA 2QQ8A 4P8XA 2L4FA 1TGUA 5FLXS 3GLHA 5IZ7D 1Z5BA 4DR5M 1QPFA 1PJTA 3MK6A 3PFIA 2RUQA 2ZR6A 2YR0A 1HQCA 1DO2A 4JFKA 4N19A 2LVNC 2QZ4A 3HX3A 1W1TA 4ODLA 4FD2A 4JI6M 1HJVA 3D8LA 3PVSA 1IBLM 2XP4A 3FRIA 2HCBA 2PPOA 2EULA 3R8FA 2M08A 1D0LA 1N36M 2JWSA 2Z7JA 2Z4SA 4DRNA 3O5PA 1BVSA 2XP6A 5HW6A 1D2NA 3W67A 1J09A 3GLFB 3PR9A 3Q8GA 1GL7A 1XC8A 3UQAA 1W5TA 4XBOA 1PJSA 3O5IA 3W0FA 3C9PA 3O5KA 4I8OA 4WKFA 2DNAA 3CHFA 4WK9A 3W4RA 3VDPA 1G41A 2D9FA 4RNAA 2LVPC 4QZVB 1DGGA 2K8IA 1H6UA 1W26A 2MR9A 3NTPA 2DI0A 1N77A 4TX0A 2APLA 1DO0A 5H37D 1EE8A 2ZBKB 1IY2A 4AI6A 1EFUB 3WQWA 1V33A 1ZBVA 3EIPA 5C18A 4LRSA 2C98A 4IBDA 1N78A 4QOSA 3JR5A 1A5TA 1OAOC 1ZV1A 4B3SM 2KRKA 2GNOA 1MU5A 1D6OA 1HNXM 2XP8A 4ANRA 4NL4H 1G59A 3WD2A 2RGOA 2WZJA 2F4VM 3B74A 4AKIA 1KT0A 4RF1A 3WKZA 3FUVA 3CHDA 2LXEA 1PINA 1GO5A 1WXQA 3ZCBB 1YUBA 1EQ3A 4PT5A 2L6OA 2GQFA 1K9TA 2XF3A 3KOYE 4NZCA 4F1IA 2G3QA 5KQDA 1G71A 5EP4A 4Z2JA 4TYOA 1HR0M 4I81A 4DR6M 3WH0A 1W1PA 2KW0A 2OPFA 4FVMA 1X6NA 3FUXA 5KQ8A 3VKGA 4HBEA 2K47A 1V34A 4R5EA 2N87A 1YW5A 5KPZA 2CFOA 2B5UB 4X62M 3J7BA 2VCDA 3ZC7B 1QZMA 3LQRA 3WD0A 4LF7M 4TW6A 1JR3D 3GRRA 4MGKE 3U60B 2V6ZM 2Y20A 1D7IA 2BWEA 4LJ9A 3AQUA 1D7HA 2DZOB 4B3RM 1LG2A 1N33M 3GRUA 2KA6B 2XZFA 3ALFA 1IN8A 1C7YA 2UUBM 3KS8A 1SR0A 2FH0A 1ZB5A 4DWSA 3KAFA 4IBEA 4AQYM 2MJ5B 3IG5A 5FTLA 4D82A 3AS2A 2VQFM 1Q6HA 4DV7M 2O01F 4XAKA 2XSZA 4Z6YA 3M7GA 4Z2HA 2FKEA 1XXHE 4DRMA 5FTJA 1VF8A 1OIPA 2ZQTA 4MGYE 2RURA 4WIWA 3E46A 4IIWA 3PNVA 2AHMA 2CE7A 1UR8A 3K9PA 3H4JA 1DV0A 3GLGA 4IT4A 3J7AS 2C9CA 1XNRM 1GRJA 3CF0A 4NXNM 3TWKA 3V76A 3R9XB 3H4MA 1RU3A 4W5UA 3FXYA 2XEPA 2QBYA 5EP2A 1R2ZA 3OOBA 2Z8YM 4JI7M 1W9VA 3FUUA 3TCZA 4L6V6 1QVRA 4MM3B 1R7RA 2G5GX 2PBCA 3CH9A 3AROA 4DH0A 3H9RB 4PD2A 3KS4A 1JVWA 1L2DA 3GPPA 2AOSA 1OTRA 2J5YA 3GP1A 3B8SA 1N75A 4LGMA 2EKKA 1FFRA 2VN1A 2X8AA 1ZQ9A 5GKNA 2MROB 3EIEA 3VLFB 1IN7A 5EP1A 1OGGA 1VEJA 5ITTA 3RGSA 3FYCA 3SAUA 2KXEA 4MGIE 5JI2E 1QQWA 1YE9A 2J7NA 2RKOA 3GQ3A 1HJWA 2LJ4A 1WNOA 1ZBCA 4MNMA 3W0LB 4DIPA 4KQZA 2I7PA 4JFLA 2RUCA 1NY6A 3E9SA 1ZMUA 1E15A 2KZSA 2KNAA 4MGHA 5IT9S 3I51A 2G8LA 3U6DA 3ARXA 1UR9A 1G3IA 2DT3A 4OX9M 5ITQA 3JAMS 1E9SA 3I4YA 4FCWA 1HKMA 4URIA 3T6PA 1SXJC 1GKIA 3TDBA 3UZUA 4ODOA 2R4JA 3IHZA 1TR8A 1M5YA 4CJ6A 2KEBA 4NRWA 1IY0A 1ZAEA 2D7GA 4NRVA 2RGHA 5DIVA 1T11A 7CATA 3GO8A 2MPHA 3UI4A 2F5OA 3GLGE 2JY6B 5KPTA 1QZEA 1XHBA 4GC5A 1HQYE 1C1KA 3SAWA 2B3TA 1SYTA 1T6OA 4P8WA 2ETNA 3QWLA 1WJ7A 2R6FA 4FWDA 5EXTA 3GPYA 3O5MA 5DITA 4ML4A 4IT6A 3L2AA 3QYEA 4MPKA 2M5ZA 3CGNA 4JYAM 2CHGA 4W5WA 3BOSA 3O5EA 1HJXA 5FTKA 3WD3A 2DZLA 2XFTA 5EXSA 2R44A 2MH8A 3NI6A 4Z2IA 2DAKA 3RM4A 1W1YA 1JB0F 4W9PA 4GHLA 3FAPA 4Q7NA 2HWJA 3U60A 4CGYB 3CTWB 5FTMA 2R46A 3CF2A 3WD1A 1OFIA 4GIPA 4L3NA 1YSYA 4K0KM 1K3WA 4LF5M 3C3EA 4WURA 4ZPVR 2P5TA 4DRKA 2YQZA 3U6OA 2JNHA 1Q6IA 4W9QA 2R4EA 2P4VA 2HKJA 4OW0A 1F4IA 2DSVA 1LQ0A 4L72B 1WB0A 1XMQM 3ALGA 1FKLA 1R4GA 4B7FA 4S12A 4DV1M 1HNWM 4KHPM 4DUZM 5BXJA 4GKKM 3ARYA 1D0KA 3ARZA 1J4HA 4OU7A 1TDZA 1J6YA 4Z2GA 5DNYA 1QPLA 2PPNA 4JFJA 3WL1A 4ZPTR 1N1AA 1NWUA 4R0XA 3GRYA 4G50A 1LTMA 1LL7A 4ODKA 5HWCA 2ZANA 4GGQA 2VF8A 5BR8M 3AOGA 3NBIA 5FSWA 3GQ4A 3GU0A 4Z2LA 4M0WA 3KW6A 5ITXE 2LKNA 2JY5A 3WIJA 4NXMM 3IECA 4LCBA 2KE0A 3K9OA 3GLIB 4JYSA 4AG5A 4DZ3A 2PPPA 2CHQA 4QIBA 4IBGA 4LJ6A 3GPXA 4WKAA 3HGIA 1JNTA 2OOBA 3MHVC 2LGOA 2Z4RA 1DGFA 3G6LA 2E5LM 3ARQA 2X4AA 2RUDA 1CTNA 2R65A 4IPXA 4KT0F 1P3QQ 4DZ2A 3KACA 4I5SA 3EIHA 1FNNA 2DG3A 3GLIE 2MLYA 4P8VA 3HHZA 4MAVA 1FD9A 2EJSA 4S3KA 2CV2A 1FKFA 3KOWE 3KABA 3UQBA 3FTEA 5F3WA 2OO9A 1JNEA 1E9LA 4DRQA 1IN5A 3GTYX 2DT2A 4HARA 1OJLA 2JZ0A 5KO3A 3KFUG 2FE8A 4UDMA 1VDDA 1E94E 4S3JA 2RQSA 3UK6A 4A3VB 1GPFA 3AOEA 2LVOC 4GRIA 3J2PB 4LF8M 2O92A 2VQEM 4MNKA 3AV0A 1TDHA 1TH3A 3KZ7A 2L7HA 4F2LA 1GABA 3U6SA 1ITXA 4FAPA 3T1HM 3M6AA 1WIVA 2QNJA 3PXGA 4O2TA 3A45A 1OIZA 1H0GA 3J81S 1SG9A 5ITXA 4ITQA 1FKRA 4J4NA 1KSFX 5HWBA 3U6QA 5GQBA 2KDLA 1AUAA 1IQPA 1Q39A 1G4AE 2F21A 4II7A 1FKBA 4XK8F 1IBKM 4OVZA 2LPVA 2JXNA 3HZJA 3QOKA 1EYMA 3RMEA 3U5ZB 1VEGA 3E21A 3I4VA 2M60A 2OFNA 3VKHA 3BMBA 2F4EA 2DHRA 1GLNA 5EP3A 4KR0B 4QHSA 2F2DA 1OFHA 3T1YM 1W1VA 2WLZA 3AS0A 4DBGB 1Y0OA 1HJPA 2LVQD 1E6NA 5DF0A 4NSRA 3J27B 3KCEA 1NO1A 2F5NA 2XP3A 2XP9A 2UXCM 1J7KA 4LF9M 1S3SA 1QDTA 2QSFX 4IBFA 1NMWA 3AS1A 2A5YB 1HKKA 4LY6A 2N35A 3SATA 3AS3A 4CISA 1IXZA 2K0BX 4GIVA 1JR3E 2M2AA 1QYRA 3B9PA 3UQIA 3TQSA 4X65M 5HTGA 4DWSB 1NWRA 2UUAM 3I01M 3B9DA 2DAEA 2ZR4A 4DV4M 2MF9A 2G41A 2PV2A 4IQ2A 2DAMA 3DFZA 4MH0E 3HWSA 3MMPA 2JUJA 1VQ1A 3CHEA 1W5SA 4IJFA 4GC9A 3DOAA 2DWLA 3GLHE 1EHNA 3J80S 3JR4A 4BBAA 4X64M 1LL4A 2FOIC 1Q6UA 5EXPA 2CRUA 3OTOM 4U84A 2QHOB 1WGLA 1IM2A 3L29A 3B7QA 4HLQA 2DG9A 1HXVA 3VFDA 4DR4M 2KHHA 1KYIA 4B7GA 1IXRC 1UFZA 1NWSA 4LZJA 3UGJA 1FKKA 4NSBA 4DRIA 2VIIA 3FUTA 3MJ5A 4WJXA 2G8ZA 1ROUA 1KFWA 1IFYA 4B7HA 4M0DA 2YBTA 4D80A 5HBFA 2FAPA 3AJIB 2DZNB 2KI3A 1NHWC 2KRUA 4DUYM 1I4WA 3CZ8A 2QBYB 1WAWA 2L4EA 1W9UA 3ARVA 4LZZA 4IBCA 2LH0A 3Q8XA 3ILKA 3SBJA 1TFVA 3O5OA 2R0IA 2OQ4A 4ODNA 1XWIA 3KDSE 4NC6A 2R18A
chains in the Genus database with same CATH topology
4L3NA 4FD2A 4ODQA 4JI6M 1HJVA 3D8LA 3PVSA 1IBLM 4R7GA 1YSYA 1ZBKA 2XP4A 2C99A 4K0KM 3FUWA 2HCBA 2PPOA 1XHGA 1J4IA 1K3WA 3UJNA 3R8FA 1N36M 1YATA 4LF5M 2Z7JA 4AZFA 1XRVA 2M08A 2Z4SA 4DRNA 3O5PA 4P16A 3U6MA 5HW6A 2XP6A 2UU9M 8CATA 4WURA 4DWSC 1D2NA 2Y78A 4LG2A 4ZPVR 2ERCA 2P5TA 3U61B 4DRKA 2DT1A 2YQZA 3FD9A 4R3DA 1J09A 3GLFB 3AKZA 3U6OA 3PR9A 5B8IC 1Z5CA 1FKSA 1GL7A 1NJGA 4M9SA 1Q6IA 1XC8A 4W9QA 2R4EA 3UQAA 1H0IA 1W5TA 1Z6TA 4XBOA 4FN2A 4LJ4A 3O5IA 2UXBM 3T38A 2CV1A 3JYMA 1GUVA 3W0FA 2HKJA 1IX5A 4DRPA 4OW0A 4I8OA 3O5KA 1FJGM 3UI6A 4WKFA 2DSVA 1LQ0A 2KZUA 1NY5A 3CHFA 5DEZA 3K2LA 2CEAA 1FKDA 1WB0A 4L72B 4WK9A 4MB7A 3KAGA 3W4RA 4QHTA 1XMQM 3VDPA 3AL0C 4PDGA 1G41A 1FKLA 2D9FA 4RNAA 3ALGA 3HJQA 4B7FA 4S12A 4DV1M 2QF8A 1HNWM 4KHPM 4DUZM 5BXJA 3GPUA 4GKKM 3ARYA 1BKFA 4QZVB 3DA1A 1DGGA 2K8IA 4PDIA 1H6UA 1W26A 3ARZA 2DVWB 4IQCA 4U85A 3NTPA 3O5LA 1J4HA 1N77A 4TX0A 4OU7A 3FTDA 1DO0A 5H37D 1TDZA 1EE8A 1J5EM 4JI4M 2UXDM 1D7JA 2ZBKB 4QOZC 4MNJA 3RGCA 2OLHA 1IY2A 2ZQSA 4Z2GA 1J6YA 5DNYA 2EO2A 1ORYB 4AI6A 1QPLA 2B31A 2PPNA 4JFJA 4P8UA 3WL1A 3WQWA 2ZAOA 4ZPTR 1JNSA 3C58A 4DV0M 1ZBVA 5C18A 4LRSA 2F5SA 1N1AA 2EA0A 1IXSB 1Z59A 1NWUA 4R0XA 2C98A 3GRYA 3LQQA 4IBDA 4G50A 4REZA 1LL7A 2XH9A 3HKPA 4ODKA 3GLGB 5HWCA 1N78A 1W1TA 2ZANA 4QOSA 3JR5A 1E9RA 3KVWA 2YFQA 5EXXA 4JV5M 3UI5A 4GGQA 5BR8M 3AOGA 3NBIA 5FSWA 1Q3BA 4B3SM 2A3AA 2QENA 5ITYA 2UUCM 4DR1M 1SXJA 4FW9A 2KRKA 3GQ4A 4BLCA 3KAHA 4DR3M 1MU5A 1HNZM 1FKGA 4PCZA 2M1IA 4M0WA 4Z2LA 3KW6A 5ITXE 5JI3E 1N32M 5HUAA 3ARPA 4G4NA 1D6OA 2LKNA 3WD2A 5BPVA 3WIJA 4LAXA 4NXMM 1HNXM 2Q2EB 4LCBA 4AKGA 1EIBA 3HHXA 4CHTB 1J4RA 2KE0A 5LMNM 3WHLA 2ZQUA 3FTCA 3GLIB 2XP8A 4AG5A 4JYSA 4DZ3A 4NL4H 1ZK6A 5HT1A 2PPPA 3WD4A 1MX0A 2CHQA 4ODPA 4QIBA 1G59A 3KSJA 4IBGA 4LJ6A 4L78A 3AOEC 2RGOA 3GLHB 4FCVA 3QAUA 3GPXA 2F4VM 4AKIA 4WKAA 1KT0A 4RF1A 3WKZA 3HGIA 1QANA 1R2YA 3FUVA 4GHAA 3CHDA 1JNTA 3MHVC 2LXEA 2HL7A 2XZUA 1PINA 2LGOA 4W9OA 1QAOA 2Z4RA 3HU3A 1WXQA 4X66M 1SXJE 1PJJA 1E32A 3ZCBB 1DGHA 2JZVA 1DGFA 1QAMA 4DV2M 4LGYA 3G6LA 1PM5A 4BB9A 2DWNA 2F5PA 2DSWA 2E5LM 3ARQA 1YUBA 3ARTA 1EQ3A 4KODA 2L6OA 4PT5A 2L7IA 2X4AA 1NHGC 2CUZA 2RUDA 1KFVA 1CTNA 1O6IA 4YHHM 3DZDA 1K9TA 2R65A 2XF3A 3K8ZA 4MGZE 5J6EA 4IPXA 1DGBA 1OWQA 3SMPA 3KP1E 3TE6A 3VAWA 4D81A 1XXHB 4JFIA 4DZ2A 3KACA 3KOYE 4NZCA 4I5SA 2DSUA 3RFWA 3EIHA 1FNNA 4B3TM 3O5QA 2DG3A 4L4UA 2MLXA 1JQJC 5KQDA 4LJ8A 4NNRA 1G8PA 5EP4A 2AWGA 2MLYA 2YBUA 3HHZA 4P8VA 4Z2JA 2J7OA 1HR0M 1FD9A 4MAVA 4TYOA 4I81A 4S3KA 1Z5AA 2CV2A 4DR6M 1FKFA 1NSFA 2KW0A 3KOWE 1W1PA 3KABA 2OPFA 3WH0A 4FVMA 1X6NA 3FUXA 2KR7A 3JYJA 3T15A 3FTEA 3UQBA 5F3WA 5KQ8A 3VKGA 4HBEA 4LF6M 1JNEA 4EIWA 2K47A 1E9LA 2UZ5A 3RGPA 5HW8A 2PV3A 2NQ8C 3LVVA 4JI1M 4DRQA 2W82A 2N87A 4R5EA 1IN5A 4IBKA 1YW5A 3ARRA 5KPZA 3UF8A 4IBBA 2FDMA 3IKDA 4LFBM 5E26A 3IG8A 2CFOA 5IWAM 5D75A 4X62M 3LUOA 4C02B 3J7BA 2DT2A 2VCDA 1TH2A 4HARA 4TW7A 5HW7A 3ZC7B 1QZMA 1OJLA 3PA7A 3LQRA 3WD0A 1FKTA 5KO3A 4LF7M 3FY1A 3SYKA 3KFUG 2FE8A 1R6BX 4AG6A 4ITZA 2C5RA 4TW6A 5DIUA 4DRHA 1JR3D 1VDDA 3GRRA 1E94E 1XMOM 4LFCM 2ZR5A 4S3JA 4MGKE 3U60B 2V6ZM 2Y20A 2XPBA 3GLFA 3E4RA 2RQSA 3UK6A 4A3VB 1D7IA 1GPFA 3HJ8A 4HL4A 4LJ9A 3B9EA 4LJ5A 4JI2M 3AOEA 1GOIA 1B6CA 2DWZB 1SXJD 4KLNA 3JXVA 4NSOB 2WLYA 1D7HA 3AQUA 4GRIA 3J2PB 1Q3CA 2DZOB 3RM8A 3L27A 4RF0A 4B3RM 1LG2A 3WL0A 1N33M 3B9AA 3GRUA 4LF8M 2KA6B 2XZFA 3ARWA 2O92A 2VQEM 4G2PA 4PTMA 3ALFA 4DR7M 4MNKA 3AV0A 1TDHA 1IN8A 1TH3A 2CHVA 4ZPXA 3KZ7A 2UUBM 1FKJA 1C9HA 3KS8A 4AW4A 1TH4A 1HT2E 2L7HA 1HKJA 1W9PA 1SR0A 1K3XA 1GVNA 1ZB5A 3U6SA 4DWSA 5JH8A 3A42A 1ITXA 4FAPA 3U61A 1QAQA 3T1HM 2IF4A 4DWSD 3IKGA 3KAFA 4WKHA 3SHGB 4IBEA 3M6AA 1R9HA 4AQYM 3IG5A 3A46A 5FTLA 1UM8A 1NNJA 5GPRA 4TNSA 4D82A 2MLZA 3KXEC 3THGA 3AS2A 2VQFM 1Q6HA 4DV7M 3O5FA 2XSZD 3NWLA 4LJ7A 2IUZA 2HHHM 4JI3M 3PXGA 4XAKA 2XSZA 4O2TA 4Z6YA 3M7GA 3A45A 2XP5A 2O9OA 4ZS6A 4Z2HA 2XPAA 2FKEA 3KAIA 1H0GA 3J81S 4DRMA 5ITXA 4ITQA 1FKRA 3LMMA 3TPZA 1L8QA 4JN6A 2QP9X 3L26A 1HT1E 4J4NA 4MTVA 1LV7A 1KSFX 1LL6A 4DT4A 5FTJA 3SARA 2XFSA 1VF8A 2O5RA 3U6QA 5ITUA 2ZQTA 2A3EA 4GKJM 4DROA 5HWBA 5GQBA 4MGYE 5DYIA 2RURA 1BL4A 1EDQA 2KFWA 4WIWA 4ZPWR 3PNVA 1T3TA 1JR3A 2AHMA 4IIWA 5HKGA 1IQPA 1SXJB 2BJWA 2CE7A 1Q39A 2QCUA 3GLIA 1UR8A 3RM9A 3NRKA 3KOZE 1A7XA 3GLGA 2ESCA 1LJYA 4IT4A 1G4AE 3J7AS 2ZAMA 4JI8M 2F21A 4II7A 2C9CA 2H1RA 1FKBA 1XNRM 4G4QA 3CF0A 2QPAA 4NXNM 3TWKA 4Q22A 1IBKM 1L2CA 2C96A 4FWHA 4OVZA 3R9XB 2LPVA 4GMQA 3H4MA 3QOKA 4W5UA 1ZCNA 4GITA 1EYMA 3U5ZB 1FKIA 2XEPA 1TCOC 3SYLA 3FXYA 3ODKA 3RMEA 1XNQM 2QBYA 5EP2A 1R2ZA 3M0EA 4LGXA 3HJSA 3OOBA 5FTNA 1ROTA 3I4VA 2M60A 4IBIA 2OFNA 4JI7M 1E6PA 4TUWA 1FAPA 3VKHA 2F4EA 4LRTA 4G4RA 1NNUC 1W9VA 2DHRA 3K1JA 5EQTA 3FUUA 1NSGA 2PV1A 1GLNA 5EP3A 4LAYA 3CGMA 2ZM6M 4KR0B 3TCZA 4FWGA 4QHSA 2F2DA 1OFHA 3T1YM 4TW8A 2C9OA 3TWMA 1NJFA 1W1VA 2LWXA 1QVRA 5EJCA 4GH9A 3LVWA 3GQ5A 3ARSA 4AY1A 4MM3B 1R7RA 2G5GX 3A98B 2DG4A 3WHKA 1QZ2A 2WLZA 2XP7A 1Y0OA 2PBCA 1E6NA 3AS0A 3CH9A 3AROA 5DF0A 4NSRA 3J27B 3H9RB 4PD2A 2XLJA 3KCEA 4BF8A 4DH0A 3KS4A 3KOXE 1L2DA 2F5NA 3GPPA 4M9ZA 3L25A 1JVWA 2XP3A 3O5GA 2AOSA 4L8RC 2MNTA 2XP9A 3CHCA 3GP1A 2UXCM 3B8SA 1N75A 2A3CA 4LGMA 1J7KA 3ARUA 1FFRA 1LG1A 4LF9M 2VN1A 2BNKA 1S3SA 3U6PA 4ODRA 2V1CA 2X8AA 1ZQ9A 5GKNA 4IBFA 4LFAM 4JI0M 2DWMA 1NMWA 3AS1A 3EIEA 2A5YB 1HKKA 4LY6A 3SMSA 3VLFB 3SATA 1Q1CA 1IN7A 3AS3A 5EP1A 4CISA 3U6EA 1D2KA 1OGGA 5ITTA 1IXZA 3I6CA 3PRDA 4MGVA 1RD6A 4IJEA 2R62A 3RGSA 4GIVA 1DGHB 2M2AA 4IBJA 3SAVA 3UMMA 3FYCA 3IK8A 5KPRA 5A2QS 1QYRA 3B9PA 3TWLA 2KXEA 3SAUA 2F5QA 3TQSA 3OA5A 3UQIA 5I98A 3G6MA 4MGIE 1N34M 5JI2E 4X65M 1QQWA 1YE9A 1NH6A 5HTGA 2DSZA 4U86A 3KP0E 2J7NA 2RKOA 3K92A 3GQ3A 1HJWA 2LJ4A 1FJDA 3D8BA 1WNOA 1ZBCA 2YNMD 4XGIA 4QNMA 1IN6A 1F8AB 3W0LB 4MNMA 4DWSB 1NMVA 1NWRA 3HU1A 4L15A 3PNYA 3HU2A 4KQZA 4DIPA 2UUAM 4B3MM 2I7PA 4MNLA 4HBOA 3B9DA 3L28A 2KGJA 4KO8A 2ZR4A 2I7NA 4JFLA 4DV5M 2X49A 2L09A 1NY6A 3E9SA 4AKHA 2PI6A 1IN4A 1E15A 2RUCA 2KZSA 2Y21A 3O5RA 4DV4M 4MGHA 5IT9S 3I51A 2MF9A 2DPEA 2G8LA 3U5ZA 4G4OA 3U6DA 2KO7A 2G41A 2DT0A 2PV2A 4IQ2A 2V1UA 3ARXA 1FKHA 1UR9A 1E6RA 1G3IA 5LMUM 3PRBA 1KT1A 4Z2KA 4QNRA 2R45A 3DFZA 3RE8A 3SFZA 4LAWA 5GPGA 4MH0E 4YY3M 2DT3A 3SHFA 1GL6A 4OX9M 3HWSA 5ITQA 3JAMS 3CHEA 4JFMA 1IBMM 1W5SA 4J4OA 4IJFA 4GC9A 3DOAA 2EUCA 1U79A 2JA2A 2DWLA 1E9SA 3I4YA 4FCWA 1HKMA 4URIA 3TL4X 4DV3M 1EHNA 3J80S 3TC5A 5DYGA 4M9XA 4ODMA 1SXJC 3VK8A 3JR4A 1GKIA 3TDBA 3VDUA 4BBAA 1XXHA 4X64M 3SASA 3UZUA 3U6LA 2Y0QA 1LL4A 1ZL1A 4ODOA 2R4JA 3IHZA 1M5YA 3B7XA 4WW0A 2KEBA 4NRWA 2FOIC 4LAVA 1IY0A 2CV0A 1NWTA 1Q6UA 2ZQVA 4LF4M 1ZAEA 2D7GA 2Y0TA 4NRVA 5EXPA 1L1PA 5E6JA 5IREB 2RGHA 1OGBA 3O5JA 5DIVA 5DO2A 2LNHC 1T11A 3PRAA 7CATA 3ZH9B 3OTOM 3GO8A 4U84A 4NOOB 1IM2A 3GRVA 4JXJA 1I94M 3L29A 2MPHA 3BXWA 4HLQA 3UI4A 1ZBWA 3WQVA 2DG9A 4DR2M 4QT2A 3VFDA 2F5OA 1HXVA 1IY1A 3MDYB 4DR4M 3CF6E 4FCTA 2Q5AA 3KSXA 1KYIA 4B7GA 1IXRC 5KPTA 3AFHA 1XHBA 2D7EA 4GC5A 1NWSA 4LZJA 1E6ZA 5C1BA 1ZU8A 1HQYE 2BJVA 3UGJA 5ITRA 4I4LA 1L2BA 2L2SA 1C1KA 1FKKA 3HHWA 4NSBA 4DV6M 4DRIA 3GPKA 2VIIA 4LJAA 4B08A 3SAWA 3FUTA 1SYTA 3MJ5A 4P8WA 4WJXA 2G8ZA 2RSEA 1L1TA 2A3BA 1ROUA 3QWLA 1KFWA 4FWDA 5EXTA 3GPYA 3O5MA 5DITA 4IT6A 3L2AA 4B7HA 1P5QA 4MPKA 2Z3XA 4M0DA 2YBTA 4ML4A 4D80A 1PBKA 2M5ZA 3FYDA 3CGNA 2WM0A 1NVMA 2FFJA 1L1ZA 4JYAM 2CHGA 1PJIA 2FAPA 5HBFA 1F40A 4W5WA 3BOSA 3AJIB 2DZNB 2D7HA 3O5EA 4OVZB 3FTFA 1HJXA 4G6ZA 5FTKA 1NHWC 2XGNA 4L16A 2KI3A 3WD3A 3SC3A 1HKIA 4Z8XA 2KRUA 3U6CA 4DUYM 2ITKA 3O5DA 2XFTA 4DRJA 3EY6A 1I4WA 5EXSA 3CZ8A 4MSPA 3HHYA 2QBYB 1WAWA 2WK2A 3KADA 4P8XA 5FLXS 1TGUA 1FFQA 1W9UA 3ARVA 4LZZA 3NI6A 4Z2IA 3GLHA 5IZ7D 3RM4A 1Z5BA 4DR5M 1JNDA 1K82A 1QPFA 1W1YA 1X6LA 4W9PA 2FNAA 3MK6A 3VK7A 4GHLA 4IBCA 3FAPA 4Q7NA 2LH0A 3Q8XA 3PFIA 2RUQA 3ILKA 3SBJA 3U60A 1TFVA 3O5OA 2ZR6A 2YR0A 1HQCA 4CGYB 2OQ4A 3FKEA 1DO2A 3CTWB 5FTMA 4ODNA 2R46A 4JFKA 4JI5M 4QT3A 1XWIA 3CF2A 2QZ4A 3KDSE 2DXIA 4N19A 2R18A 3WD1A 1OFIA 4GIPA 4ODLA 1X37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5R A;  2XPA A;  1PIN A;  2FKE A;  2LGO A;  3KAI A;  2MF9 A;  4ODQ A;  4W9O A;  2KO7 A;  2XP4 A;  4DRM A;  2PV2 A;  4IQ2 A;  2JZV A;  1FKH A;  2PPO A;  3PRB A;  1FKR A;  1J4I A;  1KT1 A;  2M08 A;  1YAT A;  4J4N A;  4DRN A;  3O5P A;  4DT4 A;  1EQ3 A;  4LAW A;  5HW6 A;  2XP6 A;  2ZQT A;  5GPG A;  4DRO A;  5HWB A;  2RUD A;  2Y78 A;  2RUR A;  1BL4 A;  2KFW A;  5J6E A;  4IPX A;  4JFM A;  4DRK A;  5HKG A;  3VAW A;  4J4O A;  5B8I C;  1FKS A;  1U79 A;  3NRK A;  4JFI A;  4DZ2 A;  1A7X A;  3KAC A;  1Q6I A;  3TC5 A;  4W9Q A;  2F21 A;  3UQA A;  4ODM A;  1FKB A;  3RFW A;  4FN2 A;  3O5Q A;  3TDB A;  2DG3 A;  2MLX A;  3O5I A;  4ODO A;  2AWG A;  2MLY A;  3IHZ A;  2LPV A;  1M5Y A;  3JYM A;  4TYO A;  1FD9 A;  4DRP A;  3B7X A;  3O5K A;  3UI6 A;  4LAV A;  1ZCN A;  1EYM A;  1Q6U A;  1FKF A;  1FKI A;  1TCO C;  2ZQV A;  3ODK A;  3WH0 A;  3KAB A;  1FKD A;  1L1P A;  2KR7 A;  3JYJ A;  3KAG A;  3O5J A;  3UQB A;  3OOB A;  5DIV A;  1T11 A;  1ROT A;  1FKL A;  2D9F A;  2OFN A;  4U84 A;  1FAP A;  2MPH A;  2UZ5 A;  2F4E A;  3UI4 A;  5HW8 A;  2PV3 A;  5BXJ A;  4DRQ A;  2DG9 A;  2PV1 A;  4LAY A;  2N87 A;  1NSG A;  1BKF A;  1YW5 A;  3TCZ A;  3CGM A;  1HXV A;  3UF8 A;  2K8I A;  3MDY B;  1W26 A;  2F2D A;  4TW8 A;  3IKD A;  2Q5A A;  4U85 A;  3NTP A;  3O5L A;  1J4H A;  4TX0 A;  5D75 A;  4C02 B;  2DG4 A;  3LUO A;  2XP7 A;  3RGC A;  1QZ2 A;  1D7J A;  1Y0O A;  2PBC A;  2VCD A;  4TW7 A;  1J6Y A;  2ZQS A;  5HW7 A;  3KCE A;  3H9R B;  4BF8 A;  4DH0 A;  3PA7 A;  2L2S A;  1FKT A;  1QPL A;  1FKK A;  1JVW A;  2PPN A;  4JFJ A;  1JNS A;  4TW6 A;  2XP3 A;  3GPK A;  4ITZ A;  3O5G A;  2MNT A;  5DIU A;  4DRI A;  4DRH A;  1N1A A;  2XP9 A;  2ZR5 A;  2RSE A;  4R0X A;  1ROU A;  2XPB A;  4G50 A;  3O5M A;  5DIT A;  1P5Q A;  2VN1 A;  2RQS A;  4ODK A;  4ODR A;  5HWC A;  1D7I A;  1PBK A;  3UI5 A;  1NMW A;  3CGN A;  4GGQ A;  1B6C A;  2FAP A;  3JXV A;  1F40 A;  1D7H A;  1Q1C A;  4NNR A;  3I6C A;  3PRD A;  3O5E A;  4MGV A;  2KI3 A;  3KAH A;  4GIV A;  4G2P A;  2M2A A;  2ITK A;  3O5D A;  4QT2 A;  1FKG A;  4DRJ A;  2M1I A;  3EY6 A;  3IK8 A;  4IQC A;  3KZ7 A;  5HUA A;  4MSP A;  3UQI A;  5I98 A;  1D6O A;  2LKN A;  1FKJ A;  1C9H A;  3KAD A;  4LAX A;  3NI6 A;  5HTG A;  4U86 A;  1J4R A;  2ZQU A;  2KE0 A;  1QPF A;  2LJ4 A;  1FJD A;  4FAP A;  2XP8 A;  4JYS A;  4W9P A;  4DZ3 A;  2IF4 A;  1ZK6 A;  3IKG A;  3KAF A;  2PPP A;  3FAP A;  5HT1 A;  1R9H A;  4ODP A;  4QIB A;  2RUQ A;  1F8A B;  1NMV A;  4TNS A;  3O5O A;  2MLZ A;  2ZR6 A;  4DIP A;  1Q6H A;  1KT0 A;  4ODN A;  3O5F A;  4JFK A;  4QT3 A;  2KGJ A;  4N19 A;  2ZR4 A;  4JFL A;  1JNT A;  2RUC A;  4O2T A;  2XP5 A;  4ODL A; 
#chains in the Genus database with same CATH topology
 4ODQ A;  4R7G A;  3BBZ A;  1XHG A;  1J4I A;  4AZF A;  2OOA A;  4P16 A;  2UU9 M;  8CAT A;  2Y78 A;  2ERC A;  3B7N A;  5DFL A;  3FD9 A;  4R3D A;  1WGN A;  5B8I C;  1NJG A;  4M9S A;  1H0I A;  3FE3 A;  2CV1 A;  1FJG M;  5DEZ A;  3K2L A;  1FKD A;  3AL0 C;  4PDG A;  2DAG A;  3HJQ A;  2QF8 A;  3GPU A;  1BKF A;  4PDI A;  2DVW B;  3FTD A;  1J5E M;  4JI4 M;  2ZQS A;  2B31 A;  4P8U A;  1JNS A;  3C58 A;  1MJG M;  4DV0 M;  2F5S A;  2EA0 A;  4REZ A;  3HKP A;  3UI5 A;  1E9R A;  3KVW A;  1TTE A;  2QEN A;  2UUC M;  4DR1 M;  4FW9 A;  4DR3 M;  1HNZ M;  1FKG A;  1N32 M;  3ARP A;  4G4N A;  5BPV A;  4AKG A;  3HHX A;  4CHT B;  1J4R A;  5LMN M;  3WHL A;  3WD4 A;  1MX0 A;  3KSJ A;  3LW5 F;  4CIZ A;  3AOE C;  3GLH B;  4FCV A;  1R2Y A;  4GHA A;  3HY5 A;  2XZU A;  4W9O A;  2L2D A;  1PJJ A;  1E32 A;  4DV2 M;  1PM5 A;  2F23 A;  2DWN A;  2F5P A;  2DSW A;  2LTU A;  4KOD A;  1NHG C;  2CUZ A;  5J6E A;  3K8Z A;  1DGB A;  3KP1 E;  1XXH B;  1AIP C;  2MLX A;  4L4U A;  4LJ8 A;  1JCH B;  2YBU A;  1Z5A A;  2MGW A;  2KR7 A;  3W68 A;  4LF6 M;  2UZ5 A;  3RGP A;  5HW8 A;  3LVV A;  2W82 A;  4IBK A;  3UF8 A;  4IBB A;  2FDM A;  3IKD A;  5E26 A;  3IG8 A;  5IWA M;  4C02 B;  2EKF A;  1TH2 A;  5HW7 A;  2KNV A;  3FY1 A;  3SYK A;  1R6B X;  4AG6 A;  4ITZ A;  4LFC M;  2XPB A;  3GLF A;  1PRB A;  4HL4 A;  2HAK A;  2BWB A;  3B9E A;  4JI2 M;  1GOI A;  1B6C A;  4KLN A;  3JXV A;  4NSO B;  2WLY A;  1Y8G A;  4RF0 A;  3WL0 A;  3B9A A;  4PTM A;  1IX5 A;  4ZPX A;  1FKJ A;  1OQY A;  1C9H A;  1HT2 E;  2KNZ A;  3A42 A;  3QYB A;  1QAQ A;  4DWS D;  3C3D A;  1R9H A;  3A46 A;  4TNS A;  2MLZ A;  3KXE C;  3THG A;  3GLF E;  2XSZ D;  3NWL A;  2IUZ A;  2XP5 A;  2O9O A;  4ZS6 A;  3KAI A;  3LMM A;  1L8Q A;  4JN6 A;  4MTV A;  1LV7 A;  1LL6 A;  4DT4 A;  4DRO A;  1YLA A;  2O5R A;  5ITU A;  1OAI A;  2A3E A;  4GKJ M;  5DYI A;  1BL4 A;  1EDQ A;  1JR3 A;  3GLI A;  3NRK A;  1VEK A;  1A7X A;  2ESC A;  2ZAM A;  4JI8 M;  2H1R A;  4G4Q A;  4Q22 A;  4FWH A;  3CGW A;  4GMQ A;  1ZCN A;  1FKI A;  1TCO C;  3SYL A;  1XNQ M;  3M0E A;  5FTN A;  4IBI A;  1E6P A;  1FAP A;  3FRH A;  4G4R A;  1NNU C;  4R71 A;  4LAY A;  5EQT A;  1NSG A;  2ZM6 M;  4FWG A;  4TW8 A;  1NJF A;  2LWX A;  4GH9 A;  3LVW A;  4UN2 B;  3ARS A;  2DG4 A;  1CUK A;  4DWS C;  3WHK A;  1QZ2 A;  4BF8 A;  4M9Z A;  2CWB A;  2CP8 A;  2A3C A;  3ARU A;  1LG1 A;  2BNK A;  3U6P A;  4ODR A;  4LFA M;  3SMS A;  3PRD A;  4MGV A;  1DGH B;  4IBJ A;  3SAV A;  3UMM A;  2PN0 A;  4IQC A;  5A2Q S;  3TWL A;  1N34 M;  1NH6 A;  2LHG A;  3KP0 E;  2YNM D;  4QNM A;  1IXS A;  1IN6 A;  1F8A B;  3HU1 A;  4L15 A;  3HU2 A;  4MNL A;  4HBO A;  3L28 A;  2KGJ A;  2I7N A;  2L09 A;  4AKH A;  2Y21 A;  2DT0 A;  1FKH A;  1NV8 A;  3PRB A;  1GJT A;  5LMU M;  4Z2K A;  4QNR A;  4RKU F;  3RE8 A;  4LAW A;  3SHF A;  1GL6 A;  4JFM A;  1IBM M;  4J4O A;  2DHY A;  2JA2 A;  3TC5 A;  4M9X A;  4ODM A;  3VDU A;  3SAS A;  3U6L A;  2Y0Q A;  1ZL1 A;  2CV0 A;  2Y0T A;  2JY8 A;  1L1P A;  5E6J A;  3O5J A;  3PRA A;  3ZH9 B;  3BXW A;  1IY1 A;  3MDY B;  3KSX A;  3AFH A;  2D7E A;  5ITR A;  1L2B A;  3HHW A;  3GPK A;  3I04 M;  2RSE A;  1L1T A;  1V92 A;  3FYD A;  2WM0 A;  1L1Z A;  1PJI A;  1F40 A;  3FTF A;  1R5L A;  5JH8 A;  3SC3 A;  4Z8X A;  3U6C A;  4DRJ A;  3EY6 A;  2WK2 A;  1GJS A;  1FFQ A;  2WSF F;  1JND A;  1K82 A;  1X6L A;  2FNA A;  3VK7 A;  3FKE A;  1VG5 A;  3LCV B;  4QT3 A;  4JI5 M;  2DXI A;  1X37 A;  1ZBK A;  2C99 A;  3FUW A;  3UJN A;  1YAT A;  1XRV A;  3U6M A;  4LG2 A;  3U61 B;  2DT1 A;  3AKZ A;  1ZMV A;  1Z5C A;  1FKS A;  1PGY A;  4FN2 A;  1Z6T A;  4LJ4 A;  2UXB M;  3T38 A;  2ZTC A;  3JYM A;  1GUV A;  4DRP A;  3UI6 A;  2KZU A;  1NY5 A;  2CEA A;  4MB7 A;  3KAG A;  4QHT A;  3DA1 A;  4U85 A;  3O5L A;  2VF7 A;  2UXD M;  3RGC A;  1D7J A;  4MNJ A;  4QOZ C;  2OLH A;  2EO2 A;  1ORY B;  1MN3 A;  2ZAO A;  1IXS B;  1Z59 A;  3LQQ A;  2XH9 A;  3GLG B;  2JY7 A;  4JV5 M;  5EXX A;  2YFQ A;  1Q3B A;  2A3A A;  5ITY A;  1SXJ A;  3KAH A;  4BLC A;  4PCZ A;  2M1I A;  5JI3 E;  5HUA A;  4LAX A;  2Q2E B;  1EIB A;  2ZQU A;  3FTC A;  1ZK6 A;  5HT1 A;  4ODP A;  4L78 A;  3QAU A;  1QAN A;  1QDR A;  2HL7 A;  1QAO A;  3ZQJ A;  3HU3 A;  4X66 M;  1SXJ E;  1VDL A;  2JZV A;  1DGH A;  1QAM A;  4LGY A;  2WSC F;  4BB9 A;  3ART A;  2L7I A;  1KFV A;  1O6I A;  4YHH M;  3DZD A;  4MGZ E;  1OWQ A;  3B7Z A;  3SMP A;  3TE6 A;  3VAW A;  4D81 A;  4JFI A;  1XB2 B;  1E44 A;  2DSU A;  3RFW A;  1T43 A;  4B3T M;  3O5Q A;  3IHP A;  1JQJ C;  2LVA A;  1G8P A;  2AWG A;  2J7O A;  1NSF A;  3JYJ A;  3T15 A;  4EIW A;  2PV3 A;  2NQ8 C;  4JI1 M;  3ARR A;  2DEN A;  4LFB M;  5D75 A;  3LUO A;  4TW7 A;  1D0M A;  4G3O A;  3PA7 A;  1FKT A;  5DIU A;  4DRH A;  2C5R A;  1XMO M;  2ZR5 A;  3E4R A;  4HEO A;  3HJ8 A;  4LJ5 A;  2DWZ B;  1SXJ D;  1Q3C A;  3RM8 A;  3L27 A;  4G2P A;  3ARW A;  4QT2 A;  4DR7 M;  2CHV A;  2VDB B;  4AW4 A;  1TH4 A;  1W9P A;  1HKJ A;  1K3X A;  1GVN A;  3U61 A;  2IF4 A;  3IKG A;  3SHG B;  1UM8 A;  1NNJ A;  5GPR A;  3O5F A;  2RRU A;  4LJ7 A;  2JP7 A;  2HHH M;  4JI3 M;  2K6B A;  2XPA A;  3NBX X;  3TPZ A;  2QP9 X;  3L26 A;  1HT1 E;  3SAR A;  2XFS A;  2KFW A;  4ZPW R;  1T3T A;  5HKG A;  1SXJ B;  2BJW A;  2QCU A;  3RM9 A;  3KOZ E;  1LJY A;  2QPA A;  1L2C A;  2C96 A;  3ODK A;  4GIT A;  2LHC A;  4LGX A;  3HJS A;  2H5X A;  3LCU A;  1ROT A;  4TUW A;  4LRT A;  3K1J A;  2PV1 A;  4WKH A;  3CGM A;  2C9O A;  3TWM A;  1ZMW A;  5EJC A;  3GQ5 A;  4AY1 A;  3A98 B;  2XP7 A;  1EIJ A;  2K9D A;  2XLJ A;  3KOX E;  3L25 A;  3O5G A;  2MNT A;  4L8R C;  3CHC A;  4WP2 A;  2V1C A;  4JI0 M;  2DWM A;  1Q1C A;  4NNR A;  1D2K A;  3I6C A;  3U6E A;  1RD6 A;  4IJE A;  2R62 A;  3IK8 A;  4P17 A;  5KPR A;  3OA5 A;  2F5Q A;  5I98 A;  3G6M A;  2DSZ A;  4U86 A;  3K92 A;  1FJD A;  3D8B A;  4XGI A;  2O25 A;  2WSE F;  1NMV A;  3PNY A;  1PJQ A;  4B3M M;  4KO8 A;  4DV5 M;  2X49 A;  2PI6 A;  1IN4 A;  1WR1 B;  3O5R A;  2DPE A;  3U5Z A;  4G4O A;  2KO7 A;  2V1U A;  1Q02 A;  2ZTD A;  1E6R A;  1KT1 A;  2R45 A;  3SFZ A;  5GPG A;  4YY3 M;  1U79 A;  2EUC A;  3TL4 X;  4DV3 M;  5DYG A;  2DAI A;  3VK8 A;  2JZ1 A;  1XXH A;  3B89 A;  3B7X A;  4WW0 A;  4LAV A;  1NWT A;  5L8R F;  2ZQV A;  4LF4 M;  1TF0 B;  5IRE B;  1OGB A;  5DO2 A;  2LNH C;  1OKS A;  4NOO B;  3GRV A;  4JXJ A;  1I94 M;  3WQV A;  1ZBW A;  4GEW A;  4DR2 M;  3CF6 E;  4FCT A;  2Q5A A;  1QUT A;  1NV9 A;  1ZU8 A;  1E6Z A;  5C1B A;  2BJV A;  3F92 A;  4I4L A;  2L2S A;  4DV6 M;  4LJA A;  4B08 A;  4Y28 F;  2A3B A;  4Q7J A;  1P5Q A;  2DKL A;  2Z3X A;  2LBC A;  1PBK A;  1NVM A;  2FFJ A;  1QUS A;  2D7H A;  4OVZ B;  4G6Z A;  2XGN A;  4L16 A;  1HKI A;  2ITK A;  3O5D A;  1WHC A;  4MSP A;  3HHY A;  2FS1 A;  3KAD A;  2QQ8 A;  4P8X A;  2L4F A;  1TGU A;  5FLX S;  3GLH A;  5IZ7 D;  1Z5B A;  4DR5 M;  1QPF A;  1PJT A;  3MK6 A;  3PFI A;  2RUQ A;  2ZR6 A;  2YR0 A;  1HQC A;  1DO2 A;  4JFK A;  4N19 A;  2LVN C;  2QZ4 A;  3HX3 A;  1W1T A;  4ODL A;  4FD2 A;  4JI6 M;  1HJV A;  3D8L A;  3PVS A;  1IBL M;  2XP4 A;  3FRI A;  2HCB A;  2PPO A;  2EUL A;  3R8F A;  2M08 A;  1D0L A;  1N36 M;  2JWS A;  2Z7J A;  2Z4S A;  4DRN A;  3O5P A;  1BVS A;  2XP6 A;  5HW6 A;  1D2N A;  3W67 A;  1J09 A;  3GLF B;  3PR9 A;  3Q8G A;  1GL7 A;  1XC8 A;  3UQA A;  1W5T A;  4XBO A;  1PJS A;  3O5I A;  3W0F A;  3C9P A;  3O5K A;  4I8O A;  4WKF A;  2DNA A;  3CHF A;  4WK9 A;  3W4R A;  3VDP A;  1G41 A;  2D9F A;  4RNA A;  2LVP C;  4QZV B;  1DGG A;  2K8I A;  1H6U A;  1W26 A;  2MR9 A;  3NTP A;  2DI0 A;  1N77 A;  4TX0 A;  2APL A;  1DO0 A;  5H37 D;  1EE8 A;  2ZBK B;  1IY2 A;  4AI6 A;  1EFU B;  3WQW A;  1V33 A;  1ZBV A;  3EIP A;  5C18 A;  4LRS A;  2C98 A;  4IBD A;  1N78 A;  4QOS A;  3JR5 A;  1A5T A;  1OAO C;  1ZV1 A;  4B3S M;  2KRK A;  2GNO A;  1MU5 A;  1D6O A;  1HNX M;  2XP8 A;  4ANR A;  4NL4 H;  1G59 A;  3WD2 A;  2RGO A;  2WZJ A;  2F4V M;  3B74 A;  4AKI A;  1KT0 A;  4RF1 A;  3WKZ A;  3FUV A;  3CHD A;  2LXE A;  1PIN A;  1GO5 A;  1WXQ A;  3ZCB B;  1YUB A;  1EQ3 A;  4PT5 A;  2L6O A;  2GQF A;  1K9T A;  2XF3 A;  3KOY E;  4NZC A;  4F1I A;  2G3Q A;  5KQD A;  1G71 A;  5EP4 A;  4Z2J A;  4TYO A;  1HR0 M;  4I81 A;  4DR6 M;  3WH0 A;  1W1P A;  2KW0 A;  2OPF A;  4FVM A;  1X6N A;  3FUX A;  5KQ8 A;  3VKG A;  4HBE A;  2K47 A;  1V34 A;  4R5E A;  2N87 A;  1YW5 A;  5KPZ A;  2CFO A;  2B5U B;  4X62 M;  3J7B A;  2VCD A;  3ZC7 B;  1QZM A;  3LQR A;  3WD0 A;  4LF7 M;  4TW6 A;  1JR3 D;  3GRR A;  4MGK E;  3U60 B;  2V6Z M;  2Y20 A;  1D7I A;  2BWE A;  4LJ9 A;  3AQU A;  1D7H A;  2DZO B;  4B3R M;  1LG2 A;  1N33 M;  3GRU A;  2KA6 B;  2XZF A;  3ALF A;  1IN8 A;  1C7Y A;  2UUB M;  3KS8 A;  1SR0 A;  2FH0 A;  1ZB5 A;  4DWS A;  3KAF A;  4IBE A;  4AQY M;  2MJ5 B;  3IG5 A;  5FTL A;  4D82 A;  3AS2 A;  2VQF M;  1Q6H A;  4DV7 M;  2O01 F;  4XAK A;  2XSZ A;  4Z6Y A;  3M7G A;  4Z2H A;  2FKE A;  1XXH E;  4DRM A;  5FTJ A;  1VF8 A;  1OIP A;  2ZQT A;  4MGY E;  2RUR A;  4WIW A;  3E46 A;  4IIW A;  3PNV A;  2AHM A;  2CE7 A;  1UR8 A;  3K9P A;  3H4J A;  1DV0 A;  3GLG A;  4IT4 A;  3J7A S;  2C9C A;  1XNR M;  1GRJ A;  3CF0 A;  4NXN M;  3TWK A;  3V76 A;  3R9X B;  3H4M A;  1RU3 A;  4W5U A;  3FXY A;  2XEP A;  2QBY A;  5EP2 A;  1R2Z A;  3OOB A;  2Z8Y M;  4JI7 M;  1W9V A;  3FUU A;  3TCZ A;  4L6V 6;  1QVR A;  4MM3 B;  1R7R A;  2G5G X;  2PBC A;  3CH9 A;  3ARO A;  4DH0 A;  3H9R B;  4PD2 A;  3KS4 A;  1JVW A;  1L2D A;  3GPP A;  2AOS A;  1OTR A;  2J5Y A;  3GP1 A;  3B8S A;  1N75 A;  4LGM A;  2EKK A;  1FFR A;  2VN1 A;  2X8A A;  1ZQ9 A;  5GKN A;  2MRO B;  3EIE A;  3VLF B;  1IN7 A;  5EP1 A;  1OGG A;  1VEJ A;  5ITT A;  3RGS A;  3FYC A;  3SAU A;  2KXE A;  4MGI E;  5JI2 E;  1QQW A;  1YE9 A;  2J7N A;  2RKO A;  3GQ3 A;  1HJW A;  2LJ4 A;  1WNO A;  1ZBC A;  4MNM A;  3W0L B;  4DIP A;  4KQZ A;  2I7P A;  4JFL A;  2RUC A;  1NY6 A;  3E9S A;  1ZMU A;  1E15 A;  2KZS A;  2KNA A;  4MGH A;  5IT9 S;  3I51 A;  2G8L A;  3U6D A;  3ARX A;  1UR9 A;  1G3I A;  2DT3 A;  4OX9 M;  5ITQ A;  3JAM S;  1E9S A;  3I4Y A;  4FCW A;  1HKM A;  4URI A;  3T6P A;  1SXJ C;  1GKI A;  3TDB A;  3UZU A;  4ODO A;  2R4J A;  3IHZ A;  1TR8 A;  1M5Y A;  4CJ6 A;  2KEB A;  4NRW A;  1IY0 A;  1ZAE A;  2D7G A;  4NRV A;  2RGH A;  5DIV A;  1T11 A;  7CAT A;  3GO8 A;  2MPH A;  3UI4 A;  2F5O A;  3GLG E;  2JY6 B;  5KPT A;  1QZE A;  1XHB A;  4GC5 A;  1HQY E;  1C1K A;  3SAW A;  2B3T A;  1SYT A;  1T6O A;  4P8W A;  2ETN A;  3QWL A;  1WJ7 A;  2R6F A;  4FWD A;  5EXT A;  3GPY A;  3O5M A;  5DIT A;  4ML4 A;  4IT6 A;  3L2A A;  3QYE A;  4MPK A;  2M5Z A;  3CGN A;  4JYA M;  2CHG A;  4W5W A;  3BOS A;  3O5E A;  1HJX A;  5FTK A;  3WD3 A;  2DZL A;  2XFT A;  5EXS A;  2R44 A;  2MH8 A;  3NI6 A;  4Z2I A;  2DAK A;  3RM4 A;  1W1Y A;  1JB0 F;  4W9P A;  4GHL A;  3FAP A;  4Q7N A;  2HWJ A;  3U60 A;  4CGY B;  3CTW B;  5FTM A;  2R46 A;  3CF2 A;  3WD1 A;  1OFI A;  4GIP A;  4L3N A;  1YSY A;  4K0K M;  1K3W A;  4LF5 M;  3C3E A;  4WUR A;  4ZPV R;  2P5T A;  4DRK A;  2YQZ A;  3U6O A;  2JNH A;  1Q6I A;  4W9Q A;  2R4E A;  2P4V A;  2HKJ A;  4OW0 A;  1F4I A;  2DSV A;  1LQ0 A;  4L72 B;  1WB0 A;  1XMQ M;  3ALG A;  1FKL A;  1R4G A;  4B7F A;  4S12 A;  4DV1 M;  1HNW M;  4KHP M;  4DUZ M;  5BXJ A;  4GKK M;  3ARY A;  1D0K A;  3ARZ A;  1J4H A;  4OU7 A;  1TDZ A;  1J6Y A;  4Z2G A;  5DNY A;  1QPL A;  2PPN A;  4JFJ A;  3WL1 A;  4ZPT R;  1N1A A;  1NWU A;  4R0X A;  3GRY A;  4G50 A;  1LTM A;  1LL7 A;  4ODK A;  5HWC A;  2ZAN A;  4GGQ A;  2VF8 A;  5BR8 M;  3AOG A;  3NBI A;  5FSW A;  3GQ4 A;  3GU0 A;  4Z2L A;  4M0W A;  3KW6 A;  5ITX E;  2LKN A;  2JY5 A;  3WIJ A;  4NXM M;  3IEC A;  4LCB A;  2KE0 A;  3K9O A;  3GLI B;  4JYS A;  4AG5 A;  4DZ3 A;  2PPP A;  2CHQ A;  4QIB A;  4IBG A;  4LJ6 A;  3GPX A;  4WKA A;  3HGI A;  1JNT A;  2OOB A;  3MHV C;  2LGO A;  2Z4R A;  1DGF A;  3G6L A;  2E5L M;  3ARQ A;  2X4A A;  2RUD A;  1CTN A;  2R65 A;  4IPX A;  4KT0 F;  1P3Q Q;  4DZ2 A;  3KAC A;  4I5S A;  3EIH A;  1FNN A;  2DG3 A;  3GLI E;  2MLY A;  4P8V A;  3HHZ A;  4MAV A;  1FD9 A;  2EJS A;  4S3K A;  2CV2 A;  1FKF A;  3KOW E;  3KAB A;  3UQB A;  3FTE A;  5F3W A;  2OO9 A;  1JNE A;  1E9L A;  4DRQ A;  1IN5 A;  3GTY X;  2DT2 A;  4HAR A;  1OJL A;  2JZ0 A;  5KO3 A;  3KFU G;  2FE8 A;  4UDM A;  1VDD A;  1E94 E;  4S3J A;  2RQS A;  3UK6 A;  4A3V B;  1GPF A;  3AOE A;  2LVO C;  4GRI A;  3J2P B;  4LF8 M;  2O92 A;  2VQE M;  4MNK A;  3AV0 A;  1TDH A;  1TH3 A;  3KZ7 A;  2L7H A;  4F2L A;  1GAB A;  3U6S A;  1ITX A;  4FAP A;  3T1H M;  3M6A A;  1WIV A;  2QNJ A;  3PXG A;  4O2T A;  3A45 A;  1OIZ A;  1H0G A;  3J81 S;  1SG9 A;  5ITX A;  4ITQ A;  1FKR A;  4J4N A;  1KSF X;  5HWB A;  3U6Q A;  5GQB A;  2KDL A;  1AUA A;  1IQP A;  1Q39 A;  1G4A E;  2F21 A;  4II7 A;  1FKB A;  4XK8 F;  1IBK M;  4OVZ A;  2LPV A;  2JXN A;  3HZJ A;  3QOK A;  1EYM A;  3RME A;  3U5Z B;  1VEG A;  3E21 A;  3I4V A;  2M60 A;  2OFN A;  3VKH A;  3BMB A;  2F4E A;  2DHR A;  1GLN A;  5EP3 A;  4KR0 B;  4QHS A;  2F2D A;  1OFH A;  3T1Y M;  1W1V A;  2WLZ A;  3AS0 A;  4DBG B;  1Y0O A;  1HJP A;  2LVQ D;  1E6N A;  5DF0 A;  4NSR A;  3J27 B;  3KCE A;  1NO1 A;  2F5N A;  2XP3 A;  2XP9 A;  2UXC M;  1J7K A;  4LF9 M;  1S3S A;  1QDT A;  2QSF X;  4IBF A;  1NMW A;  3AS1 A;  2A5Y B;  1HKK A;  4LY6 A;  2N35 A;  3SAT A;  3AS3 A;  4CIS A;  1IXZ A;  2K0B X;  4GIV A;  1JR3 E;  2M2A A;  1QYR A;  3B9P A;  3UQI A;  3TQS A;  4X65 M;  5HTG A;  4DWS B;  1NWR A;  2UUA M;  3I01 M;  3B9D A;  2DAE A;  2ZR4 A;  4DV4 M;  2MF9 A;  2G41 A;  2PV2 A;  4IQ2 A;  2DAM A;  3DFZ A;  4MH0 E;  3HWS A;  3MMP A;  2JUJ A;  1VQ1 A;  3CHE A;  1W5S A;  4IJF A;  4GC9 A;  3DOA A;  2DWL A;  3GLH E;  1EHN A;  3J80 S;  3JR4 A;  4BBA A;  4X64 M;  1LL4 A;  2FOI C;  1Q6U A;  5EXP A;  2CRU A;  3OTO M;  4U84 A;  2QHO B;  1WGL A;  1IM2 A;  3L29 A;  3B7Q A;  4HLQ A;  2DG9 A;  1HXV A;  3VFD A;  4DR4 M;  2KHH A;  1KYI A;  4B7G A;  1IXR C;  1UFZ A;  1NWS A;  4LZJ A;  3UGJ A;  1FKK A;  4NSB A;  4DRI A;  2VII A;  3FUT A;  3MJ5 A;  4WJX A;  2G8Z A;  1ROU A;  1KFW A;  1IFY A;  4B7H A;  4M0D A;  2YBT A;  4D80 A;  5HBF A;  2FAP A;  3AJI B;  2DZN B;  2KI3 A;  1NHW C;  2KRU A;  4DUY M;  1I4W A;  3CZ8 A;  2QBY B;  1WAW A;  2L4E A;  1W9U A;  3ARV A;  4LZZ A;  4IBC A;  2LH0 A;  3Q8X A;  3ILK A;  3SBJ A;  1TFV A;  3O5O A;  2R0I A;  2OQ4 A;  4ODN A;  1XWI A;  3KDS E;  4NC6 A;  2R18 A; 
#chains in the Genus database with same CATH homology
 4L3N A;  4FD2 A;  4ODQ A;  4JI6 M;  1HJV A;  3D8L A;  3PVS A;  1IBL M;  4R7G A;  1YSY A;  1ZBK A;  2XP4 A;  2C99 A;  4K0K M;  3FUW A;  2HCB A;  2PPO A;  1XHG A;  1J4I A;  1K3W A;  3UJN A;  3R8F A;  1N36 M;  1YAT A;  4LF5 M;  2Z7J A;  4AZF A;  1XRV A;  2M08 A;  2Z4S A;  4DRN A;  3O5P A;  4P16 A;  3U6M A;  5HW6 A;  2XP6 A;  2UU9 M;  8CAT A;  4WUR A;  4DWS C;  1D2N A;  2Y78 A;  4LG2 A;  4ZPV R;  2ERC A;  2P5T A;  3U61 B;  4DRK A;  2DT1 A;  2YQZ A;  3FD9 A;  4R3D A;  1J09 A;  3GLF B;  3AKZ A;  3U6O A;  3PR9 A;  5B8I C;  1Z5C A;  1FKS A;  1GL7 A;  1NJG A;  4M9S A;  1Q6I A;  1XC8 A;  4W9Q A;  2R4E A;  3UQA A;  1H0I A;  1W5T A;  1Z6T A;  4XBO A;  4FN2 A;  4LJ4 A;  3O5I A;  2UXB M;  3T38 A;  2CV1 A;  3JYM A;  1GUV A;  3W0F A;  2HKJ A;  1IX5 A;  4DRP A;  4OW0 A;  4I8O A;  3O5K A;  1FJG M;  3UI6 A;  4WKF A;  2DSV A;  1LQ0 A;  2KZU A;  1NY5 A;  3CHF A;  5DEZ A;  3K2L A;  2CEA A;  1FKD A;  1WB0 A;  4L72 B;  4WK9 A;  4MB7 A;  3KAG A;  3W4R A;  4QHT A;  1XMQ M;  3VDP A;  3AL0 C;  4PDG A;  1G41 A;  1FKL A;  2D9F A;  4RNA A;  3ALG A;  3HJQ A;  4B7F A;  4S12 A;  4DV1 M;  2QF8 A;  1HNW M;  4KHP M;  4DUZ M;  5BXJ A;  3GPU A;  4GKK M;  3ARY A;  1BKF A;  4QZV B;  3DA1 A;  1DGG A;  2K8I A;  4PDI A;  1H6U A;  1W26 A;  3ARZ A;  2DVW B;  4IQC A;  4U85 A;  3NTP A;  3O5L A;  1J4H A;  1N77 A;  4TX0 A;  4OU7 A;  3FTD A;  1DO0 A;  5H37 D;  1TDZ A;  1EE8 A;  1J5E M;  4JI4 M;  2UXD M;  1D7J A;  2ZBK B;  4QOZ C;  4MNJ A;  3RGC A;  2OLH A;  1IY2 A;  2ZQS A;  4Z2G A;  1J6Y A;  5DNY A;  2EO2 A;  1ORY B;  4AI6 A;  1QPL A;  2B31 A;  2PPN A;  4JFJ A;  4P8U A;  3WL1 A;  3WQW A;  2ZAO A;  4ZPT R;  1JNS A;  3C58 A;  4DV0 M;  1ZBV A;  5C18 A;  4LRS A;  2F5S A;  1N1A A;  2EA0 A;  1IXS B;  1Z59 A;  1NWU A;  4R0X A;  2C98 A;  3GRY A;  3LQQ A;  4IBD A;  4G50 A;  4REZ A;  1LL7 A;  2XH9 A;  3HKP A;  4ODK A;  3GLG B;  5HWC A;  1N78 A;  1W1T A;  2ZAN A;  4QOS A;  3JR5 A;  1E9R A;  3KVW A;  2YFQ A;  5EXX A;  4JV5 M;  3UI5 A;  4GGQ A;  5BR8 M;  3AOG A;  3NBI A;  5FSW A;  1Q3B A;  4B3S M;  2A3A A;  2QEN A;  5ITY A;  2UUC M;  4DR1 M;  1SXJ A;  4FW9 A;  2KRK A;  3GQ4 A;  4BLC A;  3KAH A;  4DR3 M;  1MU5 A;  1HNZ M;  1FKG A;  4PCZ A;  2M1I A;  4M0W A;  4Z2L A;  3KW6 A;  5ITX E;  5JI3 E;  1N32 M;  5HUA A;  3ARP A;  4G4N A;  1D6O A;  2LKN A;  3WD2 A;  5BPV A;  3WIJ A;  4LAX A;  4NXM M;  1HNX M;  2Q2E B;  4LCB A;  4AKG A;  1EIB A;  3HHX A;  4CHT B;  1J4R A;  2KE0 A;  5LMN M;  3WHL A;  2ZQU A;  3FTC A;  3GLI B;  2XP8 A;  4AG5 A;  4JYS A;  4DZ3 A;  4NL4 H;  1ZK6 A;  5HT1 A;  2PPP A;  3WD4 A;  1MX0 A;  2CHQ A;  4ODP A;  4QIB A;  1G59 A;  3KSJ A;  4IBG A;  4LJ6 A;  4L78 A;  3AOE C;  2RGO A;  3GLH B;  4FCV A;  3QAU A;  3GPX A;  2F4V M;  4AKI A;  4WKA A;  1KT0 A;  4RF1 A;  3WKZ A;  3HGI A;  1QAN A;  1R2Y A;  3FUV A;  4GHA A;  3CHD A;  1JNT A;  3MHV C;  2LXE A;  2HL7 A;  2XZU A;  1PIN A;  2LGO A;  4W9O A;  1QAO A;  2Z4R A;  3HU3 A;  1WXQ A;  4X66 M;  1SXJ E;  1PJJ A;  1E32 A;  3ZCB B;  1DGH A;  2JZV A;  1DGF A;  1QAM A;  4DV2 M;  4LGY A;  3G6L A;  1PM5 A;  4BB9 A;  2DWN A;  2F5P A;  2DSW A;  2E5L M;  3ARQ A;  1YUB A;  3ART A;  1EQ3 A;  4KOD A;  2L6O A;  4PT5 A;  2L7I A;  2X4A A;  1NHG C;  2CUZ A;  2RUD A;  1KFV A;  1CTN A;  1O6I A;  4YHH M;  3DZD A;  1K9T A;  2R65 A;  2XF3 A;  3K8Z A;  4MGZ E;  5J6E A;  4IPX A;  1DGB A;  1OWQ A;  3SMP A;  3KP1 E;  3TE6 A;  3VAW A;  4D81 A;  1XXH B;  4JFI A;  4DZ2 A;  3KAC A;  3KOY E;  4NZC A;  4I5S A;  2DSU A;  3RFW A;  3EIH A;  1FNN A;  4B3T M;  3O5Q A;  2DG3 A;  4L4U A;  2MLX A;  1JQJ C;  5KQD A;  4LJ8 A;  4NNR A;  1G8P A;  5EP4 A;  2AWG A;  2MLY A;  2YBU A;  3HHZ A;  4P8V A;  4Z2J A;  2J7O A;  1HR0 M;  1FD9 A;  4MAV A;  4TYO A;  4I81 A;  4S3K A;  1Z5A A;  2CV2 A;  4DR6 M;  1FKF A;  1NSF A;  2KW0 A;  3KOW E;  1W1P A;  3KAB A;  2OPF A;  3WH0 A;  4FVM A;  1X6N A;  3FUX A;  2KR7 A;  3JYJ A;  3T15 A;  3FTE A;  3UQB A;  5F3W A;  5KQ8 A;  3VKG A;  4HBE A;  4LF6 M;  1JNE A;  4EIW A;  2K47 A;  1E9L A;  2UZ5 A;  3RGP A;  5HW8 A;  2PV3 A;  2NQ8 C;  3LVV A;  4JI1 M;  4DRQ A;  2W82 A;  2N87 A;  4R5E A;  1IN5 A;  4IBK A;  1YW5 A;  3ARR A;  5KPZ A;  3UF8 A;  4IBB A;  2FDM A;  3IKD A;  4LFB M;  5E26 A;  3IG8 A;  2CFO A;  5IWA M;  5D75 A;  4X62 M;  3LUO A;  4C02 B;  3J7B A;  2DT2 A;  2VCD A;  1TH2 A;  4HAR A;  4TW7 A;  5HW7 A;  3ZC7 B;  1QZM A;  1OJL A;  3PA7 A;  3LQR A;  3WD0 A;  1FKT A;  5KO3 A;  4LF7 M;  3FY1 A;  3SYK A;  3KFU G;  2FE8 A;  1R6B X;  4AG6 A;  4ITZ A;  2C5R A;  4TW6 A;  5DIU A;  4DRH A;  1JR3 D;  1VDD A;  3GRR A;  1E94 E;  1XMO M;  4LFC M;  2ZR5 A;  4S3J A;  4MGK E;  3U60 B;  2V6Z M;  2Y20 A;  2XPB A;  3GLF A;  3E4R A;  2RQS A;  3UK6 A;  4A3V B;  1D7I A;  1GPF A;  3HJ8 A;  4HL4 A;  4LJ9 A;  3B9E A;  4LJ5 A;  4JI2 M;  3AOE A;  1GOI A;  1B6C A;  2DWZ B;  1SXJ D;  4KLN A;  3JXV A;  4NSO B;  2WLY A;  1D7H A;  3AQU A;  4GRI A;  3J2P B;  1Q3C A;  2DZO B;  3RM8 A;  3L27 A;  4RF0 A;  4B3R M;  1LG2 A;  3WL0 A;  1N33 M;  3B9A A;  3GRU A;  4LF8 M;  2KA6 B;  2XZF A;  3ARW A;  2O92 A;  2VQE M;  4G2P A;  4PTM A;  3ALF A;  4DR7 M;  4MNK A;  3AV0 A;  1TDH A;  1IN8 A;  1TH3 A;  2CHV A;  4ZPX A;  3KZ7 A;  2UUB M;  1FKJ A;  1C9H A;  3KS8 A;  4AW4 A;  1TH4 A;  1HT2 E;  2L7H A;  1HKJ A;  1W9P A;  1SR0 A;  1K3X A;  1GVN A;  1ZB5 A;  3U6S A;  4DWS A;  5JH8 A;  3A42 A;  1ITX A;  4FAP A;  3U61 A;  1QAQ A;  3T1H M;  2IF4 A;  4DWS D;  3IKG A;  3KAF A;  4WKH A;  3SHG B;  4IBE A;  3M6A A;  1R9H A;  4AQY M;  3IG5 A;  3A46 A;  5FTL A;  1UM8 A;  1NNJ A;  5GPR A;  4TNS A;  4D82 A;  2MLZ A;  3KXE C;  3THG A;  3AS2 A;  2VQF M;  1Q6H A;  4DV7 M;  3O5F A;  2XSZ D;  3NWL A;  4LJ7 A;  2IUZ A;  2HHH M;  4JI3 M;  3PXG A;  4XAK A;  2XSZ A;  4O2T A;  4Z6Y A;  3M7G A;  3A45 A;  2XP5 A;  2O9O A;  4ZS6 A;  4Z2H A;  2XPA A;  2FKE A;  3KAI A;  1H0G A;  3J81 S;  4DRM A;  5ITX A;  4ITQ A;  1FKR A;  3LMM A;  3TPZ A;  1L8Q A;  4JN6 A;  2QP9 X;  3L26 A;  1HT1 E;  4J4N A;  4MTV A;  1LV7 A;  1KSF X;  1LL6 A;  4DT4 A;  5FTJ A;  3SAR A;  2XFS A;  1VF8 A;  2O5R A;  3U6Q A;  5ITU A;  2ZQT A;  2A3E A;  4GKJ M;  4DRO A;  5HWB A;  5GQB A;  4MGY E;  5DYI A;  2RUR A;  1BL4 A;  1EDQ A;  2KFW A;  4WIW A;  4ZPW R;  3PNV A;  1T3T A;  1JR3 A;  2AHM A;  4IIW A;  5HKG A;  1IQP A;  1SXJ B;  2BJW A;  2CE7 A;  1Q39 A;  2QCU A;  3GLI A;  1UR8 A;  3RM9 A;  3NRK A;  3KOZ E;  1A7X A;  3GLG A;  2ESC A;  1LJY A;  4IT4 A;  1G4A E;  3J7A S;  2ZAM A;  4JI8 M;  2F21 A;  4II7 A;  2C9C A;  2H1R A;  1FKB A;  1XNR M;  4G4Q A;  3CF0 A;  2QPA A;  4NXN M;  3TWK A;  4Q22 A;  1IBK M;  1L2C A;  2C96 A;  4FWH A;  4OVZ A;  3R9X B;  2LPV A;  4GMQ A;  3H4M A;  3QOK A;  4W5U A;  1ZCN A;  4GIT A;  1EYM A;  3U5Z B;  1FKI A;  2XEP A;  1TCO C;  3SYL A;  3FXY A;  3ODK A;  3RME A;  1XNQ M;  2QBY A;  5EP2 A;  1R2Z A;  3M0E A;  4LGX A;  3HJS A;  3OOB A;  5FTN A;  1ROT A;  3I4V A;  2M60 A;  4IBI A;  2OFN A;  4JI7 M;  1E6P A;  4TUW A;  1FAP A;  3VKH A;  2F4E A;  4LRT A;  4G4R A;  1NNU C;  1W9V A;  2DHR A;  3K1J A;  5EQT A;  3FUU A;  1NSG A;  2PV1 A;  1GLN A;  5EP3 A;  4LAY A;  3CGM A;  2ZM6 M;  4KR0 B;  3TCZ A;  4FWG A;  4QHS A;  2F2D A;  1OFH A;  3T1Y M;  4TW8 A;  2C9O A;  3TWM A;  1NJF A;  1W1V A;  2LWX A;  1QVR A;  5EJC A;  4GH9 A;  3LVW A;  3GQ5 A;  3ARS A;  4AY1 A;  4MM3 B;  1R7R A;  2G5G X;  3A98 B;  2DG4 A;  3WHK A;  1QZ2 A;  2WLZ A;  2XP7 A;  1Y0O A;  2PBC A;  1E6N A;  3AS0 A;  3CH9 A;  3ARO A;  5DF0 A;  4NSR A;  3J27 B;  3H9R B;  4PD2 A;  2XLJ A;  3KCE A;  4BF8 A;  4DH0 A;  3KS4 A;  3KOX E;  1L2D A;  2F5N A;  3GPP A;  4M9Z A;  3L25 A;  1JVW A;  2XP3 A;  3O5G A;  2AOS A;  4L8R C;  2MNT A;  2XP9 A;  3CHC A;  3GP1 A;  2UXC M;  3B8S A;  1N75 A;  2A3C A;  4LGM A;  1J7K A;  3ARU A;  1FFR A;  1LG1 A;  4LF9 M;  2VN1 A;  2BNK A;  1S3S A;  3U6P A;  4ODR A;  2V1C A;  2X8A A;  1ZQ9 A;  5GKN A;  4IBF A;  4LFA M;  4JI0 M;  2DWM A;  1NMW A;  3AS1 A;  3EIE A;  2A5Y B;  1HKK A;  4LY6 A;  3SMS A;  3VLF B;  3SAT A;  1Q1C A;  1IN7 A;  3AS3 A;  5EP1 A;  4CIS A;  3U6E A;  1D2K A;  1OGG A;  5ITT A;  1IXZ A;  3I6C A;  3PRD A;  4MGV A;  1RD6 A;  4IJE A;  2R62 A;  3RGS A;  4GIV A;  1DGH B;  2M2A A;  4IBJ A;  3SAV A;  3UMM A;  3FYC A;  3IK8 A;  5KPR A;  5A2Q S;  1QYR A;  3B9P A;  3TWL A;  2KXE A;  3SAU A;  2F5Q A;  3TQS A;  3OA5 A;  3UQI A;  5I98 A;  3G6M A;  4MGI E;  1N34 M;  5JI2 E;  4X65 M;  1QQW A;  1YE9 A;  1NH6 A;  5HTG A;  2DSZ A;  4U86 A;  3KP0 E;  2J7N A;  2RKO A;  3K92 A;  3GQ3 A;  1HJW A;  2LJ4 A;  1FJD A;  3D8B A;  1WNO A;  1ZBC A;  2YNM D;  4XGI A;  4QNM A;  1IN6 A;  1F8A B;  3W0L B;  4MNM A;  4DWS B;  1NMV A;  1NWR A;  3HU1 A;  4L15 A;  3PNY A;  3HU2 A;  4KQZ A;  4DIP A;  2UUA M;  4B3M M;  2I7P A;  4MNL A;  4HBO A;  3B9D A;  3L28 A;  2KGJ A;  4KO8 A;  2ZR4 A;  2I7N A;  4JFL A;  4DV5 M;  2X49 A;  2L09 A;  1NY6 A;  3E9S A;  4AKH A;  2PI6 A;  1IN4 A;  1E15 A;  2RUC A;  2KZS A;  2Y21 A;  3O5R A;  4DV4 M;  4MGH A;  5IT9 S;  3I51 A;  2MF9 A;  2DPE A;  2G8L A;  3U5Z A;  4G4O A;  3U6D A;  2KO7 A;  2G41 A;  2DT0 A;  2PV2 A;  4IQ2 A;  2V1U A;  3ARX A;  1FKH A;  1UR9 A;  1E6R A;  1G3I A;  5LMU M;  3PRB A;  1KT1 A;  4Z2K A;  4QNR A;  2R45 A;  3DFZ A;  3RE8 A;  3SFZ A;  4LAW A;  5GPG A;  4MH0 E;  4YY3 M;  2DT3 A;  3SHF A;  1GL6 A;  4OX9 M;  3HWS A;  5ITQ A;  3JAM S;  3CHE A;  4JFM A;  1IBM M;  1W5S A;  4J4O A;  4IJF A;  4GC9 A;  3DOA A;  2EUC A;  1U79 A;  2JA2 A;  2DWL A;  1E9S A;  3I4Y A;  4FCW A;  1HKM A;  4URI A;  3TL4 X;  4DV3 M;  1EHN A;  3J80 S;  3TC5 A;  5DYG A;  4M9X A;  4ODM A;  1SXJ C;  3VK8 A;  3JR4 A;  1GKI A;  3TDB A;  3VDU A;  4BBA A;  1XXH A;  4X64 M;  3SAS A;  3UZU A;  3U6L A;  2Y0Q A;  1LL4 A;  1ZL1 A;  4ODO A;  2R4J A;  3IHZ A;  1M5Y A;  3B7X A;  4WW0 A;  2KEB A;  4NRW A;  2FOI C;  4LAV A;  1IY0 A;  2CV0 A;  1NWT A;  1Q6U A;  2ZQV A;  4LF4 M;  1ZAE A;  2D7G A;  2Y0T A;  4NRV A;  5EXP A;  1L1P A;  5E6J A;  5IRE B;  2RGH A;  1OGB A;  3O5J A;  5DIV A;  5DO2 A;  2LNH C;  1T11 A;  3PRA A;  7CAT A;  3ZH9 B;  3OTO M;  3GO8 A;  4U84 A;  4NOO B;  1IM2 A;  3GRV A;  4JXJ A;  1I94 M;  3L29 A;  2MPH A;  3BXW A;  4HLQ A;  3UI4 A;  1ZBW A;  3WQV A;  2DG9 A;  4DR2 M;  4QT2 A;  3VFD A;  2F5O A;  1HXV A;  1IY1 A;  3MDY B;  4DR4 M;  3CF6 E;  4FCT A;  2Q5A A;  3KSX A;  1KYI A;  4B7G A;  1IXR C;  5KPT A;  3AFH A;  1XHB A;  2D7E A;  4GC5 A;  1NWS A;  4LZJ A;  1E6Z A;  5C1B A;  1ZU8 A;  1HQY E;  2BJV A;  3UGJ A;  5ITR A;  4I4L A;  1L2B A;  2L2S A;  1C1K A;  1FKK A;  3HHW A;  4NSB A;  4DV6 M;  4DRI A;  3GPK A;  2VII A;  4LJA A;  4B08 A;  3SAW A;  3FUT A;  1SYT A;  3MJ5 A;  4P8W A;  4WJX A;  2G8Z A;  2RSE A;  1L1T A;  2A3B A;  1ROU A;  3QWL A;  1KFW A;  4FWD A;  5EXT A;  3GPY A;  3O5M A;  5DIT A;  4IT6 A;  3L2A A;  4B7H A;  1P5Q A;  4MPK A;  2Z3X A;  4M0D A;  2YBT A;  4ML4 A;  4D80 A;  1PBK A;  2M5Z A;  3FYD A;  3CGN A;  2WM0 A;  1NVM A;  2FFJ A;  1L1Z A;  4JYA M;  2CHG A;  1PJI A;  2FAP A;  5HBF A;  1F40 A;  4W5W A;  3BOS A;  3AJI B;  2DZN B;  2D7H A;  3O5E A;  4OVZ B;  3FTF A;  1HJX A;  4G6Z A;  5FTK A;  1NHW C;  2XGN A;  4L16 A;  2KI3 A;  3WD3 A;  3SC3 A;  1HKI A;  4Z8X A;  2KRU A;  3U6C A;  4DUY M;  2ITK A;  3O5D A;  2XFT A;  4DRJ A;  3EY6 A;  1I4W A;  5EXS A;  3CZ8 A;  4MSP A;  3HHY A;  2QBY B;  1WAW A;  2WK2 A;  3KAD A;  4P8X A;  5FLX S;  1TGU A;  1FFQ A;  1W9U A;  3ARV A;  4LZZ A;  3NI6 A;  4Z2I A;  3GLH A;  5IZ7 D;  3RM4 A;  1Z5B A;  4DR5 M;  1JND A;  1K82 A;  1QPF A;  1W1Y A;  1X6L A;  4W9P A;  2FNA A;  3MK6 A;  3VK7 A;  4GHL A;  4IBC A;  3FAP A;  4Q7N A;  2LH0 A;  3Q8X A;  3PFI A;  2RUQ A;  3ILK A;  3SBJ A;  3U60 A;  1TFV A;  3O5O A;  2ZR6 A;  2YR0 A;  1HQC A;  4CGY B;  2OQ4 A;  3FKE A;  1DO2 A;  3CTW B;  5FTM A;  4ODN A;  2R46 A;  4JFK A;  4JI5 M;  4QT3 A;  1XWI A;  3CF2 A;  2QZ4 A;  3KDS E;  2DXI A;  4N19 A;  2R18 A;  3WD1 A;  1OFI A;  4GIP A;  4ODL A;  1X37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...