3RFWA

The virulence factor peb4 and the periplasmic protein cj1289 are two structurally-related sura-like chaperones in the human pathogen campylobacter jejuni
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
252
structure length
252
Chain Sequence
b'ATVATVNGKSISDTEVSEFFAPMLRGQDFKTLPDNQKKALIQQYIMQDLILQDAKKQNLEKDPLYTKELDRAKDAILVNVYQEKILNTIKIDAAKVKAFYDQNKDKYVKPARVQAKHILVATEKEAKDIINELKGLKGKELDAKFSELAKEKSIDPGSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTTPVKTNFGYHVILKENSQAKGQIKFDEVKQGIENGLKFEEFKKVINQKGQDLLNSAKVEYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell-binding factor 2
publication title The virulence factor PEB4 and the periplasmic protein Cj1289 are two structurally-related SurA-like chaperones in the human pathogen Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
molecule tags Chaperone
total genus 77
structure length 252
sequence length 252
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1040 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3rfwA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3rfwA03
4IQCA 2FKEA 1BKFA 1PINA 4TW7A 1T11A 4U85A 4DT4A 4MSPA 3KABA 1FKFA 3O5MA 2DG3A 3B7XA 3JYJA 4BF8A 2M2AA 3KAIA 2KE0A 2KR7A 3H9RB 3IHZA 4W9OA 5B8IC 3FAPA 2M1IA 2PV2A 3PRDA 4U84A 3KZ7A 2PPNA 3UI5A 2K8IA 5HW6A 3NTPA 1FKBA 1FKGA 4ITZA 2XP9A 4DZ3A 5HWBA 4ODOA 4TW6A 3O5LA 4DRKA 2PBCA 2XP4A 2PPOA 2DG4A 2N87A 4DRNA 5HUAA 1FAPA 2LKNA 5HTGA 4J4NA 2LGOA 1B6CA 1FKHA 2RUCA 2ZR4A 3CGNA 4QT3A 4TW8A 4ODLA 4DRMA 4W9PA 1FKLA 4O2TA 2IF4A 2XPBA 1PBKA 4G2PA 4G50A 5GPGA 3UI6A 1Q6HA 2MLYA 2MNTA 2Q5AA 3OOBA 3O5IA 4QIBA 3JYMA 1P5QA 4DZ2A 4W9QA 4JFKA 1JVWA 2MF9A 4ODNA 5D75A 1KT0A 1QZ2A 3PA7A 5HWCA 1FKSA 1W26A 2D9FA 3EY6A 5I98A 1NMWA 2L2SA 1C9HA 3IKGA 1F40A 1QPLA 3KAFA 4TX0A 2LJ4A 2DG9A 1Q6UA 1D6OA 2M08A 1NMVA 4C02B 4GGQA 3O5PA 1ZK6A 2VCDA 3I6CA 3PRBA 4LAXA 1JNSA 1HXVA 1J6YA 2F21A 4N19A 2PPPA 1D7JA 5HT1A 2OFNA 1NSGA 4MGVA 1EYMA 3UQBA 3MDYB 3TDBA 1Q6IA 5BXJA 3NRKA 5J6EA 2F4EA 5HW8A 4JFLA 2AWGA 2VN1A 3O5FA 5DIUA 3GPKA 3UF8A 1ZCNA 1R9HA 2Y78A 2MLXA 1F8AB 4DRIA 5HW7A 4QT2A 4ODPA 2XP5A 2ZQSA 2ZQTA 2XP8A 3O5RA 1Q1CA 4DROA 4DRHA 3O5DA 4JFMA 1N1AA 3UQIA 2RURA 2LPVA 4ODRA 1YATA 1J4RA 1FKIA 1YW5A 3O5KA 4LAWA 1J4IA 4U86A 2UZ5A 2ZQUA 4LAVA 4J4OA 3IK8A 3TCZA 3TC5A 3O5GA 4NNRA 1J4HA 2ZR5A 3LUOA 1ROTA 3IKDA 1FKRA 1FD9A 2RUDA 1KT1A 3CGMA 4IQ2A 1Y0OA 2XP3A 4DRQA 3O5OA 4DH0A 4IPXA 3VAWA 3KAGA 2ITKA 4DRPA 4JFIA 2RSEA 5DIVA 3KAHA 3JXVA 4JYSA 3WH0A 4TYOA 3KADA 2FAPA 1ROUA 2F2DA 2MPHA 3UI4A 2KI3A 1EQ3A 4ODMA 1JNTA 1FKJA 3KCEA 4DIPA 4TNSA 3O5EA 4FN2A 2KFWA 2ZQVA 3NI6A 4FAPA 3RFWA 2PV1A 4DRJA 1L1PA 1D7IA 1A7XA 4ODQA 2KGJA 2RUQA 1BL4A 4R0XA 3RGCA 4GIVA 1FKTA 4LAYA 1FKDA 2PV3A 2JZVA 3UQAA 5HKGA 2XP6A 3O5JA 4JFJA 5DITA 2KO7A 4ODKA 1M5YA 2XPAA 1FKKA 3O5QA 3ODKA 2XP7A 2MLZA 1D7HA 3KACA 2ZR6A 1U79A 1FJDA 2RQSA 1TCOC 1QPFA
chains in the Genus database with same CATH superfamily
4LF9M 3I4YA 2CP8A 1QAQA 1NJGA 3AOGA 3B7XA 4B3TM 2OQ4A 4AY1A 1Q3CA 2LXEA 3M7GA 1ZBVA 2UUCM 2RUCA 1SXJD 2C9OA 4P8VA 1FKLA 2D7EA 3ALFA 4XK8F 1XXHA 3HGIA 3GQ3A 3B7QA 1J09A 4RF0A 3I01M 3O5IA 2DWZB 2MF9A 2Z7JA 3SMSA 1QPLA 4CHTB 3TPZA 1ZBWA 5FTJA 3RGSA 1OKSA 3W68A 1NH6A 4M0DA 5GPRA 3KSXA 3ARTA 3SYKA 2QBYA 3J27B 2VDBB 3KFUG 1IQPA 1N1AA 2FH0A 5L8RF 2LPVA 2NQ8C 4KQZA 4U86A 3AROA 4PDGA 1JCHB 4LFAM 2G8ZA 1FKRA 4DRQA 4FWDA 3CF2A 3KAHA 3C9PA 3T1YM 2W82A 1QDTA 2MPHA 8CATA 4NRWA 3GPPA 1SG9A 2WLYA 1PM5A 3GLGE 4AZFA 1V92A 2WZJA 4LF8M 1N34M 4DR4M 4FWGA 4LRSA 2XP6A 3CHFA 3VK7A 5FSWA 2CHGA 4ODKA 1M5YA 1CUKA 3E46A 3KACA 3WL1A 1E44A 2VQEM 3ARQA 3WQVA 1W9UA 4M9SA 2DT0A 4XBOA 3H9RB 4U84A 1NHGC 2L2DA 4X62M 1L2CA 2PPNA 4ITZA 1TH3A 4TW6A 3PNVA 3FKEA 1B6CA 4W9PA 5EP4A 1DGFA 4MNKA 2MJ5B 4Z2LA 4W9QA 1NHWC 1YSYA 1QZ2A 3KOYE 3Q8XA 1T3TA 4Z2JA 4KO8A 5EXSA 4LAXA 1E9RA 4JXJA 4MGVA 2BJVA 5LMUM 4DV3M 2R18A 1K9TA 2R0IA 1SXJA 2F4EA 4DR7M 4DRIA 4ODPA 1Z59A 2ZQTA 1NWRA 2RURA 4X65M 2QCUA 4NOOB 3CHEA 3GLHA 3U6DA 4M9XA 1J4HA 1GJTA 3A42A 2RRUA 5KQDA 1FD9A 5FLXS 2A3BA 3I04M 4MB7A 3JXVA 4LY6A 4MNJA 4G4RA 4L8RC 2MROB 4F2LA 1WXQA 5FTKA 1PRBA 4BB9A 3SMPA 3K8ZA 3GLIA 4PT5A 4R7GA 2L4FA 4IIWA 3JR4A 1V34A 2DZOB 3B74A 1FKKA 3JAMS 5A2QS 2CV0A 2XH9A 3KSJA 2R45A 2VQFM 3FTEA 3RE8A 2AHMA 4S3JA 2A3CA 1N78A 1PJTA 3L26A 2N87A 1R6BX 1Y8GA 3CF0A 2MNTA 5IWAM 1D2KA 3ZCBB 1XMOM 2D9FA 3L28A 5I98A 3NWLA 2DZNB 2F21A 3AS1A 5HT1A 3WIJA 4PDIA 2C9CA 3TDBA 3K1JA 1G4AE 4HL4A 3U5ZB 2UXCM 1W1PA 1TH2A 2P5TA 2O25A 4ZPTR 3FY1A 3SASA 2B5UB 2DT1A 1IY0A 3WH0A 1HKIA 1VF8A 2V1CA 1W1VA 1VDLA 3AS2A 5DYGA 4QHSA 4FAPA 1MU5A 4G3OA 2PV3A 1TH4A 5EJCA 3ARPA 3IECA 3QAUA 2K47A 3FYDA 2O5RA 3WQWA 3M0EA 1LG2A 2Z8YM 4IQCA 4AG5A 4NXNM 3KAIA 2KE0A 2ERCA 5BR8M 4DZ3A 4TW8A 3TWLA 2ETNA 4O2TA 2K0BX 2R65A 4Q22A 1L1TA 3SAUA 1JVWA 3RM9A 1Z6TA 1NO1A 1FKSA 1OIPA 1NWTA 3EY6A 1C9HA 4B7HA 1K3XA 4P8UA 4GITA 1G41A 1NWUA 3O5PA 4IT6A 4L78A 4NRVA 1EYMA 2JXNA 3UQBA 1LL7A 4MH0E 5H37D 4JFLA 2LNHC 3UK6A 2Y78A 2FFJA 1F8AB 2G41A 2XP5A 4HBOA 4MTVA 3ZH9B 1HQCA 1KFVA 3T1HM 1JQJC 1EFUB 4J4OA 4WKFA 4MM3B 2C99A 1GKIA 1R4GA 4MGHA 1FJGM 1LL4A 3U60A 3L25A 2OOAA 1W5TA 2F2DA 3W0LB 1FKJA 2QPAA 1IXZA 1PJJA 1ZU8A 1XWIA 2MR9A 4BBAA 1KSFX 1HKJA 3HU3A 2UXDM 3O5JA 4IJFA 2HWJA 2XGNA 3KABA 1WR1B 1FJDA 1FKBA 1IXSA 4JN6A 7CATA 4TUWA 5DF0A 2K9DA 3KZ7A 4Z2HA 3E21A 4QNRA 3KVWA 2DSZA 3CGNA 2J7OA 3FD9A 3AL0C 3CTWB 1N75A 3THGA 4GRIA 1LQ0A 2F5SA 2ZBKB 4CIZA 1QVRA 5HWCA 2EO2A 1EIJA 3J80S 4LFCM 2VCDA 5E6JA 4OVZB 1W9VA 4ZS6A 1MN3A 2JY8A 2VN1A 4HARA 4LF7M 4X64M 5HW7A 4II7A 3BOSA 1GOIA 2XP8A 2LHCA 2Y21A 2D7HA 2KRKA 2E5LM 1FKIA 1Z5BA 1H0GA 2CRUA 3ARVA 4NNRA 2LBCA 4GIPA 1HQYE 1ROTA 1QZEA 4MNLA 1LTMA 1QQWA 1PGYA 1NJFA 3TWKA 4OU7A 4R3DA 1L1PA 2V6ZM 4RNAA 2XEPA 3D8BA 2LHGA 3AS3A 3HY5A 3WHKA 4Q7JA 3VFDA 1ZBKA 1HJPA 1IXRC 1OFHA 1PJSA 1ZMUA 2EUCA 2PI6A 2M5ZA 2JZ0A 1QANA 3W0FA 3U6OA 3SAVA 1F4IA 1Q3BA 5FTNA 3WD1A 3IHZA 2VIIA 2PV2A 4D80A 3U61B 3HWSA 2DT3A 4AQYM 4ODOA 1FAPA 3FRIA 2LGOA 2VF8A 2DXIA 2MLYA 1DV0A 4DZ2A 3CHDA 1E9SA 1UR8A 1F40A 1I4WA 2WSCF 3K92A 3GPYA 4GGQA 2ZM6M 4N19A 3ARXA 3H4MA 5ITQA 1MX0A 2AWGA 5DIUA 1QAOA 2BJWA 2F5NA 4QT2A 2V1UA 4AKIA 4ITQA 1YATA 3KS4A 1YW5A 1J4IA 4LRTA 3NBIA 3VLFB 1JB0F 2ITKA 1XB2B 2GQFA 4IBEA 2DWMA 3A45A 4NXMM 3VKGA 2DAMA 3GLFB 3KW6A 3ARYA 3LCUA 3O5EA 4FN2A 2KFWA 2ZQVA 3LVWA 4GIVA 4LGMA 2CFOA 1FKDA 1VDDA 4B3RM 2ZTDA 3FUUA 1XMQM 2KRUA 1D7HA 2XP4A 4ML4A 3B9AA 2OPFA 1BKFA 3PVSA 4U85A 1TGUA 4DT4A 2UU9M 3KP0E 4W5WA 2KR7A 2M1IA 1JR3D 1E6PA 2XP9A 1N33M 4FCWA 2DG4A 1G71A 1NSFA 1HT2E 3CZ8A 3OA5A 3U6EA 3AOEA 4GEWA 5GPGA 3UI6A 3KOWE 1HJWA 3JYMA 3MMPA 2F23A 4Z2GA 3KAFA 1VEGA 4Z6YA 2DG9A 4DR1M 3PRBA 4LFBM 1WNOA 1E94E 1RU3A 3U6PA 4NSOB 2C96A 3B9DA 4L72B 4P8XA 3U6MA 5EP1A 4URIA 3GRYA 3G6MA 1R5LA 4S3KA 3B7ZA 3U6CA 1D0LA 2UZ5A 3TWMA 4R5EA 2ZR5A 4DV5M 1XHBA 2LTUA 1UM8A 1XRVA 4G4NA 4DWSC 4LF5M 2R6FA 2CV1A 4ODMA 2KXEA 1C7YA 3ARSA 2QF8A 1NY6A 4ODQA 2M60A 4R0XA 1HNXM 5C18A 2JNHA 3O5QA 4WK9A 1AIPC 4RKUF 5ITTA 2Z4RA 1QAMA 2O01F 2CHVA 3AJIB 1FKGA 4FWHA 1YE9A 4R71A 4QNMA 4J4NA 1FKHA 2ZR4A 1TDZA 4HEOA 4G2PA 1K3WA 5ITXA 1KYIA 2QZ4A 1JNEA 2R44A 3U6LA 1NMVA 2KZSA 1GO5A 1JR3A 5DEZA 2JY7A 1IN6A 1VQ1A 1HNZM 4MAVA 2XSZD 1TF0B 2FNAA 3GO8A 4DROA 5EXTA 3VDUA 2EKFA 2Q2EB 1O6IA 4JV5M 1G59A 3IK8A 4OX9M 2LVPC 4CJ6A 5EP2A 1UR9A 2DNAA 3LMMA 4LJ6A 4DWSB 1QYRA 2A5YB 2FAPA 1IBLM 3J81S 2RKOA 5IT9S 2PV1A 1P3QQ 1EDQA 4IBBA 2KGJA 1FKTA 4B3MM 4AI6A 3ARZA 2L09A 1YUBA 1E9LA 3UGJA 2XP7A 1DO0A 2ZAOA 1HJVA 2KEBA 4NSRA 2FKEA 1T6OA 5BPVA 4LJ8A 2DT2A 2FOIC 4DV0M 4MGKE 3AS0A 4BLCA 3GLGB 3PXGA 1DGHB 3U5ZA 4FCVA 3VK8A 2PBCA 4I4LA 5C1BA 5HUAA 5KPTA 3L2AA 1WHCA 2XLJA 3HJQA 3WL0A 2X8AA 3V76A 4LJ9A 4DR3M 3FTCA 4D81A 2FE8A 1OGBA 2M08A 3B7NA 1ZK6A 1J6YA 3GRUA 2PPPA 4JI6M 4LZJA 1LG1A 4GMQA 1HKKA 4Z2KA 2K6BA 3O5FA 1TR8A 3UF8A 2MLXA 2RGOA 4KODA 5DYIA 4DRHA 2J5YA 4M9ZA 1XXHE 3RM8A 2I7NA 1KFWA 2DSVA 3DOAA 3B8SA 4LAVA 3TCZA 4DR5M 2Y0TA 1KT1A 5EXPA 4JI5M 5F3WA 4I5SA 3EIHA 3VAWA 4LJAA 2BNKA 3LQRA 4L3NA 2LH0A 3TL4X 4WURA 2XSZA 4NC6A 1IFYA 2L7HA 2KNAA 1IN7A 1NNJA 2LVAA 2P4VA 4DUYM 1L2DA 3HJ8A 3PFIA 2I7PA 5JH8A 3KOXE 4JI0M 1N32M 4MGIE 5HKGA 1S3SA 4JFJA 3HU1A 1L8QA 3C58A 2O9OA 4MNMA 3HJSA 2RQSA 1FFQA 4LF6M 2UXBM 3FUXA 1A5TA 2L6OA 3FAPA 1X6NA 3PRDA 3UI5A 1Z5AA 3PR9A 2KNZA 2K8IA 1OAIA 2HL7A 3O5LA 3GU0A 4DUZM 2GNOA 1Q6HA 2JY6B 1UFZA 4JFKA 1W5SA 3GRRA 3W4RA 1OJLA 4TX0A 3SAWA 1D6OA 2OO9A 3MDYB 2YBTA 5LMNM 2XZUA 4A3VB 1OFIA 3FUVA 1R9HA 1I94M 4JI3M 2ZQSA 3VKHA 3OTOM 1QUSA 4NZCA 3UQIA 4FW9A 4ODRA 1OIZA 2ZANA 3KDSE 2PN0A 2ZTCA 4DRPA 4JYSA 4YHHM 1SXJE 2DAEA 4Z8XA 1JNTA 5IZ7D 1W9PA 1OTRA 3KOZE 3EIPA 3E9SA 3FTDA 4FCTA 1IBKM 1BL4A 3GLHE 3GTYX 2JZ1A 2UUAM 4P17A 2G5GX 5DITA 4GC9A 1HR0M 2A3EA 3ILKA 1D0KA 4IBFA 1X37A 4OVZA 1R2YA 4G4QA 4I81A 4DV1M 3B9PA 2JP7A 3GPXA 3A46A 4DRKA 2DAGA 5HTGA 2MH8A 3GLIE 4HLQA 2F5QA 1OWQA 5GKNA 3UJNA 5E26A 1PBKA 1EE8A 3GQ5A 3VDPA 3ARRA 1ZL1A 1D0MA 1E32A 4YY3M 4C02B 3LW5F 3HHXA 2JA2A 1HXVA 1FFRA 1WB0A 5J6EA 5HW8A 3BBZA 3TE6A 3QWLA 3R9XB 2LVNC 1Q39A 4S12A 2VF7A 2DENA 1XXHB 1ZQ9A 2APLA 5EXXA 3ALGA 2CEAA 3O5GA 2DAIA 4IQ2A 4KHPM 2DVWB 1SXJC 4EIWA 1TTEA 2QNJA 3U61A 2QBYB 4GHLA 2OOBA 2KDLA 4DRJA 2BWBA 1IBMM 4LAYA 4DV4M 3KP1E 4F1IA 1DGBA 1WIVA 3QYBA 4DR2M 1U79A 1GJSA 2EULA 3T6PA 1OGGA 1Q02A 1AUAA 1GL6A 4MSPA 3O5MA 5JI2E 3U6SA 3IG5A 2CE7A 2DPEA 1R2ZA 3WKZA 2QQ8A 1CTNA 5HWBA 4X66M 1E6ZA 2CV2A 4LG2A 1WJ7A 4FVMA 1W1YA 4DR6M 1V33A 2IF4A 1IX5A 4JI7M 4REZA 1EIBA 2XFTA 3RGPA 1IN8A 1TFVA 4G6ZA 2L2SA 3IKGA 1HJXA 3FXYA 4IT4A 4L6V6 2DSWA 1D7JA 4B7GA 4LGXA 4JI4M 3GLFA 1ZCNA 2FDMA 1IY2A 4XAKA 1LJYA 1Q1CA 1X6LA 4B3SM 3DFZA 2ZQUA 3LVVA 2BWEA 3LUOA 2DHYA 3CGMA 5JI3E 3O5OA 4DH0A 3PRAA 4L15A 2F4VM 4LCBA 4JI8M 1ROUA 1SXJB 4XGIA 1NVMA 1ORYB 3B89A 4D82A 3WD0A 4DIPA 1G3IA 4JI2M 2EKKA 3A98B 3RFWA 1W1TA 1J5EM 4WIWA 2R46A 1N77A 3UQAA 3GLHB 2DKLA 2XZFA 4LJ7A 1VEKA 2XF3A 1EHNA 3ODKA 2MLZA 2D7GA 2ZR6A 3HHWA 1QPFA 3TQSA 2HCBA 1E15A 1PINA 4OW0A 3WD4A 1PJIA 2DG3A 1GL7A 3M6AA 3BMBA 5B8IC 2F5PA 3ZQJA 1NV9A 4QOZC 2EJSA 2R62A 1HT1E 1MJGM 4DWSD 1NWSA 2EA0A 4Y28F 5KO3A 2LKNA 4ODLA 3GLIB 4UN2B 1GLNA 4DV7M 4QIBA 4LJ5A 4ZPWR 4GHAA 3SHFA 2DI0A 4AKHA 3I4VA 1KT0A 5DO2A 1NMWA 2KW0A 4IBCA 1Q6UA 2XFSA 1XHGA 1BVSA 2OFNA 2JWSA 2J7NA 3RM4A 5ITRA 3W67A 4LGYA 1LL6A 3SFZA 5KPRA 4AW4A 1GPFA 3HZJA 4CGYB 1K82A 2Z4SA 3O5RA 2LWXA 4LF4M 2G3QA 1J4RA 4IBJA 2X4AA 3MHVC 2YR0A 3TC5A 3IKDA 4FD2A 2WM0A 3GP1A 4MPKA 3MK6A 4IPXA 4IJEA 3WHLA 1IY1A 2DWNA 2FS1A 3QYEA 1XNRM 4TYOA 1N36M 3KXEC 2CWBA 3LQQA 3F92A 3HKPA 4QOSA 2RGHA 3C3DA 3B9EA 3FYCA 2JZVA 2QP9X 2H1RA 3U6QA 1LV7A 1R7RA 2X49A 2HAKA 2DAKA 1T43A 1T11A 1RD6A 1C1KA 4GH9A 4W9OA 4UDMA 4DBGB 3HHZA 4WW0A 3CH9A 2PPOA 3PNYA 3DZDA 4QT3A 4ANRA 3SARA 1GABA 3I51A 5DNYA 2JUJA 5FTLA 4DV6M 2Q5AA 4GKJM 3FRHA 2YBUA 1D2NA 5EQTA 2UUBM 4QHTA 3PA7A 2YFQA 2A3AA 3IHPA 4KLNA 3I6CA 4DWSA 5DFLA 5BXJA 3MJ5A 3GPKA 4PTMA 1ITXA 3G6LA 3E4RA 3LCVB 3O5DA 3NBXX 1WGLA 3IG8A 1IN4A 4CISA 3WD2A 2QHOB 5IREB 5KQ8A 2JY5A 2XP3A 2AOSA 2WK2A 3KAGA 3T38A 4DV2M 3J7AS 2OLHA 4L16A 3UI4A 4IBKA 3GLGA 1SYTA 3QOKA 1DGHA 1NY5A 4B7FA 1QDRA 4LJ4A 5KPZA 3K9OA 1Z5CA 2G8LA 2RUQA 2YQZA 3RGCA 3BXWA 2F5OA 1IM2A 3AQUA 3JR5A 2ZAMA 3AFHA 2KA6B 2KO7A 2XPAA 1GUVA 3GRVA 4TW7A 2WLZA 1OQYA 5EP3A 3U60B 1FKFA 4KR0B 3JYJA 2M2AA 4PD2A 1PJQA 1FNNA 3SHGB 1NV8A 4DRMA 4LZZA 3GQ4A 1VG5A 4G50A 3AV0A 4ODNA 1E6NA 3T15A 1W26A 2Y20A 1IXSB 2DZLA 1SR0A 2DHRA 2H5XA 1NSGA 4WP2A 1H0IA 2WSFF 2QENA 2L4EA 3GLFE 2WSEF 4Z2IA 3CHCA 4IBIA 3ARWA 3L29A 4HBEA 4AKGA 4ZPVR 2Y0QA 3SYLA 4JFMA 2KZUA 3K9PA 4B08A 3O5KA 3HX3A 4WKAA 1VEJA 4GC5A 1HKMA 1XNQM 2DWLA 1YLAA 1ZV1A 2RUDA 4IBDA 3CGWA 3K2LA 1G8PA 3J7BA 4JFIA 5DIVA 2C5RA 2R4EA 3KADA 2IUZA 1EQ3A 4ZPXA 2KI3A 2HHHM 3J2PB 3FUTA 4TNSA 1L1ZA 3UMMA 3NI6A 2LVQD 4NSBA 4QZVB 3R8FA 4P8WA 1ZAEA 4JYAM 3FTFA 1IN5A 3UZUA 2KNVA 4P16A 3GPUA 2L7IA 1ZMVA 1ZBCA 4BF8A 1L2BA 1NNUC 1QUTA 5HW6A 3NTPA 3DA1A 1GRJA 1WGNA 1JNDA 4DRNA 4KT0F 2N35A 2XPBA 3WD3A 3D8LA 3OOBA 1P5QA 5D75A 4RF1A 4W5UA 3SATA 3L27A 1ZMWA 2LJ4A 1E6RA 3C3EA 1JNSA 3SC3A 2YNMD 1Q6IA 3NRKA 1QZMA 4G4OA 5HBFA 2CUZA 5FTMA 2Z3XA 1HNWM 4NL4H 1J7KA 4MGYE 4MGZE 4L4UA 2C98A 4I8OA 2HKJA 1OAOC 3AOEC 5ITXE 1XC8A 3KS8A 4GKKM 4WJXA 4LAWA 2ESCA 3EIEA 2QSFX 1GVNA 3FUWA 5GQBA 1TDHA 2LVOC 4M0WA 1Y0OA 1JR3E 3SBJA 4K0KM 2DSUA 3RMEA 2RSEA 3CF6E 2KHHA 4JI1M 5ITUA 5ITYA 3AKZA 1ZB5A 3HU2A 1H6UA 3ARUA 3KCEA 1WAWA 3HHYA 2B31A 3Q8GA 4WKHA 1D7IA 4PCZA 1A7XA 1DO2A 3ZC7B 4AG6A 2CHQA 3H4JA 2R4JA 1DGGA 2B3TA 2MGWA 4Q7NA 3FE3A 4IBGA 1TCOC 2O92A
chains in the Genus database with same CATH topology
4LF9M 3I4YA 1QAQA 1NJGA 3AOGA 3B7XA 4B3TM 2OQ4A 4AY1A 1Q3CA 2LXEA 3M7GA 1ZBVA 2UUCM 2RUCA 1SXJD 2C9OA 4P8VA 1FKLA 2D7EA 3ALFA 3GQ3A 1XXHA 3HGIA 4RF0A 1J09A 3O5IA 2DWZB 2MF9A 2Z7JA 3SMSA 1QPLA 4CHTB 3TPZA 1ZBWA 5FTJA 3RGSA 1NH6A 4M0DA 5GPRA 3KSXA 3ARTA 3SYKA 2QBYA 3J27B 3KFUG 1IQPA 1N1AA 2LPVA 2NQ8C 4KQZA 4U86A 3AROA 4PDGA 4LFAM 2G8ZA 1FKRA 4DRQA 4FWDA 3CF2A 3KAHA 3T1YM 2W82A 2MPHA 8CATA 4NRWA 3GPPA 2WLYA 1PM5A 4AZFA 4LF8M 1N34M 4DR4M 4FWGA 4LRSA 2XP6A 3CHFA 3VK7A 5FSWA 2CHGA 4ODKA 1M5YA 3KACA 3WL1A 2VQEM 3ARQA 3WQVA 1W9UA 4M9SA 2DT0A 4XBOA 3H9RB 4U84A 1NHGC 4X62M 1L2CA 2PPNA 4ITZA 1TH3A 4TW6A 3PNVA 3FKEA 1B6CA 4W9PA 5EP4A 1DGFA 4MNKA 4Z2LA 4W9QA 1NHWC 1YSYA 1QZ2A 3KOYE 3Q8XA 1T3TA 4Z2JA 4KO8A 5EXSA 4LAXA 1E9RA 4JXJA 4MGVA 2BJVA 5LMUM 4DV3M 2R18A 1K9TA 1SXJA 2F4EA 4DR7M 4DRIA 4ODPA 1Z59A 2ZQTA 1NWRA 2RURA 4X65M 2QCUA 4NOOB 3CHEA 3GLHA 3U6DA 4M9XA 1J4HA 3A42A 5KQDA 1FD9A 5FLXS 2A3BA 4MB7A 3JXVA 4LY6A 4MNJA 4G4RA 4L8RC 1WXQA 5FTKA 4BB9A 3SMPA 3K8ZA 3GLIA 4PT5A 4R7GA 4IIWA 3JR4A 2DZOB 1FKKA 3JAMS 5A2QS 2CV0A 2XH9A 3KSJA 2R45A 2VQFM 3FTEA 3RE8A 2AHMA 4S3JA 2A3CA 1N78A 3L26A 2N87A 1R6BX 3CF0A 2MNTA 5IWAM 1D2KA 3ZCBB 1XMOM 2D9FA 3L28A 5I98A 3NWLA 2DZNB 2F21A 3AS1A 5HT1A 3WIJA 4PDIA 2C9CA 3TDBA 3K1JA 1G4AE 4HL4A 3U5ZB 2UXCM 1W1PA 1TH2A 2P5TA 4ZPTR 3FY1A 3SASA 2DT1A 1IY0A 3WH0A 1HKIA 1VF8A 2V1CA 1W1VA 3AS2A 5DYGA 4QHSA 4FAPA 1MU5A 2PV3A 1TH4A 5EJCA 3ARPA 3QAUA 2K47A 3FYDA 2O5RA 3WQWA 3M0EA 1LG2A 4IQCA 4AG5A 4NXNM 3KAIA 2KE0A 2ERCA 5BR8M 4DZ3A 4TW8A 3TWLA 4O2TA 2R65A 4Q22A 1L1TA 3SAUA 1JVWA 3RM9A 1Z6TA 1FKSA 1NWTA 3EY6A 1C9HA 4B7HA 1K3XA 4P8UA 4GITA 1G41A 1NWUA 3O5PA 4IT6A 4L78A 4NRVA 1EYMA 3UQBA 1LL7A 4MH0E 5H37D 4JFLA 2LNHC 3UK6A 2Y78A 2FFJA 1F8AB 2G41A 2XP5A 4HBOA 4MTVA 3ZH9B 1HQCA 1KFVA 3T1HM 1JQJC 4J4OA 4WKFA 4MM3B 2C99A 1GKIA 4MGHA 1FJGM 1LL4A 3U60A 3L25A 1W5TA 2F2DA 3W0LB 1FKJA 2QPAA 1IXZA 1PJJA 1ZU8A 1XWIA 4BBAA 1KSFX 1HKJA 3HU3A 2UXDM 3O5JA 4IJFA 2XGNA 3KABA 1FJDA 1FKBA 4JN6A 7CATA 4TUWA 5DF0A 3KZ7A 4Z2HA 4QNRA 3KVWA 2DSZA 3CGNA 2J7OA 3FD9A 3AL0C 3CTWB 1N75A 3THGA 4GRIA 1LQ0A 2F5SA 2ZBKB 1QVRA 5HWCA 2EO2A 3J80S 4LFCM 2VCDA 5E6JA 4OVZB 1W9VA 4ZS6A 2VN1A 4HARA 4LF7M 4X64M 5HW7A 4II7A 3BOSA 1GOIA 2XP8A 2Y21A 2D7HA 2KRKA 2E5LM 1FKIA 1Z5BA 1H0GA 3ARVA 4NNRA 4GIPA 1HQYE 1ROTA 4MNLA 1QQWA 1NJFA 3TWKA 4OU7A 4R3DA 1L1PA 2V6ZM 4RNAA 2XEPA 3D8BA 3AS3A 3WHKA 3VFDA 1ZBKA 1IXRC 1OFHA 2EUCA 2PI6A 2M5ZA 1QANA 3W0FA 3U6OA 3SAVA 1Q3BA 5FTNA 3WD1A 3IHZA 2VIIA 2PV2A 4D80A 3U61B 3HWSA 2DT3A 4AQYM 4ODOA 1FAPA 2LGOA 2DXIA 2MLYA 4DZ2A 3CHDA 1E9SA 1UR8A 1F40A 1I4WA 3K92A 3GPYA 4GGQA 2ZM6M 4N19A 3ARXA 3H4MA 5ITQA 1MX0A 2AWGA 5DIUA 1QAOA 2BJWA 2F5NA 4QT2A 2V1UA 4AKIA 4ITQA 1YATA 3KS4A 1YW5A 1J4IA 4LRTA 3NBIA 3VLFB 2ITKA 4IBEA 2DWMA 3A45A 4NXMM 3VKGA 3GLFB 3KW6A 3ARYA 3O5EA 4FN2A 2KFWA 2ZQVA 3LVWA 4GIVA 4LGMA 2CFOA 1FKDA 1VDDA 4B3RM 3FUUA 1XMQM 2KRUA 1D7HA 2XP4A 4ML4A 3B9AA 2OPFA 1BKFA 3PVSA 4U85A 1TGUA 4DT4A 2UU9M 3KP0E 4W5WA 2KR7A 2M1IA 1JR3D 1E6PA 2XP9A 1N33M 4FCWA 2DG4A 1NSFA 1HT2E 3CZ8A 3OA5A 3U6EA 3AOEA 3UI6A 5GPGA 3KOWE 1HJWA 3JYMA 4Z2GA 3KAFA 4Z6YA 2DG9A 4DR1M 3PRBA 4LFBM 1WNOA 1E94E 3U6PA 4NSOB 2C96A 3B9DA 4L72B 4P8XA 3U6MA 5EP1A 4URIA 3GRYA 3G6MA 4S3KA 3U6CA 2UZ5A 3TWMA 4R5EA 2ZR5A 4DV5M 1XHBA 1UM8A 1XRVA 4G4NA 4DWSC 4LF5M 2CV1A 4ODMA 2KXEA 3ARSA 2QF8A 1NY6A 4ODQA 2M60A 4R0XA 1HNXM 5C18A 3O5QA 4WK9A 5ITTA 2Z4RA 1QAMA 2CHVA 3AJIB 1FKGA 4FWHA 1YE9A 4QNMA 4J4NA 1FKHA 2ZR4A 1TDZA 4G2PA 1K3WA 5ITXA 1KYIA 2QZ4A 1JNEA 3U6LA 1NMVA 2KZSA 1JR3A 5DEZA 1IN6A 1HNZM 4MAVA 2XSZD 2FNAA 3GO8A 4DROA 5EXTA 3VDUA 2Q2EB 1O6IA 4JV5M 1G59A 3IK8A 4OX9M 5EP2A 1UR9A 3LMMA 4LJ6A 4DWSB 1QYRA 2A5YB 2FAPA 1IBLM 3J81S 2RKOA 5IT9S 2PV1A 1EDQA 4IBBA 2KGJA 1FKTA 4B3MM 4AI6A 3ARZA 2L09A 1YUBA 1E9LA 3UGJA 2XP7A 1DO0A 2ZAOA 1HJVA 2KEBA 4NSRA 2FKEA 5BPVA 4LJ8A 2DT2A 2FOIC 4DV0M 4MGKE 3AS0A 4BLCA 3GLGB 3PXGA 1DGHB 3U5ZA 4FCVA 3VK8A 2PBCA 4I4LA 5C1BA 5HUAA 5KPTA 3L2AA 2XLJA 3HJQA 3WL0A 2X8AA 4LJ9A 4DR3M 3FTCA 4D81A 2FE8A 1OGBA 2M08A 1ZK6A 1J6YA 3GRUA 2PPPA 4JI6M 4LZJA 1LG1A 4GMQA 1HKKA 4Z2KA 3O5FA 3UF8A 2MLXA 2RGOA 4KODA 5DYIA 4DRHA 4M9ZA 3RM8A 2I7NA 1KFWA 2DSVA 3DOAA 3B8SA 4LAVA 3TCZA 4DR5M 2Y0TA 1KT1A 5EXPA 4JI5M 5F3WA 4I5SA 3EIHA 3VAWA 4LJAA 2BNKA 3LQRA 4L3NA 2LH0A 3TL4X 4WURA 2XSZA 2L7HA 1IN7A 1NNJA 4DUYM 1L2DA 3HJ8A 3PFIA 2I7PA 5JH8A 3KOXE 4JI0M 1N32M 4MGIE 5HKGA 1S3SA 4JFJA 3HU1A 1L8QA 3C58A 2O9OA 4MNMA 3HJSA 2RQSA 1FFQA 4LF6M 2UXBM 3FUXA 2L6OA 3FAPA 1X6NA 3PRDA 3UI5A 1Z5AA 3PR9A 2K8IA 2HL7A 3O5LA 4DUZM 1Q6HA 4JFKA 1W5SA 3GRRA 3W4RA 1OJLA 4TX0A 3SAWA 1D6OA 3MDYB 2YBTA 5LMNM 2XZUA 4A3VB 1OFIA 3FUVA 1R9HA 1I94M 4JI3M 2ZQSA 3VKHA 3OTOM 4NZCA 3UQIA 4FW9A 4ODRA 2ZANA 3KDSE 4DRPA 4JYSA 4YHHM 1SXJE 4Z8XA 1JNTA 5IZ7D 1W9PA 3KOZE 3E9SA 3FTDA 4FCTA 1IBKM 1BL4A 2UUAM 2G5GX 5DITA 4GC9A 1HR0M 2A3EA 3ILKA 4IBFA 1X37A 4OVZA 1R2YA 4G4QA 4I81A 4DV1M 3B9PA 3GPXA 3A46A 4DRKA 5HTGA 1OWQA 4HLQA 2F5QA 5GKNA 3UJNA 5E26A 1PBKA 1EE8A 3GQ5A 3VDPA 3ARRA 1ZL1A 1E32A 4YY3M 4C02B 3HHXA 2JA2A 1HXVA 1FFRA 1WB0A 5J6EA 5HW8A 3TE6A 3QWLA 3R9XB 1Q39A 4S12A 1XXHB 1ZQ9A 5EXXA 3ALGA 2CEAA 3O5GA 4IQ2A 4KHPM 2DVWB 1SXJC 4EIWA 3U61A 2QBYB 4GHLA 4DRJA 1IBMM 4LAYA 4DV4M 3KP1E 1DGBA 4DR2M 1U79A 1OGGA 1GL6A 4MSPA 3O5MA 5JI2E 3U6SA 3IG5A 2CE7A 2DPEA 1R2ZA 3WKZA 1CTNA 5HWBA 4X66M 1E6ZA 2CV2A 4LG2A 4FVMA 1W1YA 4DR6M 2IF4A 1IX5A 4JI7M 4REZA 1EIBA 2XFTA 3RGPA 1IN8A 1TFVA 4G6ZA 2L2SA 3IKGA 1HJXA 3FXYA 4IT4A 2DSWA 1D7JA 4B7GA 4LGXA 4JI4M 3GLFA 1ZCNA 2FDMA 1IY2A 4XAKA 1LJYA 1Q1CA 1X6LA 4B3SM 3DFZA 2ZQUA 3LVVA 3LUOA 3CGMA 5JI3E 3O5OA 4DH0A 3PRAA 4L15A 2F4VM 4LCBA 4JI8M 1ROUA 1SXJB 4XGIA 1NVMA 1ORYB 4D82A 3WD0A 4DIPA 1G3IA 4JI2M 3A98B 3RFWA 1W1TA 1J5EM 4WIWA 2R46A 1N77A 3UQAA 3GLHB 2XZFA 4LJ7A 2XF3A 1EHNA 3ODKA 2MLZA 2D7GA 2ZR6A 3HHWA 1QPFA 3TQSA 2HCBA 1E15A 1PINA 4OW0A 3WD4A 1PJIA 2DG3A 1GL7A 3M6AA 5B8IC 2F5PA 4QOZC 2R62A 1HT1E 4DWSD 1NWSA 2EA0A 5KO3A 2LKNA 4ODLA 3GLIB 1GLNA 4DV7M 4QIBA 4LJ5A 4ZPWR 4GHAA 3SHFA 1KT0A 4AKHA 3I4VA 5DO2A 1NMWA 2KW0A 4IBCA 1Q6UA 2XFSA 1XHGA 2OFNA 2J7NA 3RM4A 5ITRA 4LGYA 1LL6A 3SFZA 5KPRA 4AW4A 1GPFA 4CGYB 1K82A 2Z4SA 3O5RA 2LWXA 4LF4M 1J4RA 4IBJA 2X4AA 3MHVC 2YR0A 3TC5A 3IKDA 4FD2A 2WM0A 3GP1A 4MPKA 3MK6A 4IPXA 4IJEA 3WHLA 1IY1A 2DWNA 1XNRM 4TYOA 1N36M 3KXEC 3LQQA 3HKPA 4QOSA 2RGHA 3B9EA 3FYCA 2JZVA 2QP9X 2H1RA 3U6QA 1LV7A 1R7RA 2X49A 1T11A 1RD6A 1C1KA 4GH9A 4W9OA 3HHZA 4WW0A 3CH9A 2PPOA 3PNYA 3DZDA 4QT3A 3SARA 3I51A 5DNYA 5FTLA 4DV6M 2Q5AA 4GKJM 2YBUA 1D2NA 5EQTA 2UUBM 4QHTA 3PA7A 2YFQA 2A3AA 4KLNA 3I6CA 4DWSA 5BXJA 3MJ5A 3GPKA 4PTMA 1ITXA 3G6LA 3E4RA 3O5DA 3IG8A 1IN4A 4CISA 3WD2A 5IREB 5KQ8A 2XP3A 2AOSA 2WK2A 3KAGA 3T38A 4DV2M 3J7AS 2OLHA 4L16A 3UI4A 4IBKA 3GLGA 1SYTA 3QOKA 1DGHA 1NY5A 4B7FA 4LJ4A 5KPZA 1Z5CA 2G8LA 2RUQA 2YQZA 3RGCA 3BXWA 2F5OA 1IM2A 3AQUA 3JR5A 2ZAMA 3AFHA 2KA6B 2KO7A 2XPAA 1GUVA 3GRVA 4TW7A 2WLZA 5EP3A 3U60B 1FKFA 4KR0B 3JYJA 2M2AA 4PD2A 1FNNA 3SHGB 4DRMA 4LZZA 3GQ4A 4G50A 3AV0A 4ODNA 1E6NA 3T15A 1W26A 2Y20A 1IXSB 1SR0A 2DHRA 1NSGA 1H0IA 2QENA 4Z2IA 3CHCA 4IBIA 3ARWA 3L29A 4HBEA 4AKGA 4ZPVR 2Y0QA 3SYLA 4JFMA 2KZUA 4B08A 3O5KA 4WKAA 4GC5A 1HKMA 1XNQM 2DWLA 2RUDA 4IBDA 3K2LA 1G8PA 3J7BA 4JFIA 5DIVA 2C5RA 2R4EA 3KADA 2IUZA 1EQ3A 4ZPXA 2KI3A 2HHHM 3J2PB 3FUTA 4TNSA 1L1ZA 3UMMA 3NI6A 4NSBA 4QZVB 3R8FA 4P8WA 1ZAEA 4JYAM 3FTFA 1IN5A 3UZUA 4P16A 3GPUA 2L7IA 1ZBCA 4BF8A 1L2BA 1NNUC 5HW6A 3NTPA 3DA1A 1JNDA 4DRNA 2XPBA 3WD3A 3D8LA 3OOBA 1P5QA 5D75A 4RF1A 4W5UA 3SATA 3L27A 2LJ4A 1E6RA 1JNSA 3SC3A 2YNMD 1Q6IA 3NRKA 1QZMA 4G4OA 5HBFA 2CUZA 5FTMA 2Z3XA 1HNWM 4NL4H 1J7KA 4MGYE 4MGZE 4L4UA 2C98A 4I8OA 2HKJA 3AOEC 5ITXE 1XC8A 3KS8A 4GKKM 4WJXA 4LAWA 2ESCA 3EIEA 1GVNA 3FUWA 5GQBA 1TDHA 4M0WA 1Y0OA 3SBJA 4K0KM 2DSUA 3RMEA 2RSEA 3CF6E 4JI1M 5ITUA 5ITYA 3AKZA 1ZB5A 3HU2A 1H6UA 3ARUA 3KCEA 1WAWA 3HHYA 2B31A 4WKHA 1D7IA 4PCZA 1A7XA 1DO2A 3ZC7B 4AG6A 2CHQA 2R4JA 1DGGA 4Q7NA 4IBGA 1TCOC 2O92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQC A;  2FKE A;  1BKF A;  1PIN A;  4TW7 A;  1T11 A;  4U85 A;  4DT4 A;  4MSP A;  3KAB A;  1FKF A;  3O5M A;  2DG3 A;  3B7X A;  3JYJ A;  4BF8 A;  2M2A A;  3KAI A;  2KE0 A;  2KR7 A;  3H9R B;  3IHZ A;  4W9O A;  5B8I C;  3FAP A;  2M1I A;  2PV2 A;  3PRD A;  4U84 A;  3KZ7 A;  2PPN A;  3UI5 A;  2K8I A;  5HW6 A;  3NTP A;  1FKB A;  1FKG A;  4ITZ A;  2XP9 A;  4DZ3 A;  5HWB A;  4ODO A;  4TW6 A;  3O5L A;  4DRK A;  2PBC A;  2XP4 A;  2PPO A;  2DG4 A;  2N87 A;  4DRN A;  5HUA A;  1FAP A;  2LKN A;  5HTG A;  4J4N A;  2LGO A;  1B6C A;  1FKH A;  2RUC A;  2ZR4 A;  3CGN A;  4QT3 A;  4TW8 A;  4ODL A;  4DRM A;  4W9P A;  1FKL A;  4O2T A;  2IF4 A;  2XPB A;  1PBK A;  4G2P A;  4G50 A;  5GPG A;  3UI6 A;  1Q6H A;  2MLY A;  2MNT A;  2Q5A A;  3OOB A;  3O5I A;  4QIB A;  3JYM A;  1P5Q A;  4DZ2 A;  4W9Q A;  4JFK A;  1JVW A;  2MF9 A;  4ODN A;  5D75 A;  1KT0 A;  1QZ2 A;  3PA7 A;  5HWC A;  1FKS A;  1W26 A;  2D9F A;  3EY6 A;  5I98 A;  1NMW A;  2L2S A;  1C9H A;  3IKG A;  1F40 A;  1QPL A;  3KAF A;  4TX0 A;  2LJ4 A;  2DG9 A;  1Q6U A;  1D6O A;  2M08 A;  1NMV A;  4C02 B;  4GGQ A;  3O5P A;  1ZK6 A;  2VCD A;  3I6C A;  3PRB A;  4LAX A;  1JNS A;  1HXV A;  1J6Y A;  2F21 A;  4N19 A;  2PPP A;  1D7J A;  5HT1 A;  2OFN A;  1NSG A;  4MGV A;  1EYM A;  3UQB A;  3MDY B;  3TDB A;  1Q6I A;  5BXJ A;  3NRK A;  5J6E A;  2F4E A;  5HW8 A;  4JFL A;  2AWG A;  2VN1 A;  3O5F A;  5DIU A;  3GPK A;  3UF8 A;  1ZCN A;  1R9H A;  2Y78 A;  2MLX A;  1F8A B;  4DRI A;  5HW7 A;  4QT2 A;  4ODP A;  2XP5 A;  2ZQS A;  2ZQT A;  2XP8 A;  3O5R A;  1Q1C A;  4DRO A;  4DRH A;  3O5D A;  4JFM A;  1N1A A;  3UQI A;  2RUR A;  2LPV A;  4ODR A;  1YAT A;  1J4R A;  1FKI A;  1YW5 A;  3O5K A;  4LAW A;  1J4I A;  4U86 A;  2UZ5 A;  2ZQU A;  4LAV A;  4J4O A;  3IK8 A;  3TCZ A;  3TC5 A;  3O5G A;  4NNR A;  1J4H A;  2ZR5 A;  3LUO A;  1ROT A;  3IKD A;  1FKR A;  1FD9 A;  2RUD A;  1KT1 A;  3CGM A;  4IQ2 A;  1Y0O A;  2XP3 A;  4DRQ A;  3O5O A;  4DH0 A;  4IPX A;  3VAW A;  3KAG A;  2ITK A;  4DRP A;  4JFI A;  2RSE A;  5DIV A;  3KAH A;  3JXV A;  4JYS A;  3WH0 A;  4TYO A;  3KAD A;  2FAP A;  1ROU A;  2F2D A;  2MPH A;  3UI4 A;  2KI3 A;  1EQ3 A;  4ODM A;  1JNT A;  1FKJ A;  3KCE A;  4DIP A;  4TNS A;  3O5E A;  4FN2 A;  2KFW A;  2ZQV A;  3NI6 A;  4FAP A;  3RFW A;  2PV1 A;  4DRJ A;  1L1P A;  1D7I A;  1A7X A;  4ODQ A;  2KGJ A;  2RUQ A;  1BL4 A;  4R0X A;  3RGC A;  4GIV A;  1FKT A;  4LAY A;  1FKD A;  2PV3 A;  2JZV A;  3UQA A;  5HKG A;  2XP6 A;  3O5J A;  4JFJ A;  5DIT A;  2KO7 A;  4ODK A;  1M5Y A;  2XPA A;  1FKK A;  3O5Q A;  3ODK A;  2XP7 A;  2MLZ A;  1D7H A;  3KAC A;  2ZR6 A;  1U79 A;  1FJD A;  2RQS A;  1TCO C;  1QPF A; 
#chains in the Genus database with same CATH topology
 4LF9 M;  3I4Y A;  2CP8 A;  1QAQ A;  1NJG A;  3AOG A;  3B7X A;  4B3T M;  2OQ4 A;  4AY1 A;  1Q3C A;  2LXE A;  3M7G A;  1ZBV A;  2UUC M;  2RUC A;  1SXJ D;  2C9O A;  4P8V A;  1FKL A;  2D7E A;  3ALF A;  4XK8 F;  1XXH A;  3HGI A;  3GQ3 A;  3B7Q A;  1J09 A;  4RF0 A;  3I01 M;  3O5I A;  2DWZ B;  2MF9 A;  2Z7J A;  3SMS A;  1QPL A;  4CHT B;  3TPZ A;  1ZBW A;  5FTJ A;  3RGS A;  1OKS A;  3W68 A;  1NH6 A;  4M0D A;  5GPR A;  3KSX A;  3ART A;  3SYK A;  2QBY A;  3J27 B;  2VDB B;  3KFU G;  1IQP A;  1N1A A;  2FH0 A;  5L8R F;  2LPV A;  2NQ8 C;  4KQZ A;  4U86 A;  3ARO A;  4PDG A;  1JCH B;  4LFA M;  2G8Z A;  1FKR A;  4DRQ A;  4FWD A;  3CF2 A;  3KAH A;  3C9P A;  3T1Y M;  2W82 A;  1QDT A;  2MPH A;  8CAT A;  4NRW A;  3GPP A;  1SG9 A;  2WLY A;  1PM5 A;  3GLG E;  4AZF A;  1V92 A;  2WZJ A;  4LF8 M;  1N34 M;  4DR4 M;  4FWG A;  4LRS A;  2XP6 A;  3CHF A;  3VK7 A;  5FSW A;  2CHG A;  4ODK A;  1M5Y A;  1CUK A;  3E46 A;  3KAC A;  3WL1 A;  1E44 A;  2VQE M;  3ARQ A;  3WQV A;  1W9U A;  4M9S A;  2DT0 A;  4XBO A;  3H9R B;  4U84 A;  1NHG C;  2L2D A;  4X62 M;  1L2C A;  2PPN A;  4ITZ A;  1TH3 A;  4TW6 A;  3PNV A;  3FKE A;  1B6C A;  4W9P A;  5EP4 A;  1DGF A;  4MNK A;  2MJ5 B;  4Z2L A;  4W9Q A;  1NHW C;  1YSY A;  1QZ2 A;  3KOY E;  3Q8X A;  1T3T A;  4Z2J A;  4KO8 A;  5EXS A;  4LAX A;  1E9R A;  4JXJ A;  4MGV A;  2BJV A;  5LMU M;  4DV3 M;  2R18 A;  1K9T A;  2R0I A;  1SXJ A;  2F4E A;  4DR7 M;  4DRI A;  4ODP A;  1Z59 A;  2ZQT A;  1NWR A;  2RUR A;  4X65 M;  2QCU A;  4NOO B;  3CHE A;  3GLH A;  3U6D A;  4M9X A;  1J4H A;  1GJT A;  3A42 A;  2RRU A;  5KQD A;  1FD9 A;  5FLX S;  2A3B A;  3I04 M;  4MB7 A;  3JXV A;  4LY6 A;  4MNJ A;  4G4R A;  4L8R C;  2MRO B;  4F2L A;  1WXQ A;  5FTK A;  1PRB A;  4BB9 A;  3SMP A;  3K8Z A;  3GLI A;  4PT5 A;  4R7G A;  2L4F A;  4IIW A;  3JR4 A;  1V34 A;  2DZO B;  3B74 A;  1FKK A;  3JAM S;  5A2Q S;  2CV0 A;  2XH9 A;  3KSJ A;  2R45 A;  2VQF M;  3FTE A;  3RE8 A;  2AHM A;  4S3J A;  2A3C A;  1N78 A;  1PJT A;  3L26 A;  2N87 A;  1R6B X;  1Y8G A;  3CF0 A;  2MNT A;  5IWA M;  1D2K A;  3ZCB B;  1XMO M;  2D9F A;  3L28 A;  5I98 A;  3NWL A;  2DZN B;  2F21 A;  3AS1 A;  5HT1 A;  3WIJ A;  4PDI A;  2C9C A;  3TDB A;  3K1J A;  1G4A E;  4HL4 A;  3U5Z B;  2UXC M;  1W1P A;  1TH2 A;  2P5T A;  2O25 A;  4ZPT R;  3FY1 A;  3SAS A;  2B5U B;  2DT1 A;  1IY0 A;  3WH0 A;  1HKI A;  1VF8 A;  2V1C A;  1W1V A;  1VDL A;  3AS2 A;  5DYG A;  4QHS A;  4FAP A;  1MU5 A;  4G3O A;  2PV3 A;  1TH4 A;  5EJC A;  3ARP A;  3IEC A;  3QAU A;  2K47 A;  3FYD A;  2O5R A;  3WQW A;  3M0E A;  1LG2 A;  2Z8Y M;  4IQC A;  4AG5 A;  4NXN M;  3KAI A;  2KE0 A;  2ERC A;  5BR8 M;  4DZ3 A;  4TW8 A;  3TWL A;  2ETN A;  4O2T A;  2K0B X;  2R65 A;  4Q22 A;  1L1T A;  3SAU A;  1JVW A;  3RM9 A;  1Z6T A;  1NO1 A;  1FKS A;  1OIP A;  1NWT A;  3EY6 A;  1C9H A;  4B7H A;  1K3X A;  4P8U A;  4GIT A;  1G41 A;  1NWU A;  3O5P A;  4IT6 A;  4L78 A;  4NRV A;  1EYM A;  2JXN A;  3UQB A;  1LL7 A;  4MH0 E;  5H37 D;  4JFL A;  2LNH C;  3UK6 A;  2Y78 A;  2FFJ A;  1F8A B;  2G41 A;  2XP5 A;  4HBO A;  4MTV A;  3ZH9 B;  1HQC A;  1KFV A;  3T1H M;  1JQJ C;  1EFU B;  4J4O A;  4WKF A;  4MM3 B;  2C99 A;  1GKI A;  1R4G A;  4MGH A;  1FJG M;  1LL4 A;  3U60 A;  3L25 A;  2OOA A;  1W5T A;  2F2D A;  3W0L B;  1FKJ A;  2QPA A;  1IXZ A;  1PJJ A;  1ZU8 A;  1XWI A;  2MR9 A;  4BBA A;  1KSF X;  1HKJ A;  3HU3 A;  2UXD M;  3O5J A;  4IJF A;  2HWJ A;  2XGN A;  3KAB A;  1WR1 B;  1FJD A;  1FKB A;  1IXS A;  4JN6 A;  7CAT A;  4TUW A;  5DF0 A;  2K9D A;  3KZ7 A;  4Z2H A;  3E21 A;  4QNR A;  3KVW A;  2DSZ A;  3CGN A;  2J7O A;  3FD9 A;  3AL0 C;  3CTW B;  1N75 A;  3THG A;  4GRI A;  1LQ0 A;  2F5S A;  2ZBK B;  4CIZ A;  1QVR A;  5HWC A;  2EO2 A;  1EIJ A;  3J80 S;  4LFC M;  2VCD A;  5E6J A;  4OVZ B;  1W9V A;  4ZS6 A;  1MN3 A;  2JY8 A;  2VN1 A;  4HAR A;  4LF7 M;  4X64 M;  5HW7 A;  4II7 A;  3BOS A;  1GOI A;  2XP8 A;  2LHC A;  2Y21 A;  2D7H A;  2KRK A;  2E5L M;  1FKI A;  1Z5B A;  1H0G A;  2CRU A;  3ARV A;  4NNR A;  2LBC A;  4GIP A;  1HQY E;  1ROT A;  1QZE A;  4MNL A;  1LTM A;  1QQW A;  1PGY A;  1NJF A;  3TWK A;  4OU7 A;  4R3D A;  1L1P A;  2V6Z M;  4RNA A;  2XEP A;  3D8B A;  2LHG A;  3AS3 A;  3HY5 A;  3WHK A;  4Q7J A;  3VFD A;  1ZBK A;  1HJP A;  1IXR C;  1OFH A;  1PJS A;  1ZMU A;  2EUC A;  2PI6 A;  2M5Z A;  2JZ0 A;  1QAN A;  3W0F A;  3U6O A;  3SAV A;  1F4I A;  1Q3B A;  5FTN A;  3WD1 A;  3IHZ A;  2VII A;  2PV2 A;  4D80 A;  3U61 B;  3HWS A;  2DT3 A;  4AQY M;  4ODO A;  1FAP A;  3FRI A;  2LGO A;  2VF8 A;  2DXI A;  2MLY A;  1DV0 A;  4DZ2 A;  3CHD A;  1E9S A;  1UR8 A;  1F40 A;  1I4W A;  2WSC F;  3K92 A;  3GPY A;  4GGQ A;  2ZM6 M;  4N19 A;  3ARX A;  3H4M A;  5ITQ A;  1MX0 A;  2AWG A;  5DIU A;  1QAO A;  2BJW A;  2F5N A;  4QT2 A;  2V1U A;  4AKI A;  4ITQ A;  1YAT A;  3KS4 A;  1YW5 A;  1J4I A;  4LRT A;  3NBI A;  3VLF B;  1JB0 F;  2ITK A;  1XB2 B;  2GQF A;  4IBE A;  2DWM A;  3A45 A;  4NXM M;  3VKG A;  2DAM A;  3GLF B;  3KW6 A;  3ARY A;  3LCU A;  3O5E A;  4FN2 A;  2KFW A;  2ZQV A;  3LVW A;  4GIV A;  4LGM A;  2CFO A;  1FKD A;  1VDD A;  4B3R M;  2ZTD A;  3FUU A;  1XMQ M;  2KRU A;  1D7H A;  2XP4 A;  4ML4 A;  3B9A A;  2OPF A;  1BKF A;  3PVS A;  4U85 A;  1TGU A;  4DT4 A;  2UU9 M;  3KP0 E;  4W5W A;  2KR7 A;  2M1I A;  1JR3 D;  1E6P A;  2XP9 A;  1N33 M;  4FCW A;  2DG4 A;  1G71 A;  1NSF A;  1HT2 E;  3CZ8 A;  3OA5 A;  3U6E A;  3AOE A;  4GEW A;  5GPG A;  3UI6 A;  3KOW E;  1HJW A;  3JYM A;  3MMP A;  2F23 A;  4Z2G A;  3KAF A;  1VEG A;  4Z6Y A;  2DG9 A;  4DR1 M;  3PRB A;  4LFB M;  1WNO A;  1E94 E;  1RU3 A;  3U6P A;  4NSO B;  2C96 A;  3B9D A;  4L72 B;  4P8X A;  3U6M A;  5EP1 A;  4URI A;  3GRY A;  3G6M A;  1R5L A;  4S3K A;  3B7Z A;  3U6C A;  1D0L A;  2UZ5 A;  3TWM A;  4R5E A;  2ZR5 A;  4DV5 M;  1XHB A;  2LTU A;  1UM8 A;  1XRV A;  4G4N A;  4DWS C;  4LF5 M;  2R6F A;  2CV1 A;  4ODM A;  2KXE A;  1C7Y A;  3ARS A;  2QF8 A;  1NY6 A;  4ODQ A;  2M60 A;  4R0X A;  1HNX M;  5C18 A;  2JNH A;  3O5Q A;  4WK9 A;  1AIP C;  4RKU F;  5ITT A;  2Z4R A;  1QAM A;  2O01 F;  2CHV A;  3AJI B;  1FKG A;  4FWH A;  1YE9 A;  4R71 A;  4QNM A;  4J4N A;  1FKH A;  2ZR4 A;  1TDZ A;  4HEO A;  4G2P A;  1K3W A;  5ITX A;  1KYI A;  2QZ4 A;  1JNE A;  2R44 A;  3U6L A;  1NMV A;  2KZS A;  1GO5 A;  1JR3 A;  5DEZ A;  2JY7 A;  1IN6 A;  1VQ1 A;  1HNZ M;  4MAV A;  2XSZ D;  1TF0 B;  2FNA A;  3GO8 A;  4DRO A;  5EXT A;  3VDU A;  2EKF A;  2Q2E B;  1O6I A;  4JV5 M;  1G59 A;  3IK8 A;  4OX9 M;  2LVP C;  4CJ6 A;  5EP2 A;  1UR9 A;  2DNA A;  3LMM A;  4LJ6 A;  4DWS B;  1QYR A;  2A5Y B;  2FAP A;  1IBL M;  3J81 S;  2RKO A;  5IT9 S;  2PV1 A;  1P3Q Q;  1EDQ A;  4IBB A;  2KGJ A;  1FKT A;  4B3M M;  4AI6 A;  3ARZ A;  2L09 A;  1YUB A;  1E9L A;  3UGJ A;  2XP7 A;  1DO0 A;  2ZAO A;  1HJV A;  2KEB A;  4NSR A;  2FKE A;  1T6O A;  5BPV A;  4LJ8 A;  2DT2 A;  2FOI C;  4DV0 M;  4MGK E;  3AS0 A;  4BLC A;  3GLG B;  3PXG A;  1DGH B;  3U5Z A;  4FCV A;  3VK8 A;  2PBC A;  4I4L A;  5C1B A;  5HUA A;  5KPT A;  3L2A A;  1WHC A;  2XLJ A;  3HJQ A;  3WL0 A;  2X8A A;  3V76 A;  4LJ9 A;  4DR3 M;  3FTC A;  4D81 A;  2FE8 A;  1OGB A;  2M08 A;  3B7N A;  1ZK6 A;  1J6Y A;  3GRU A;  2PPP A;  4JI6 M;  4LZJ A;  1LG1 A;  4GMQ A;  1HKK A;  4Z2K A;  2K6B A;  3O5F A;  1TR8 A;  3UF8 A;  2MLX A;  2RGO A;  4KOD A;  5DYI A;  4DRH A;  2J5Y A;  4M9Z A;  1XXH E;  3RM8 A;  2I7N A;  1KFW A;  2DSV A;  3DOA A;  3B8S A;  4LAV A;  3TCZ A;  4DR5 M;  2Y0T A;  1KT1 A;  5EXP A;  4JI5 M;  5F3W A;  4I5S A;  3EIH A;  3VAW A;  4LJA A;  2BNK A;  3LQR A;  4L3N A;  2LH0 A;  3TL4 X;  4WUR A;  2XSZ A;  4NC6 A;  1IFY A;  2L7H A;  2KNA A;  1IN7 A;  1NNJ A;  2LVA A;  2P4V A;  4DUY M;  1L2D A;  3HJ8 A;  3PFI A;  2I7P A;  5JH8 A;  3KOX E;  4JI0 M;  1N32 M;  4MGI E;  5HKG A;  1S3S A;  4JFJ A;  3HU1 A;  1L8Q A;  3C58 A;  2O9O A;  4MNM A;  3HJS A;  2RQS A;  1FFQ A;  4LF6 M;  2UXB M;  3FUX A;  1A5T A;  2L6O A;  3FAP A;  1X6N A;  3PRD A;  3UI5 A;  1Z5A A;  3PR9 A;  2KNZ A;  2K8I A;  1OAI A;  2HL7 A;  3O5L A;  3GU0 A;  4DUZ M;  2GNO A;  1Q6H A;  2JY6 B;  1UFZ A;  4JFK A;  1W5S A;  3GRR A;  3W4R A;  1OJL A;  4TX0 A;  3SAW A;  1D6O A;  2OO9 A;  3MDY B;  2YBT A;  5LMN M;  2XZU A;  4A3V B;  1OFI A;  3FUV A;  1R9H A;  1I94 M;  4JI3 M;  2ZQS A;  3VKH A;  3OTO M;  1QUS A;  4NZC A;  3UQI A;  4FW9 A;  4ODR A;  1OIZ A;  2ZAN A;  3KDS E;  2PN0 A;  2ZTC A;  4DRP A;  4JYS A;  4YHH M;  1SXJ E;  2DAE A;  4Z8X A;  1JNT A;  5IZ7 D;  1W9P A;  1OTR A;  3KOZ E;  3EIP A;  3E9S A;  3FTD A;  4FCT A;  1IBK M;  1BL4 A;  3GLH E;  3GTY X;  2JZ1 A;  2UUA M;  4P17 A;  2G5G X;  5DIT A;  4GC9 A;  1HR0 M;  2A3E A;  3ILK A;  1D0K A;  4IBF A;  1X37 A;  4OVZ A;  1R2Y A;  4G4Q A;  4I81 A;  4DV1 M;  3B9P A;  2JP7 A;  3GPX A;  3A46 A;  4DRK A;  2DAG A;  5HTG A;  2MH8 A;  3GLI E;  4HLQ A;  2F5Q A;  1OWQ A;  5GKN A;  3UJN A;  5E26 A;  1PBK A;  1EE8 A;  3GQ5 A;  3VDP A;  3ARR A;  1ZL1 A;  1D0M A;  1E32 A;  4YY3 M;  4C02 B;  3LW5 F;  3HHX A;  2JA2 A;  1HXV A;  1FFR A;  1WB0 A;  5J6E A;  5HW8 A;  3BBZ A;  3TE6 A;  3QWL A;  3R9X B;  2LVN C;  1Q39 A;  4S12 A;  2VF7 A;  2DEN A;  1XXH B;  1ZQ9 A;  2APL A;  5EXX A;  3ALG A;  2CEA A;  3O5G A;  2DAI A;  4IQ2 A;  4KHP M;  2DVW B;  1SXJ C;  4EIW A;  1TTE A;  2QNJ A;  3U61 A;  2QBY B;  4GHL A;  2OOB A;  2KDL A;  4DRJ A;  2BWB A;  1IBM M;  4LAY A;  4DV4 M;  3KP1 E;  4F1I A;  1DGB A;  1WIV A;  3QYB A;  4DR2 M;  1U79 A;  1GJS A;  2EUL A;  3T6P A;  1OGG A;  1Q02 A;  1AUA A;  1GL6 A;  4MSP A;  3O5M A;  5JI2 E;  3U6S A;  3IG5 A;  2CE7 A;  2DPE A;  1R2Z A;  3WKZ A;  2QQ8 A;  1CTN A;  5HWB A;  4X66 M;  1E6Z A;  2CV2 A;  4LG2 A;  1WJ7 A;  4FVM A;  1W1Y A;  4DR6 M;  1V33 A;  2IF4 A;  1IX5 A;  4JI7 M;  4REZ A;  1EIB A;  2XFT A;  3RGP A;  1IN8 A;  1TFV A;  4G6Z A;  2L2S A;  3IKG A;  1HJX A;  3FXY A;  4IT4 A;  4L6V 6;  2DSW A;  1D7J A;  4B7G A;  4LGX A;  4JI4 M;  3GLF A;  1ZCN A;  2FDM A;  1IY2 A;  4XAK A;  1LJY A;  1Q1C A;  1X6L A;  4B3S M;  3DFZ A;  2ZQU A;  3LVV A;  2BWE A;  3LUO A;  2DHY A;  3CGM A;  5JI3 E;  3O5O A;  4DH0 A;  3PRA A;  4L15 A;  2F4V M;  4LCB A;  4JI8 M;  1ROU A;  1SXJ B;  4XGI A;  1NVM A;  1ORY B;  3B89 A;  4D82 A;  3WD0 A;  4DIP A;  1G3I A;  4JI2 M;  2EKK A;  3A98 B;  3RFW A;  1W1T A;  1J5E M;  4WIW A;  2R46 A;  1N77 A;  3UQA A;  3GLH B;  2DKL A;  2XZF A;  4LJ7 A;  1VEK A;  2XF3 A;  1EHN A;  3ODK A;  2MLZ A;  2D7G A;  2ZR6 A;  3HHW A;  1QPF A;  3TQS A;  2HCB A;  1E15 A;  1PIN A;  4OW0 A;  3WD4 A;  1PJI A;  2DG3 A;  1GL7 A;  3M6A A;  3BMB A;  5B8I C;  2F5P A;  3ZQJ A;  1NV9 A;  4QOZ C;  2EJS A;  2R62 A;  1HT1 E;  1MJG M;  4DWS D;  1NWS A;  2EA0 A;  4Y28 F;  5KO3 A;  2LKN A;  4ODL A;  3GLI B;  4UN2 B;  1GLN A;  4DV7 M;  4QIB A;  4LJ5 A;  4ZPW R;  4GHA A;  3SHF A;  2DI0 A;  4AKH A;  3I4V A;  1KT0 A;  5DO2 A;  1NMW A;  2KW0 A;  4IBC A;  1Q6U A;  2XFS A;  1XHG A;  1BVS A;  2OFN A;  2JWS A;  2J7N A;  3RM4 A;  5ITR A;  3W67 A;  4LGY A;  1LL6 A;  3SFZ A;  5KPR A;  4AW4 A;  1GPF A;  3HZJ A;  4CGY B;  1K82 A;  2Z4S A;  3O5R A;  2LWX A;  4LF4 M;  2G3Q A;  1J4R A;  4IBJ A;  2X4A A;  3MHV C;  2YR0 A;  3TC5 A;  3IKD A;  4FD2 A;  2WM0 A;  3GP1 A;  4MPK A;  3MK6 A;  4IPX A;  4IJE A;  3WHL A;  1IY1 A;  2DWN A;  2FS1 A;  3QYE A;  1XNR M;  4TYO A;  1N36 M;  3KXE C;  2CWB A;  3LQQ A;  3F92 A;  3HKP A;  4QOS A;  2RGH A;  3C3D A;  3B9E A;  3FYC A;  2JZV A;  2QP9 X;  2H1R A;  3U6Q A;  1LV7 A;  1R7R A;  2X49 A;  2HAK A;  2DAK A;  1T43 A;  1T11 A;  1RD6 A;  1C1K A;  4GH9 A;  4W9O A;  4UDM A;  4DBG B;  3HHZ A;  4WW0 A;  3CH9 A;  2PPO A;  3PNY A;  3DZD A;  4QT3 A;  4ANR A;  3SAR A;  1GAB A;  3I51 A;  5DNY A;  2JUJ A;  5FTL A;  4DV6 M;  2Q5A A;  4GKJ M;  3FRH A;  2YBU A;  1D2N A;  5EQT A;  2UUB M;  4QHT A;  3PA7 A;  2YFQ A;  2A3A A;  3IHP A;  4KLN A;  3I6C A;  4DWS A;  5DFL A;  5BXJ A;  3MJ5 A;  3GPK A;  4PTM A;  1ITX A;  3G6L A;  3E4R A;  3LCV B;  3O5D A;  3NBX X;  1WGL A;  3IG8 A;  1IN4 A;  4CIS A;  3WD2 A;  2QHO B;  5IRE B;  5KQ8 A;  2JY5 A;  2XP3 A;  2AOS A;  2WK2 A;  3KAG A;  3T38 A;  4DV2 M;  3J7A S;  2OLH A;  4L16 A;  3UI4 A;  4IBK A;  3GLG A;  1SYT A;  3QOK A;  1DGH A;  1NY5 A;  4B7F A;  1QDR A;  4LJ4 A;  5KPZ A;  3K9O A;  1Z5C A;  2G8L A;  2RUQ A;  2YQZ A;  3RGC A;  3BXW A;  2F5O A;  1IM2 A;  3AQU A;  3JR5 A;  2ZAM A;  3AFH A;  2KA6 B;  2KO7 A;  2XPA A;  1GUV A;  3GRV A;  4TW7 A;  2WLZ A;  1OQY A;  5EP3 A;  3U60 B;  1FKF A;  4KR0 B;  3JYJ A;  2M2A A;  4PD2 A;  1PJQ A;  1FNN A;  3SHG B;  1NV8 A;  4DRM A;  4LZZ A;  3GQ4 A;  1VG5 A;  4G50 A;  3AV0 A;  4ODN A;  1E6N A;  3T15 A;  1W26 A;  2Y20 A;  1IXS B;  2DZL A;  1SR0 A;  2DHR A;  2H5X A;  1NSG A;  4WP2 A;  1H0I A;  2WSF F;  2QEN A;  2L4E A;  3GLF E;  2WSE F;  4Z2I A;  3CHC A;  4IBI A;  3ARW A;  3L29 A;  4HBE A;  4AKG A;  4ZPV R;  2Y0Q A;  3SYL A;  4JFM A;  2KZU A;  3K9P A;  4B08 A;  3O5K A;  3HX3 A;  4WKA A;  1VEJ A;  4GC5 A;  1HKM A;  1XNQ M;  2DWL A;  1YLA A;  1ZV1 A;  2RUD A;  4IBD A;  3CGW A;  3K2L A;  1G8P A;  3J7B A;  4JFI A;  5DIV A;  2C5R A;  2R4E A;  3KAD A;  2IUZ A;  1EQ3 A;  4ZPX A;  2KI3 A;  2HHH M;  3J2P B;  3FUT A;  4TNS A;  1L1Z A;  3UMM A;  3NI6 A;  2LVQ D;  4NSB A;  4QZV B;  3R8F A;  4P8W A;  1ZAE A;  4JYA M;  3FTF A;  1IN5 A;  3UZU A;  2KNV A;  4P16 A;  3GPU A;  2L7I A;  1ZMV A;  1ZBC A;  4BF8 A;  1L2B A;  1NNU C;  1QUT A;  5HW6 A;  3NTP A;  3DA1 A;  1GRJ A;  1WGN A;  1JND A;  4DRN A;  4KT0 F;  2N35 A;  2XPB A;  3WD3 A;  3D8L A;  3OOB A;  1P5Q A;  5D75 A;  4RF1 A;  4W5U A;  3SAT A;  3L27 A;  1ZMW A;  2LJ4 A;  1E6R A;  3C3E A;  1JNS A;  3SC3 A;  2YNM D;  1Q6I A;  3NRK A;  1QZM A;  4G4O A;  5HBF A;  2CUZ A;  5FTM A;  2Z3X A;  1HNW M;  4NL4 H;  1J7K A;  4MGY E;  4MGZ E;  4L4U A;  2C98 A;  4I8O A;  2HKJ A;  1OAO C;  3AOE C;  5ITX E;  1XC8 A;  3KS8 A;  4GKK M;  4WJX A;  4LAW A;  2ESC A;  3EIE A;  2QSF X;  1GVN A;  3FUW A;  5GQB A;  1TDH A;  2LVO C;  4M0W A;  1Y0O A;  1JR3 E;  3SBJ A;  4K0K M;  2DSU A;  3RME A;  2RSE A;  3CF6 E;  2KHH A;  4JI1 M;  5ITU A;  5ITY A;  3AKZ A;  1ZB5 A;  3HU2 A;  1H6U A;  3ARU A;  3KCE A;  1WAW A;  3HHY A;  2B31 A;  3Q8G A;  4WKH A;  1D7I A;  4PCZ A;  1A7X A;  1DO2 A;  3ZC7 B;  4AG6 A;  2CHQ A;  3H4J A;  2R4J A;  1DGG A;  2B3T A;  2MGW A;  4Q7N A;  3FE3 A;  4IBG A;  1TCO C;  2O92 A; 
#chains in the Genus database with same CATH homology
 4LF9 M;  3I4Y A;  1QAQ A;  1NJG A;  3AOG A;  3B7X A;  4B3T M;  2OQ4 A;  4AY1 A;  1Q3C A;  2LXE A;  3M7G A;  1ZBV A;  2UUC M;  2RUC A;  1SXJ D;  2C9O A;  4P8V A;  1FKL A;  2D7E A;  3ALF A;  3GQ3 A;  1XXH A;  3HGI A;  4RF0 A;  1J09 A;  3O5I A;  2DWZ B;  2MF9 A;  2Z7J A;  3SMS A;  1QPL A;  4CHT B;  3TPZ A;  1ZBW A;  5FTJ A;  3RGS A;  1NH6 A;  4M0D A;  5GPR A;  3KSX A;  3ART A;  3SYK A;  2QBY A;  3J27 B;  3KFU G;  1IQP A;  1N1A A;  2LPV A;  2NQ8 C;  4KQZ A;  4U86 A;  3ARO A;  4PDG A;  4LFA M;  2G8Z A;  1FKR A;  4DRQ A;  4FWD A;  3CF2 A;  3KAH A;  3T1Y M;  2W82 A;  2MPH A;  8CAT A;  4NRW A;  3GPP A;  2WLY A;  1PM5 A;  4AZF A;  4LF8 M;  1N34 M;  4DR4 M;  4FWG A;  4LRS A;  2XP6 A;  3CHF A;  3VK7 A;  5FSW A;  2CHG A;  4ODK A;  1M5Y A;  3KAC A;  3WL1 A;  2VQE M;  3ARQ A;  3WQV A;  1W9U A;  4M9S A;  2DT0 A;  4XBO A;  3H9R B;  4U84 A;  1NHG C;  4X62 M;  1L2C A;  2PPN A;  4ITZ A;  1TH3 A;  4TW6 A;  3PNV A;  3FKE A;  1B6C A;  4W9P A;  5EP4 A;  1DGF A;  4MNK A;  4Z2L A;  4W9Q A;  1NHW C;  1YSY A;  1QZ2 A;  3KOY E;  3Q8X A;  1T3T A;  4Z2J A;  4KO8 A;  5EXS A;  4LAX A;  1E9R A;  4JXJ A;  4MGV A;  2BJV A;  5LMU M;  4DV3 M;  2R18 A;  1K9T A;  1SXJ A;  2F4E A;  4DR7 M;  4DRI A;  4ODP A;  1Z59 A;  2ZQT A;  1NWR A;  2RUR A;  4X65 M;  2QCU A;  4NOO B;  3CHE A;  3GLH A;  3U6D A;  4M9X A;  1J4H A;  3A42 A;  5KQD A;  1FD9 A;  5FLX S;  2A3B A;  4MB7 A;  3JXV A;  4LY6 A;  4MNJ A;  4G4R A;  4L8R C;  1WXQ A;  5FTK A;  4BB9 A;  3SMP A;  3K8Z A;  3GLI A;  4PT5 A;  4R7G A;  4IIW A;  3JR4 A;  2DZO B;  1FKK A;  3JAM S;  5A2Q S;  2CV0 A;  2XH9 A;  3KSJ A;  2R45 A;  2VQF M;  3FTE A;  3RE8 A;  2AHM A;  4S3J A;  2A3C A;  1N78 A;  3L26 A;  2N87 A;  1R6B X;  3CF0 A;  2MNT A;  5IWA M;  1D2K A;  3ZCB B;  1XMO M;  2D9F A;  3L28 A;  5I98 A;  3NWL A;  2DZN B;  2F21 A;  3AS1 A;  5HT1 A;  3WIJ A;  4PDI A;  2C9C A;  3TDB A;  3K1J A;  1G4A E;  4HL4 A;  3U5Z B;  2UXC M;  1W1P A;  1TH2 A;  2P5T A;  4ZPT R;  3FY1 A;  3SAS A;  2DT1 A;  1IY0 A;  3WH0 A;  1HKI A;  1VF8 A;  2V1C A;  1W1V A;  3AS2 A;  5DYG A;  4QHS A;  4FAP A;  1MU5 A;  2PV3 A;  1TH4 A;  5EJC A;  3ARP A;  3QAU A;  2K47 A;  3FYD A;  2O5R A;  3WQW A;  3M0E A;  1LG2 A;  4IQC A;  4AG5 A;  4NXN M;  3KAI A;  2KE0 A;  2ERC A;  5BR8 M;  4DZ3 A;  4TW8 A;  3TWL A;  4O2T A;  2R65 A;  4Q22 A;  1L1T A;  3SAU A;  1JVW A;  3RM9 A;  1Z6T A;  1FKS A;  1NWT A;  3EY6 A;  1C9H A;  4B7H A;  1K3X A;  4P8U A;  4GIT A;  1G41 A;  1NWU A;  3O5P A;  4IT6 A;  4L78 A;  4NRV A;  1EYM A;  3UQB A;  1LL7 A;  4MH0 E;  5H37 D;  4JFL A;  2LNH C;  3UK6 A;  2Y78 A;  2FFJ A;  1F8A B;  2G41 A;  2XP5 A;  4HBO A;  4MTV A;  3ZH9 B;  1HQC A;  1KFV A;  3T1H M;  1JQJ C;  4J4O A;  4WKF A;  4MM3 B;  2C99 A;  1GKI A;  4MGH A;  1FJG M;  1LL4 A;  3U60 A;  3L25 A;  1W5T A;  2F2D A;  3W0L B;  1FKJ A;  2QPA A;  1IXZ A;  1PJJ A;  1ZU8 A;  1XWI A;  4BBA A;  1KSF X;  1HKJ A;  3HU3 A;  2UXD M;  3O5J A;  4IJF A;  2XGN A;  3KAB A;  1FJD A;  1FKB A;  4JN6 A;  7CAT A;  4TUW A;  5DF0 A;  3KZ7 A;  4Z2H A;  4QNR A;  3KVW A;  2DSZ A;  3CGN A;  2J7O A;  3FD9 A;  3AL0 C;  3CTW B;  1N75 A;  3THG A;  4GRI A;  1LQ0 A;  2F5S A;  2ZBK B;  1QVR A;  5HWC A;  2EO2 A;  3J80 S;  4LFC M;  2VCD A;  5E6J A;  4OVZ B;  1W9V A;  4ZS6 A;  2VN1 A;  4HAR A;  4LF7 M;  4X64 M;  5HW7 A;  4II7 A;  3BOS A;  1GOI A;  2XP8 A;  2Y21 A;  2D7H A;  2KRK A;  2E5L M;  1FKI A;  1Z5B A;  1H0G A;  3ARV A;  4NNR A;  4GIP A;  1HQY E;  1ROT A;  4MNL A;  1QQW A;  1NJF A;  3TWK A;  4OU7 A;  4R3D A;  1L1P A;  2V6Z M;  4RNA A;  2XEP A;  3D8B A;  3AS3 A;  3WHK A;  3VFD A;  1ZBK A;  1IXR C;  1OFH A;  2EUC A;  2PI6 A;  2M5Z A;  1QAN A;  3W0F A;  3U6O A;  3SAV A;  1Q3B A;  5FTN A;  3WD1 A;  3IHZ A;  2VII A;  2PV2 A;  4D80 A;  3U61 B;  3HWS A;  2DT3 A;  4AQY M;  4ODO A;  1FAP A;  2LGO A;  2DXI A;  2MLY A;  4DZ2 A;  3CHD A;  1E9S A;  1UR8 A;  1F40 A;  1I4W A;  3K92 A;  3GPY A;  4GGQ A;  2ZM6 M;  4N19 A;  3ARX A;  3H4M A;  5ITQ A;  1MX0 A;  2AWG A;  5DIU A;  1QAO A;  2BJW A;  2F5N A;  4QT2 A;  2V1U A;  4AKI A;  4ITQ A;  1YAT A;  3KS4 A;  1YW5 A;  1J4I A;  4LRT A;  3NBI A;  3VLF B;  2ITK A;  4IBE A;  2DWM A;  3A45 A;  4NXM M;  3VKG A;  3GLF B;  3KW6 A;  3ARY A;  3O5E A;  4FN2 A;  2KFW A;  2ZQV A;  3LVW A;  4GIV A;  4LGM A;  2CFO A;  1FKD A;  1VDD A;  4B3R M;  3FUU A;  1XMQ M;  2KRU A;  1D7H A;  2XP4 A;  4ML4 A;  3B9A A;  2OPF A;  1BKF A;  3PVS A;  4U85 A;  1TGU A;  4DT4 A;  2UU9 M;  3KP0 E;  4W5W A;  2KR7 A;  2M1I A;  1JR3 D;  1E6P A;  2XP9 A;  1N33 M;  4FCW A;  2DG4 A;  1NSF A;  1HT2 E;  3CZ8 A;  3OA5 A;  3U6E A;  3AOE A;  3UI6 A;  5GPG A;  3KOW E;  1HJW A;  3JYM A;  4Z2G A;  3KAF A;  4Z6Y A;  2DG9 A;  4DR1 M;  3PRB A;  4LFB M;  1WNO A;  1E94 E;  3U6P A;  4NSO B;  2C96 A;  3B9D A;  4L72 B;  4P8X A;  3U6M A;  5EP1 A;  4URI A;  3GRY A;  3G6M A;  4S3K A;  3U6C A;  2UZ5 A;  3TWM A;  4R5E A;  2ZR5 A;  4DV5 M;  1XHB A;  1UM8 A;  1XRV A;  4G4N A;  4DWS C;  4LF5 M;  2CV1 A;  4ODM A;  2KXE A;  3ARS A;  2QF8 A;  1NY6 A;  4ODQ A;  2M60 A;  4R0X A;  1HNX M;  5C18 A;  3O5Q A;  4WK9 A;  5ITT A;  2Z4R A;  1QAM A;  2CHV A;  3AJI B;  1FKG A;  4FWH A;  1YE9 A;  4QNM A;  4J4N A;  1FKH A;  2ZR4 A;  1TDZ A;  4G2P A;  1K3W A;  5ITX A;  1KYI A;  2QZ4 A;  1JNE A;  3U6L A;  1NMV A;  2KZS A;  1JR3 A;  5DEZ A;  1IN6 A;  1HNZ M;  4MAV A;  2XSZ D;  2FNA A;  3GO8 A;  4DRO A;  5EXT A;  3VDU A;  2Q2E B;  1O6I A;  4JV5 M;  1G59 A;  3IK8 A;  4OX9 M;  5EP2 A;  1UR9 A;  3LMM A;  4LJ6 A;  4DWS B;  1QYR A;  2A5Y B;  2FAP A;  1IBL M;  3J81 S;  2RKO A;  5IT9 S;  2PV1 A;  1EDQ A;  4IBB A;  2KGJ A;  1FKT A;  4B3M M;  4AI6 A;  3ARZ A;  2L09 A;  1YUB A;  1E9L A;  3UGJ A;  2XP7 A;  1DO0 A;  2ZAO A;  1HJV A;  2KEB A;  4NSR A;  2FKE A;  5BPV A;  4LJ8 A;  2DT2 A;  2FOI C;  4DV0 M;  4MGK E;  3AS0 A;  4BLC A;  3GLG B;  3PXG A;  1DGH B;  3U5Z A;  4FCV A;  3VK8 A;  2PBC A;  4I4L A;  5C1B A;  5HUA A;  5KPT A;  3L2A A;  2XLJ A;  3HJQ A;  3WL0 A;  2X8A A;  4LJ9 A;  4DR3 M;  3FTC A;  4D81 A;  2FE8 A;  1OGB A;  2M08 A;  1ZK6 A;  1J6Y A;  3GRU A;  2PPP A;  4JI6 M;  4LZJ A;  1LG1 A;  4GMQ A;  1HKK A;  4Z2K A;  3O5F A;  3UF8 A;  2MLX A;  2RGO A;  4KOD A;  5DYI A;  4DRH A;  4M9Z A;  3RM8 A;  2I7N A;  1KFW A;  2DSV A;  3DOA A;  3B8S A;  4LAV A;  3TCZ A;  4DR5 M;  2Y0T A;  1KT1 A;  5EXP A;  4JI5 M;  5F3W A;  4I5S A;  3EIH A;  3VAW A;  4LJA A;  2BNK A;  3LQR A;  4L3N A;  2LH0 A;  3TL4 X;  4WUR A;  2XSZ A;  2L7H A;  1IN7 A;  1NNJ A;  4DUY M;  1L2D A;  3HJ8 A;  3PFI A;  2I7P A;  5JH8 A;  3KOX E;  4JI0 M;  1N32 M;  4MGI E;  5HKG A;  1S3S A;  4JFJ A;  3HU1 A;  1L8Q A;  3C58 A;  2O9O A;  4MNM A;  3HJS A;  2RQS A;  1FFQ A;  4LF6 M;  2UXB M;  3FUX A;  2L6O A;  3FAP A;  1X6N A;  3PRD A;  3UI5 A;  1Z5A A;  3PR9 A;  2K8I A;  2HL7 A;  3O5L A;  4DUZ M;  1Q6H A;  4JFK A;  1W5S A;  3GRR A;  3W4R A;  1OJL A;  4TX0 A;  3SAW A;  1D6O A;  3MDY B;  2YBT A;  5LMN M;  2XZU A;  4A3V B;  1OFI A;  3FUV A;  1R9H A;  1I94 M;  4JI3 M;  2ZQS A;  3VKH A;  3OTO M;  4NZC A;  3UQI A;  4FW9 A;  4ODR A;  2ZAN A;  3KDS E;  4DRP A;  4JYS A;  4YHH M;  1SXJ E;  4Z8X A;  1JNT A;  5IZ7 D;  1W9P A;  3KOZ E;  3E9S A;  3FTD A;  4FCT A;  1IBK M;  1BL4 A;  2UUA M;  2G5G X;  5DIT A;  4GC9 A;  1HR0 M;  2A3E A;  3ILK A;  4IBF A;  1X37 A;  4OVZ A;  1R2Y A;  4G4Q A;  4I81 A;  4DV1 M;  3B9P A;  3GPX A;  3A46 A;  4DRK A;  5HTG A;  1OWQ A;  4HLQ A;  2F5Q A;  5GKN A;  3UJN A;  5E26 A;  1PBK A;  1EE8 A;  3GQ5 A;  3VDP A;  3ARR A;  1ZL1 A;  1E32 A;  4YY3 M;  4C02 B;  3HHX A;  2JA2 A;  1HXV A;  1FFR A;  1WB0 A;  5J6E A;  5HW8 A;  3TE6 A;  3QWL A;  3R9X B;  1Q39 A;  4S12 A;  1XXH B;  1ZQ9 A;  5EXX A;  3ALG A;  2CEA A;  3O5G A;  4IQ2 A;  4KHP M;  2DVW B;  1SXJ C;  4EIW A;  3U61 A;  2QBY B;  4GHL A;  4DRJ A;  1IBM M;  4LAY A;  4DV4 M;  3KP1 E;  1DGB A;  4DR2 M;  1U79 A;  1OGG A;  1GL6 A;  4MSP A;  3O5M A;  5JI2 E;  3U6S A;  3IG5 A;  2CE7 A;  2DPE A;  1R2Z A;  3WKZ A;  1CTN A;  5HWB A;  4X66 M;  1E6Z A;  2CV2 A;  4LG2 A;  4FVM A;  1W1Y A;  4DR6 M;  2IF4 A;  1IX5 A;  4JI7 M;  4REZ A;  1EIB A;  2XFT A;  3RGP A;  1IN8 A;  1TFV A;  4G6Z A;  2L2S A;  3IKG A;  1HJX A;  3FXY A;  4IT4 A;  2DSW A;  1D7J A;  4B7G A;  4LGX A;  4JI4 M;  3GLF A;  1ZCN A;  2FDM A;  1IY2 A;  4XAK A;  1LJY A;  1Q1C A;  1X6L A;  4B3S M;  3DFZ A;  2ZQU A;  3LVV A;  3LUO A;  3CGM A;  5JI3 E;  3O5O A;  4DH0 A;  3PRA A;  4L15 A;  2F4V M;  4LCB A;  4JI8 M;  1ROU A;  1SXJ B;  4XGI A;  1NVM A;  1ORY B;  4D82 A;  3WD0 A;  4DIP A;  1G3I A;  4JI2 M;  3A98 B;  3RFW A;  1W1T A;  1J5E M;  4WIW A;  2R46 A;  1N77 A;  3UQA A;  3GLH B;  2XZF A;  4LJ7 A;  2XF3 A;  1EHN A;  3ODK A;  2MLZ A;  2D7G A;  2ZR6 A;  3HHW A;  1QPF A;  3TQS A;  2HCB A;  1E15 A;  1PIN A;  4OW0 A;  3WD4 A;  1PJI A;  2DG3 A;  1GL7 A;  3M6A A;  5B8I C;  2F5P A;  4QOZ C;  2R62 A;  1HT1 E;  4DWS D;  1NWS A;  2EA0 A;  5KO3 A;  2LKN A;  4ODL A;  3GLI B;  1GLN A;  4DV7 M;  4QIB A;  4LJ5 A;  4ZPW R;  4GHA A;  3SHF A;  1KT0 A;  4AKH A;  3I4V A;  5DO2 A;  1NMW A;  2KW0 A;  4IBC A;  1Q6U A;  2XFS A;  1XHG A;  2OFN A;  2J7N A;  3RM4 A;  5ITR A;  4LGY A;  1LL6 A;  3SFZ A;  5KPR A;  4AW4 A;  1GPF A;  4CGY B;  1K82 A;  2Z4S A;  3O5R A;  2LWX A;  4LF4 M;  1J4R A;  4IBJ A;  2X4A A;  3MHV C;  2YR0 A;  3TC5 A;  3IKD A;  4FD2 A;  2WM0 A;  3GP1 A;  4MPK A;  3MK6 A;  4IPX A;  4IJE A;  3WHL A;  1IY1 A;  2DWN A;  1XNR M;  4TYO A;  1N36 M;  3KXE C;  3LQQ A;  3HKP A;  4QOS A;  2RGH A;  3B9E A;  3FYC A;  2JZV A;  2QP9 X;  2H1R A;  3U6Q A;  1LV7 A;  1R7R A;  2X49 A;  1T11 A;  1RD6 A;  1C1K A;  4GH9 A;  4W9O A;  3HHZ A;  4WW0 A;  3CH9 A;  2PPO A;  3PNY A;  3DZD A;  4QT3 A;  3SAR A;  3I51 A;  5DNY A;  5FTL A;  4DV6 M;  2Q5A A;  4GKJ M;  2YBU A;  1D2N A;  5EQT A;  2UUB M;  4QHT A;  3PA7 A;  2YFQ A;  2A3A A;  4KLN A;  3I6C A;  4DWS A;  5BXJ A;  3MJ5 A;  3GPK A;  4PTM A;  1ITX A;  3G6L A;  3E4R A;  3O5D A;  3IG8 A;  1IN4 A;  4CIS A;  3WD2 A;  5IRE B;  5KQ8 A;  2XP3 A;  2AOS A;  2WK2 A;  3KAG A;  3T38 A;  4DV2 M;  3J7A S;  2OLH A;  4L16 A;  3UI4 A;  4IBK A;  3GLG A;  1SYT A;  3QOK A;  1DGH A;  1NY5 A;  4B7F A;  4LJ4 A;  5KPZ A;  1Z5C A;  2G8L A;  2RUQ A;  2YQZ A;  3RGC A;  3BXW A;  2F5O A;  1IM2 A;  3AQU A;  3JR5 A;  2ZAM A;  3AFH A;  2KA6 B;  2KO7 A;  2XPA A;  1GUV A;  3GRV A;  4TW7 A;  2WLZ A;  5EP3 A;  3U60 B;  1FKF A;  4KR0 B;  3JYJ A;  2M2A A;  4PD2 A;  1FNN A;  3SHG B;  4DRM A;  4LZZ A;  3GQ4 A;  4G50 A;  3AV0 A;  4ODN A;  1E6N A;  3T15 A;  1W26 A;  2Y20 A;  1IXS B;  1SR0 A;  2DHR A;  1NSG A;  1H0I A;  2QEN A;  4Z2I A;  3CHC A;  4IBI A;  3ARW A;  3L29 A;  4HBE A;  4AKG A;  4ZPV R;  2Y0Q A;  3SYL A;  4JFM A;  2KZU A;  4B08 A;  3O5K A;  4WKA A;  4GC5 A;  1HKM A;  1XNQ M;  2DWL A;  2RUD A;  4IBD A;  3K2L A;  1G8P A;  3J7B A;  4JFI A;  5DIV A;  2C5R A;  2R4E A;  3KAD A;  2IUZ A;  1EQ3 A;  4ZPX A;  2KI3 A;  2HHH M;  3J2P B;  3FUT A;  4TNS A;  1L1Z A;  3UMM A;  3NI6 A;  4NSB A;  4QZV B;  3R8F A;  4P8W A;  1ZAE A;  4JYA M;  3FTF A;  1IN5 A;  3UZU A;  4P16 A;  3GPU A;  2L7I A;  1ZBC A;  4BF8 A;  1L2B A;  1NNU C;  5HW6 A;  3NTP A;  3DA1 A;  1JND A;  4DRN A;  2XPB A;  3WD3 A;  3D8L A;  3OOB A;  1P5Q A;  5D75 A;  4RF1 A;  4W5U A;  3SAT A;  3L27 A;  2LJ4 A;  1E6R A;  1JNS A;  3SC3 A;  2YNM D;  1Q6I A;  3NRK A;  1QZM A;  4G4O A;  5HBF A;  2CUZ A;  5FTM A;  2Z3X A;  1HNW M;  4NL4 H;  1J7K A;  4MGY E;  4MGZ E;  4L4U A;  2C98 A;  4I8O A;  2HKJ A;  3AOE C;  5ITX E;  1XC8 A;  3KS8 A;  4GKK M;  4WJX A;  4LAW A;  2ESC A;  3EIE A;  1GVN A;  3FUW A;  5GQB A;  1TDH A;  4M0W A;  1Y0O A;  3SBJ A;  4K0K M;  2DSU A;  3RME A;  2RSE A;  3CF6 E;  4JI1 M;  5ITU A;  5ITY A;  3AKZ A;  1ZB5 A;  3HU2 A;  1H6U A;  3ARU A;  3KCE A;  1WAW A;  3HHY A;  2B31 A;  4WKH A;  1D7I A;  4PCZ A;  1A7X A;  1DO2 A;  3ZC7 B;  4AG6 A;  2CHQ A;  2R4J A;  1DGG A;  4Q7N A;  4IBG A;  1TCO C;  2O92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...