3IKDA

Structure-based design of novel pin1 inhibitors (i)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 36
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ikdA00
2DG9A 2KGJA 2ZQUA 3FAPA 4R0XA 3NI6A 3LUOA 2XP5A 4DRHA 5HKGA 2M08A 2M1IA 2PV2A 2UZ5A 4DZ2A 2RUQA 3O5OA 3VAWA 2RUDA 4DIPA 2RSEA 2XP4A 5DIUA 3UI6A 3O5PA 5HUAA 2ZQSA 4BF8A 4DRQA 1FKTA 1BKFA 3TDBA 2RQSA 4W9OA 1QPLA 1NMWA 1Q6IA 3NTPA 5DIVA 2MF9A 2MPHA 3WH0A 1FKSA 2PBCA 1FKDA 2F4EA 4J4NA 1N1AA 1JVWA 1YW5A 1D7HA 4GGQA 3H9RB 4C02B 3IKDA 2MLYA 3O5RA 1U79A 4QT3A 4DRNA 5HW8A 1JNSA 4O2TA 4U86A 1FKRA 2XP9A 4DROA 3UQBA 2PPOA 3KAGA 2MNTA 1NSGA 2ZR6A 3JYJA 2XP7A 1EYMA 3KZ7A 3JYMA 4IQ2A 4MSPA 1C9HA 2RUCA 2L2SA 4TNSA 4DRJA 4JFJA 5HT1A 3O5IA 3O5FA 1J6YA 4TW7A 2VN1A 1J4RA 2XPBA 3I6CA 3O5KA 1FJDA 3ODKA 1TCOC 2OFNA 3PRBA 4TW8A 4DT4A 4DRIA 2Y78A 1ZCNA 1D7IA 5HWBA 4TYOA 2LPVA 2KI3A 2AWGA 3O5DA 1KT0A 1QZ2A 3O5JA 4IPXA 2N87A 1A7XA 2Q5AA 4FN2A 2KR7A 2PV1A 4J4OA 3O5MA 1J4IA 2MLZA 2ZR4A 2PV3A 2M2AA 4N19A 3KADA 2PPPA 1FKJA 2FAPA 3UQAA 3KACA 3IHZA 1L1PA 4LAVA 4NNRA 1JNTA 2ITKA 3PA7A 1FKIA 4QT2A 4JFLA 2FKEA 2VCDA 2RURA 2ZQVA 3IKGA 5HWCA 1HXVA 1R9HA 2ZR5A 4ODNA 1ZK6A 1PINA 3KAFA 1YATA 4LAYA 3UI4A 4JYSA 1M5YA 3KAHA 2KO7A 4ODMA 1BL4A 1Q6UA 2DG4A 3KABA 2DG3A 2ZQTA 5D75A 1F40A 3O5LA 5I98A 3CGNA 2XP8A 3KCEA 4MGVA 4JFIA 3JXVA 1F8AB 3IK8A 2LGOA 4G50A 4ODQA 1EQ3A 3O5GA 1FKHA 4ODOA 3B7XA 5BXJA 4DZ3A 3UQIA 4DRMA 3RFWA 1ROUA 3EY6A 2XP6A 5HW6A 4JFMA 2D9FA 2JZVA 4LAWA 1NMVA 5J6EA 4ODKA 1Q1CA 1QPFA 4ODLA 5HW7A 2MLXA 3MDYB 4FAPA 1P5QA 4U85A 1J4HA 4DH0A 3UI5A 4LAXA 5HTGA 1FAPA 1KT1A 3O5QA 5GPGA 3TCZA 1W26A 3RGCA 3PRDA 2XPAA 1B6CA 1FKBA 4U84A 1D7JA 3GPKA 3KAIA 5DITA 5B8IC 2LKNA 4DRKA 4ODPA 3CGMA 1FKKA 2KE0A 4QIBA 2F21A 4ODRA 2IF4A 1FKLA 1Q6HA 4GIVA 1Y0OA 2PPNA 1FD9A 2KFWA 4TW6A 3OOBA 1T11A 2K8IA 1PBKA 3TC5A 4DRPA 3O5EA 1FKFA 4TX0A 2XP3A 4W9PA 4ITZA 2F2DA 4W9QA 4G2PA 3UF8A 1D6OA 1ROTA 2LJ4A 4JFKA 3NRKA 1FKGA 4IQCA
chains in the Genus database with same CATH superfamily
4P8WA 2ZQUA 4IT4A 4L72B 2IUZA 2UZ5A 3O5OA 3B9AA 2XP4A 3AS0A 3UI6A 1W1YA 2ZQSA 4DWSC 4ZPTR 4UDMA 1NMWA 2DT1A 1ZBWA 4MAVA 1FKSA 1W9UA 4Z2JA 1K9TA 4GGQA 3IKDA 4QT3A 4Z2KA 3B9EA 2A3AA 1IX5A 1HJXA 4URIA 2XP9A 1X6NA 3BXWA 3KZ7A 4IQ2A 2QF8A 3O5IA 3O5FA 4TW7A 1J4RA 2XPBA 3O5KA 4TW8A 4TYOA 4IPXA 2Q5AA 4Z2GA 2KR7A 2EULA 3GTYX 5JH8A 1FKJA 1W9VA 4DWSD 3UQAA 4LAVA 4QT2A 3B9DA 2A3CA 3KAFA 4JYSA 2KO7A 1NWTA 3KABA 3ALFA 5D75A 3ARTA 3G6MA 3G6LA 1E6RA 4MNLA 2O92A 4ODQA 1FKHA 1JNDA 4ODOA 4P8XA 3UQIA 4DRMA 4LAWA 4ODKA 1QPFA 2MLXA 1W9PA 4FAPA 2FDMA 4U85A 3OA5A 4WIWA 2DSVA 4HBOA 3WD0A 4Z2LA 4XAKA 1LG1A 4DWSB 4QIBA 4ODRA 2IF4A 4QZVB 2F23A 1FD9A 3ALGA 3TC5A 3O5EA 4W9PA 1FFQA 5DF0A 3EIPA 4WK9A 5HWBA 3AS2A 2PN0A 2M1IA 1NWSA 2RSEA 4DWSA 2A3EA 4NSBA 2DSUA 2RQSA 4W9OA 1E6ZA 1ZBCA 1Q6IA 4MNJA 1OGGA 2PBCA 1FKDA 1ZU8A 2B31A 1E9LA 1D7HA 4DRNA 3O5RA 2MLYA 5HW8A 5GQBA 3CHDA 4U86A 4DROA 3ARWA 1E44A 2ZR6A 1W1PA 1WNOA 1C9HA 2L2SA 1H0IA 1HKJA 1FJDA 3ODKA 3PRBA 4DRIA 1ZCNA 1EDQA 2KI3A 2AWGA 2LPVA 1UR9A 1QZ2A 4S3KA 3O5JA 3RM9A 2PV1A 1J4IA 2M2AA 4N19A 1KFWA 3IHZA 4ZS6A 2G41A 2ITKA 5HWCA 4JFLA 2VCDA 2RURA 2ZQVA 3AS1A 4ODNA 3W4RA 1HKMA 1NH6A 1M5YA 3KAHA 3AQUA 4ODMA 2DG4A 3O5LA 1WB0A 3CGNA 1X6LA 3KCEA 2DT2A 1F8AB 3WL1A 1XRVA 2YBUA 3QOKA 1LL4A 1SR0A 3B7XA 3RFWA 3EY6A 2XP6A 5J6EA 2D9FA 1NMVA 4ZPWR 3MDYB 1P5QA 1EHNA 4DH0A 1J4HA 3RMEA 1E6PA 1KT1A 2PI6A 4WKFA 1LJYA 1UR8A 1HKKA 3KAIA 5DITA 2LKNA 4DRKA 1FKKA 4GIVA 1Q6HA 2DT0A 1Y0OA 2KFWA 4HBEA 3RM4A 1PBKA 1ZL1A 2XP3A 4PTMA 1NWUA 4W9QA 1FKGA 4R0XA 2XP5A 2PV2A 2ETNA 4DZ2A 3ARSA 2RUQA 3PRAA 3VAWA 2RUDA 4DIPA 1LQ0A 3O5PA 4ZPVR 1BKFA 3TDBA 1VF8A 3NTPA 5DIVA 2MPHA 3WH0A 4J4NA 1N1AA 3FY1A 1ITXA 2DSZA 3WD2A 4MTVA 5DO2A 3H9RB 1U79A 1JNSA 4O2TA 3ARUA 4Z2HA 4S3JA 3ARYA 3KAGA 1NSGA 1NWRA 1XHGA 1EYMA 3PR9A 4DRJA 5HT1A 1JCHB 2VN1A 3AS3A 2O9OA 2OFNA 4MNMA 1CTNA 4DT4A 2Y78A 1D7IA 1O6IA 2P4VA 3O5DA 1KT0A 2N87A 2ZR4A 3KADA 2PPPA 2FAPA 3WQWA 1L1PA 4NNRA 3PA7A 1FKIA 4Z2IA 1LL6A 3FXYA 1R9HA 2ZR5A 3ARRA 1PINA 3UI4A 4ML4A 3CHCA 2DPEA 1F40A 5I98A 2XP8A 4MGVA 3ARPA 4JFIA 3JXVA 4G50A 1GRJA 3AROA 4DZ3A 3WIJA 4Q22A 2G8ZA 3CHFA 1ROUA 5HW6A 4JFMA 2JZVA 3UQBA 5GPRA 1Q1CA 1SYTA 3ARXA 3UI5A 4LAXA 1W1VA 5HTGA 1FAPA 3TCZA 1ZBKA 1FKBA 1D7JA 2ESCA 1TFVA 2OLHA 5B8IC 1FFRA 2PPNA 3OOBA 2WK2A 3CZ8A 1LL7A 4MPKA 1T11A 1FKFA 4TX0A 4G2PA 3ARZA 1ROTA 2LJ4A 2DT3A 2B5UB 4JFKA 3NRKA 4IQCA 2DG9A 2KGJA 4P8VA 3FAPA 3NI6A 3LUOA 4DRHA 5HKGA 2M08A 1E6NA 5HUAA 1W1TA 5DIUA 3WQVA 4BF8A 4DRQA 1FKTA 4KR0B 4R5EA 1QPLA 1OWQA 1GOIA 2MF9A 3ARVA 3RM8A 2F4EA 2AOSA 1JVWA 1YW5A 4C02B 4AY1A 1HJWA 1FKRA 2PPOA 1HJVA 2MNTA 3JYJA 2XP7A 3JYMA 4MSPA 5HBFA 2RUCA 4TNSA 4JFJA 1J6YA 4WJXA 1GPFA 1WAWA 3I6CA 3CHEA 5DEZA 1TCOC 2WLYA 1ZB5A 3CH9A 4Q7NA 4W5UA 1A7XA 4FN2A 4J4OA 3O5MA 2WLZA 2MLZA 1HKIA 2PV3A 1ZBVA 3KACA 4NZCA 1JNTA 1OGBA 1HXVA 2FKEA 3IKGA 1ZK6A 4WKHA 1YATA 4LAYA 3WD1A 1BL4A 1Q6UA 4LGXA 1E15A 4MNKA 2DG3A 2ZQTA 2A3BA 3IK8A 3WKZA 2LGOA 1GUVA 2WM0A 1EQ3A 3O5GA 2DSWA 5BXJA 4HARA 5HW7A 4ODLA 1D2KA 3WL0A 3O5QA 5GPGA 1W26A 3RGCA 3BMBA 3PRDA 2XPAA 1B6CA 4U84A 4WKAA 1LG2A 3GPKA 1JNEA 4P8UA 3WD4A 1EIBA 4ODPA 3B8SA 3CGMA 2KE0A 4KQZA 2F21A 1FKLA 3GU0A 1H0GA 4TW6A 2YBTA 2K8IA 4DRPA 4IT6A 4ITZA 2F2DA 3UF8A 4L3NA 1D6OA 1RD6A 3ARQA 3WD3A
chains in the Genus database with same CATH topology
4P8WA 2ZQUA 4IT4A 4L72B 2IUZA 2UZ5A 3O5OA 3B9AA 2XP4A 3AS0A 3UI6A 1W1YA 2ZQSA 4DWSC 4ZPTR 1NMWA 2DT1A 1ZBWA 4MAVA 1FKSA 1W9UA 4Z2JA 1K9TA 4GGQA 3IKDA 4QT3A 4Z2KA 3B9EA 2A3AA 1IX5A 1HJXA 4URIA 2XP9A 1X6NA 3BXWA 3KZ7A 4IQ2A 2QF8A 3O5IA 3O5FA 4TW7A 1J4RA 2XPBA 3O5KA 4TW8A 4TYOA 4IPXA 2Q5AA 4Z2GA 2KR7A 5JH8A 1FKJA 1W9VA 4DWSD 3UQAA 4LAVA 4QT2A 3B9DA 2A3CA 3KAFA 4JYSA 2KO7A 1NWTA 3KABA 3ALFA 5D75A 3ARTA 3G6MA 3G6LA 1E6RA 4MNLA 2O92A 4ODQA 1FKHA 1JNDA 4ODOA 4P8XA 3UQIA 4DRMA 4LAWA 4ODKA 1QPFA 2MLXA 1W9PA 4FAPA 2FDMA 4U85A 3OA5A 4WIWA 2DSVA 4HBOA 3WD0A 4Z2LA 4XAKA 1LG1A 4DWSB 4QIBA 4ODRA 2IF4A 4QZVB 1FD9A 3ALGA 3TC5A 3O5EA 4W9PA 1FFQA 5DF0A 4WK9A 5HWBA 3AS2A 2M1IA 1NWSA 2RSEA 4DWSA 2A3EA 4NSBA 2DSUA 2RQSA 4W9OA 1E6ZA 1ZBCA 1Q6IA 4MNJA 1OGGA 2PBCA 1FKDA 1ZU8A 2B31A 1E9LA 1D7HA 4DRNA 3O5RA 2MLYA 5HW8A 5GQBA 3CHDA 4U86A 4DROA 3ARWA 2ZR6A 1W1PA 1WNOA 1C9HA 2L2SA 1H0IA 1HKJA 1FJDA 3ODKA 3PRBA 4DRIA 1ZCNA 1EDQA 2KI3A 2AWGA 2LPVA 1UR9A 1QZ2A 4S3KA 3O5JA 3RM9A 2PV1A 1J4IA 2M2AA 4N19A 1KFWA 3IHZA 4ZS6A 2G41A 2ITKA 5HWCA 4JFLA 2VCDA 2RURA 2ZQVA 3AS1A 4ODNA 3W4RA 1HKMA 1NH6A 1M5YA 3KAHA 3AQUA 4ODMA 2DG4A 3O5LA 1WB0A 3CGNA 1X6LA 3KCEA 2DT2A 1F8AB 3WL1A 1XRVA 2YBUA 3QOKA 1LL4A 1SR0A 3B7XA 3RFWA 3EY6A 2XP6A 5J6EA 2D9FA 1NMVA 4ZPWR 3MDYB 1P5QA 1EHNA 4DH0A 1J4HA 3RMEA 1E6PA 1KT1A 2PI6A 4WKFA 1LJYA 1UR8A 1HKKA 3KAIA 5DITA 2LKNA 4DRKA 1FKKA 4GIVA 1Q6HA 2DT0A 1Y0OA 2KFWA 4HBEA 3RM4A 1PBKA 1ZL1A 2XP3A 4PTMA 1NWUA 4W9QA 1FKGA 4R0XA 2XP5A 2PV2A 4DZ2A 3ARSA 2RUQA 3PRAA 3VAWA 2RUDA 4DIPA 1LQ0A 3O5PA 4ZPVR 1BKFA 3TDBA 1VF8A 3NTPA 5DIVA 2MPHA 3WH0A 4J4NA 1N1AA 3FY1A 1ITXA 2DSZA 3WD2A 4MTVA 5DO2A 3H9RB 1U79A 1JNSA 4O2TA 3ARUA 4Z2HA 4S3JA 3ARYA 3KAGA 1NSGA 1NWRA 1XHGA 1EYMA 3PR9A 4DRJA 5HT1A 2VN1A 3AS3A 2O9OA 2OFNA 4MNMA 1CTNA 4DT4A 2Y78A 1D7IA 1O6IA 3O5DA 1KT0A 2N87A 2ZR4A 3KADA 2PPPA 2FAPA 3WQWA 1L1PA 4NNRA 3PA7A 1FKIA 4Z2IA 1LL6A 3FXYA 1R9HA 2ZR5A 3ARRA 1PINA 3UI4A 4ML4A 3CHCA 2DPEA 1F40A 5I98A 2XP8A 4MGVA 3ARPA 4JFIA 3JXVA 4G50A 3AROA 4DZ3A 3WIJA 4Q22A 2G8ZA 3CHFA 1ROUA 5HW6A 4JFMA 2JZVA 3UQBA 5GPRA 1Q1CA 1SYTA 3ARXA 3UI5A 4LAXA 1W1VA 5HTGA 1FAPA 3TCZA 1ZBKA 1FKBA 1D7JA 2ESCA 1TFVA 2OLHA 5B8IC 1FFRA 2PPNA 3OOBA 2WK2A 3CZ8A 1LL7A 4MPKA 1T11A 1FKFA 4TX0A 4G2PA 3ARZA 1ROTA 2LJ4A 2DT3A 4JFKA 3NRKA 4IQCA 2DG9A 2KGJA 4P8VA 3FAPA 3NI6A 3LUOA 4DRHA 5HKGA 2M08A 1E6NA 5HUAA 1W1TA 5DIUA 3WQVA 4BF8A 4DRQA 1FKTA 4KR0B 4R5EA 1QPLA 1OWQA 1GOIA 2MF9A 3ARVA 3RM8A 2F4EA 2AOSA 1JVWA 1YW5A 4C02B 4AY1A 1HJWA 1FKRA 2PPOA 1HJVA 2MNTA 3JYJA 2XP7A 3JYMA 4MSPA 5HBFA 2RUCA 4TNSA 4JFJA 1J6YA 4WJXA 1GPFA 1WAWA 3I6CA 3CHEA 5DEZA 1TCOC 2WLYA 1ZB5A 3CH9A 4Q7NA 4W5UA 1A7XA 4FN2A 4J4OA 3O5MA 2WLZA 2MLZA 1HKIA 2PV3A 1ZBVA 3KACA 4NZCA 1JNTA 1OGBA 1HXVA 2FKEA 3IKGA 1ZK6A 4WKHA 1YATA 4LAYA 3WD1A 1BL4A 1Q6UA 4LGXA 1E15A 4MNKA 2DG3A 2ZQTA 2A3BA 3IK8A 3WKZA 2LGOA 1GUVA 2WM0A 1EQ3A 3O5GA 2DSWA 5BXJA 4HARA 5HW7A 4ODLA 1D2KA 3WL0A 3O5QA 5GPGA 1W26A 3RGCA 3PRDA 2XPAA 1B6CA 4U84A 4WKAA 1LG2A 3GPKA 1JNEA 4P8UA 3WD4A 1EIBA 4ODPA 3B8SA 3CGMA 2KE0A 4KQZA 2F21A 1FKLA 1H0GA 4TW6A 2YBTA 2K8IA 4DRPA 4IT6A 4ITZA 2F2DA 3UF8A 4L3NA 1D6OA 1RD6A 3ARQA 3WD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG9 A;  2KGJ A;  2ZQU A;  3FAP A;  4R0X A;  3NI6 A;  3LUO A;  2XP5 A;  4DRH A;  5HKG A;  2M08 A;  2M1I A;  2PV2 A;  2UZ5 A;  4DZ2 A;  2RUQ A;  3O5O A;  3VAW A;  2RUD A;  4DIP A;  2RSE A;  2XP4 A;  5DIU A;  3UI6 A;  3O5P A;  5HUA A;  2ZQS A;  4BF8 A;  4DRQ A;  1FKT A;  1BKF A;  3TDB A;  2RQS A;  4W9O A;  1QPL A;  1NMW A;  1Q6I A;  3NTP A;  5DIV A;  2MF9 A;  2MPH A;  3WH0 A;  1FKS A;  2PBC A;  1FKD A;  2F4E A;  4J4N A;  1N1A A;  1JVW A;  1YW5 A;  1D7H A;  4GGQ A;  3H9R B;  4C02 B;  3IKD A;  2MLY A;  3O5R A;  1U79 A;  4QT3 A;  4DRN A;  5HW8 A;  1JNS A;  4O2T A;  4U86 A;  1FKR A;  2XP9 A;  4DRO A;  3UQB A;  2PPO A;  3KAG A;  2MNT A;  1NSG A;  2ZR6 A;  3JYJ A;  2XP7 A;  1EYM A;  3KZ7 A;  3JYM A;  4IQ2 A;  4MSP A;  1C9H A;  2RUC A;  2L2S A;  4TNS A;  4DRJ A;  4JFJ A;  5HT1 A;  3O5I A;  3O5F A;  1J6Y A;  4TW7 A;  2VN1 A;  1J4R A;  2XPB A;  3I6C A;  3O5K A;  1FJD A;  3ODK A;  1TCO C;  2OFN A;  3PRB A;  4TW8 A;  4DT4 A;  4DRI A;  2Y78 A;  1ZCN A;  1D7I A;  5HWB A;  4TYO A;  2LPV A;  2KI3 A;  2AWG A;  3O5D A;  1KT0 A;  1QZ2 A;  3O5J A;  4IPX A;  2N87 A;  1A7X A;  2Q5A A;  4FN2 A;  2KR7 A;  2PV1 A;  4J4O A;  3O5M A;  1J4I A;  2MLZ A;  2ZR4 A;  2PV3 A;  2M2A A;  4N19 A;  3KAD A;  2PPP A;  1FKJ A;  2FAP A;  3UQA A;  3KAC A;  3IHZ A;  1L1P A;  4LAV A;  4NNR A;  1JNT A;  2ITK A;  3PA7 A;  1FKI A;  4QT2 A;  4JFL A;  2FKE A;  2VCD A;  2RUR A;  2ZQV A;  3IKG A;  5HWC A;  1HXV A;  1R9H A;  2ZR5 A;  4ODN A;  1ZK6 A;  1PIN A;  3KAF A;  1YAT A;  4LAY A;  3UI4 A;  4JYS A;  1M5Y A;  3KAH A;  2KO7 A;  4ODM A;  1BL4 A;  1Q6U A;  2DG4 A;  3KAB A;  2DG3 A;  2ZQT A;  5D75 A;  1F40 A;  3O5L A;  5I98 A;  3CGN A;  2XP8 A;  3KCE A;  4MGV A;  4JFI A;  3JXV A;  1F8A B;  3IK8 A;  2LGO A;  4G50 A;  4ODQ A;  1EQ3 A;  3O5G A;  1FKH A;  4ODO A;  3B7X A;  5BXJ A;  4DZ3 A;  3UQI A;  4DRM A;  3RFW A;  1ROU A;  3EY6 A;  2XP6 A;  5HW6 A;  4JFM A;  2D9F A;  2JZV A;  4LAW A;  1NMV A;  5J6E A;  4ODK A;  1Q1C A;  1QPF A;  4ODL A;  5HW7 A;  2MLX A;  3MDY B;  4FAP A;  1P5Q A;  4U85 A;  1J4H A;  4DH0 A;  3UI5 A;  4LAX A;  5HTG A;  1FAP A;  1KT1 A;  3O5Q A;  5GPG A;  3TCZ A;  1W26 A;  3RGC A;  3PRD A;  2XPA A;  1B6C A;  1FKB A;  4U84 A;  1D7J A;  3GPK A;  3KAI A;  5DIT A;  5B8I C;  2LKN A;  4DRK A;  4ODP A;  3CGM A;  1FKK A;  2KE0 A;  4QIB A;  2F21 A;  4ODR A;  2IF4 A;  1FKL A;  1Q6H A;  4GIV A;  1Y0O A;  2PPN A;  1FD9 A;  2KFW A;  4TW6 A;  3OOB A;  1T11 A;  2K8I A;  1PBK A;  3TC5 A;  4DRP A;  3O5E A;  1FKF A;  4TX0 A;  2XP3 A;  4W9P A;  4ITZ A;  2F2D A;  4W9Q A;  4G2P A;  3UF8 A;  1D6O A;  1ROT A;  2LJ4 A;  4JFK A;  3NRK A;  1FKG A;  4IQC A; 
#chains in the Genus database with same CATH topology
 4P8W A;  2ZQU A;  4IT4 A;  4L72 B;  2IUZ A;  2UZ5 A;  3O5O A;  3B9A A;  2XP4 A;  3AS0 A;  3UI6 A;  1W1Y A;  2ZQS A;  4DWS C;  4ZPT R;  4UDM A;  1NMW A;  2DT1 A;  1ZBW A;  4MAV A;  1FKS A;  1W9U A;  4Z2J A;  1K9T A;  4GGQ A;  3IKD A;  4QT3 A;  4Z2K A;  3B9E A;  2A3A A;  1IX5 A;  1HJX A;  4URI A;  2XP9 A;  1X6N A;  3BXW A;  3KZ7 A;  4IQ2 A;  2QF8 A;  3O5I A;  3O5F A;  4TW7 A;  1J4R A;  2XPB A;  3O5K A;  4TW8 A;  4TYO A;  4IPX A;  2Q5A A;  4Z2G A;  2KR7 A;  2EUL A;  3GTY X;  5JH8 A;  1FKJ A;  1W9V A;  4DWS D;  3UQA A;  4LAV A;  4QT2 A;  3B9D A;  2A3C A;  3KAF A;  4JYS A;  2KO7 A;  1NWT A;  3KAB A;  3ALF A;  5D75 A;  3ART A;  3G6M A;  3G6L A;  1E6R A;  4MNL A;  2O92 A;  4ODQ A;  1FKH A;  1JND A;  4ODO A;  4P8X A;  3UQI A;  4DRM A;  4LAW A;  4ODK A;  1QPF A;  2MLX A;  1W9P A;  4FAP A;  2FDM A;  4U85 A;  3OA5 A;  4WIW A;  2DSV A;  4HBO A;  3WD0 A;  4Z2L A;  4XAK A;  1LG1 A;  4DWS B;  4QIB A;  4ODR A;  2IF4 A;  4QZV B;  2F23 A;  1FD9 A;  3ALG A;  3TC5 A;  3O5E A;  4W9P A;  1FFQ A;  5DF0 A;  3EIP A;  4WK9 A;  5HWB A;  3AS2 A;  2PN0 A;  2M1I A;  1NWS A;  2RSE A;  4DWS A;  2A3E A;  4NSB A;  2DSU A;  2RQS A;  4W9O A;  1E6Z A;  1ZBC A;  1Q6I A;  4MNJ A;  1OGG A;  2PBC A;  1FKD A;  1ZU8 A;  2B31 A;  1E9L A;  1D7H A;  4DRN A;  3O5R A;  2MLY A;  5HW8 A;  5GQB A;  3CHD A;  4U86 A;  4DRO A;  3ARW A;  1E44 A;  2ZR6 A;  1W1P A;  1WNO A;  1C9H A;  2L2S A;  1H0I A;  1HKJ A;  1FJD A;  3ODK A;  3PRB A;  4DRI A;  1ZCN A;  1EDQ A;  2KI3 A;  2AWG A;  2LPV A;  1UR9 A;  1QZ2 A;  4S3K A;  3O5J A;  3RM9 A;  2PV1 A;  1J4I A;  2M2A A;  4N19 A;  1KFW A;  3IHZ A;  4ZS6 A;  2G41 A;  2ITK A;  5HWC A;  4JFL A;  2VCD A;  2RUR A;  2ZQV A;  3AS1 A;  4ODN A;  3W4R A;  1HKM A;  1NH6 A;  1M5Y A;  3KAH A;  3AQU A;  4ODM A;  2DG4 A;  3O5L A;  1WB0 A;  3CGN A;  1X6L A;  3KCE A;  2DT2 A;  1F8A B;  3WL1 A;  1XRV A;  2YBU A;  3QOK A;  1LL4 A;  1SR0 A;  3B7X A;  3RFW A;  3EY6 A;  2XP6 A;  5J6E A;  2D9F A;  1NMV A;  4ZPW R;  3MDY B;  1P5Q A;  1EHN A;  4DH0 A;  1J4H A;  3RME A;  1E6P A;  1KT1 A;  2PI6 A;  4WKF A;  1LJY A;  1UR8 A;  1HKK A;  3KAI A;  5DIT A;  2LKN A;  4DRK A;  1FKK A;  4GIV A;  1Q6H A;  2DT0 A;  1Y0O A;  2KFW A;  4HBE A;  3RM4 A;  1PBK A;  1ZL1 A;  2XP3 A;  4PTM A;  1NWU A;  4W9Q A;  1FKG A;  4R0X A;  2XP5 A;  2PV2 A;  2ETN A;  4DZ2 A;  3ARS A;  2RUQ A;  3PRA A;  3VAW A;  2RUD A;  4DIP A;  1LQ0 A;  3O5P A;  4ZPV R;  1BKF A;  3TDB A;  1VF8 A;  3NTP A;  5DIV A;  2MPH A;  3WH0 A;  4J4N A;  1N1A A;  3FY1 A;  1ITX A;  2DSZ A;  3WD2 A;  4MTV A;  5DO2 A;  3H9R B;  1U79 A;  1JNS A;  4O2T A;  3ARU A;  4Z2H A;  4S3J A;  3ARY A;  3KAG A;  1NSG A;  1NWR A;  1XHG A;  1EYM A;  3PR9 A;  4DRJ A;  5HT1 A;  1JCH B;  2VN1 A;  3AS3 A;  2O9O A;  2OFN A;  4MNM A;  1CTN A;  4DT4 A;  2Y78 A;  1D7I A;  1O6I A;  2P4V A;  3O5D A;  1KT0 A;  2N87 A;  2ZR4 A;  3KAD A;  2PPP A;  2FAP A;  3WQW A;  1L1P A;  4NNR A;  3PA7 A;  1FKI A;  4Z2I A;  1LL6 A;  3FXY A;  1R9H A;  2ZR5 A;  3ARR A;  1PIN A;  3UI4 A;  4ML4 A;  3CHC A;  2DPE A;  1F40 A;  5I98 A;  2XP8 A;  4MGV A;  3ARP A;  4JFI A;  3JXV A;  4G50 A;  1GRJ A;  3ARO A;  4DZ3 A;  3WIJ A;  4Q22 A;  2G8Z A;  3CHF A;  1ROU A;  5HW6 A;  4JFM A;  2JZV A;  3UQB A;  5GPR A;  1Q1C A;  1SYT A;  3ARX A;  3UI5 A;  4LAX A;  1W1V A;  5HTG A;  1FAP A;  3TCZ A;  1ZBK A;  1FKB A;  1D7J A;  2ESC A;  1TFV A;  2OLH A;  5B8I C;  1FFR A;  2PPN A;  3OOB A;  2WK2 A;  3CZ8 A;  1LL7 A;  4MPK A;  1T11 A;  1FKF A;  4TX0 A;  4G2P A;  3ARZ A;  1ROT A;  2LJ4 A;  2DT3 A;  2B5U B;  4JFK A;  3NRK A;  4IQC A;  2DG9 A;  2KGJ A;  4P8V A;  3FAP A;  3NI6 A;  3LUO A;  4DRH A;  5HKG A;  2M08 A;  1E6N A;  5HUA A;  1W1T A;  5DIU A;  3WQV A;  4BF8 A;  4DRQ A;  1FKT A;  4KR0 B;  4R5E A;  1QPL A;  1OWQ A;  1GOI A;  2MF9 A;  3ARV A;  3RM8 A;  2F4E A;  2AOS A;  1JVW A;  1YW5 A;  4C02 B;  4AY1 A;  1HJW A;  1FKR A;  2PPO A;  1HJV A;  2MNT A;  3JYJ A;  2XP7 A;  3JYM A;  4MSP A;  5HBF A;  2RUC A;  4TNS A;  4JFJ A;  1J6Y A;  4WJX A;  1GPF A;  1WAW A;  3I6C A;  3CHE A;  5DEZ A;  1TCO C;  2WLY A;  1ZB5 A;  3CH9 A;  4Q7N A;  4W5U A;  1A7X A;  4FN2 A;  4J4O A;  3O5M A;  2WLZ A;  2MLZ A;  1HKI A;  2PV3 A;  1ZBV A;  3KAC A;  4NZC A;  1JNT A;  1OGB A;  1HXV A;  2FKE A;  3IKG A;  1ZK6 A;  4WKH A;  1YAT A;  4LAY A;  3WD1 A;  1BL4 A;  1Q6U A;  4LGX A;  1E15 A;  4MNK A;  2DG3 A;  2ZQT A;  2A3B A;  3IK8 A;  3WKZ A;  2LGO A;  1GUV A;  2WM0 A;  1EQ3 A;  3O5G A;  2DSW A;  5BXJ A;  4HAR A;  5HW7 A;  4ODL A;  1D2K A;  3WL0 A;  3O5Q A;  5GPG A;  1W26 A;  3RGC A;  3BMB A;  3PRD A;  2XPA A;  1B6C A;  4U84 A;  4WKA A;  1LG2 A;  3GPK A;  1JNE A;  4P8U A;  3WD4 A;  1EIB A;  4ODP A;  3B8S A;  3CGM A;  2KE0 A;  4KQZ A;  2F21 A;  1FKL A;  3GU0 A;  1H0G A;  4TW6 A;  2YBT A;  2K8I A;  4DRP A;  4IT6 A;  4ITZ A;  2F2D A;  3UF8 A;  4L3N A;  1D6O A;  1RD6 A;  3ARQ A;  3WD3 A; 
#chains in the Genus database with same CATH homology
 4P8W A;  2ZQU A;  4IT4 A;  4L72 B;  2IUZ A;  2UZ5 A;  3O5O A;  3B9A A;  2XP4 A;  3AS0 A;  3UI6 A;  1W1Y A;  2ZQS A;  4DWS C;  4ZPT R;  1NMW A;  2DT1 A;  1ZBW A;  4MAV A;  1FKS A;  1W9U A;  4Z2J A;  1K9T A;  4GGQ A;  3IKD A;  4QT3 A;  4Z2K A;  3B9E A;  2A3A A;  1IX5 A;  1HJX A;  4URI A;  2XP9 A;  1X6N A;  3BXW A;  3KZ7 A;  4IQ2 A;  2QF8 A;  3O5I A;  3O5F A;  4TW7 A;  1J4R A;  2XPB A;  3O5K A;  4TW8 A;  4TYO A;  4IPX A;  2Q5A A;  4Z2G A;  2KR7 A;  5JH8 A;  1FKJ A;  1W9V A;  4DWS D;  3UQA A;  4LAV A;  4QT2 A;  3B9D A;  2A3C A;  3KAF A;  4JYS A;  2KO7 A;  1NWT A;  3KAB A;  3ALF A;  5D75 A;  3ART A;  3G6M A;  3G6L A;  1E6R A;  4MNL A;  2O92 A;  4ODQ A;  1FKH A;  1JND A;  4ODO A;  4P8X A;  3UQI A;  4DRM A;  4LAW A;  4ODK A;  1QPF A;  2MLX A;  1W9P A;  4FAP A;  2FDM A;  4U85 A;  3OA5 A;  4WIW A;  2DSV A;  4HBO A;  3WD0 A;  4Z2L A;  4XAK A;  1LG1 A;  4DWS B;  4QIB A;  4ODR A;  2IF4 A;  4QZV B;  1FD9 A;  3ALG A;  3TC5 A;  3O5E A;  4W9P A;  1FFQ A;  5DF0 A;  4WK9 A;  5HWB A;  3AS2 A;  2M1I A;  1NWS A;  2RSE A;  4DWS A;  2A3E A;  4NSB A;  2DSU A;  2RQS A;  4W9O A;  1E6Z A;  1ZBC A;  1Q6I A;  4MNJ A;  1OGG A;  2PBC A;  1FKD A;  1ZU8 A;  2B31 A;  1E9L A;  1D7H A;  4DRN A;  3O5R A;  2MLY A;  5HW8 A;  5GQB A;  3CHD A;  4U86 A;  4DRO A;  3ARW A;  2ZR6 A;  1W1P A;  1WNO A;  1C9H A;  2L2S A;  1H0I A;  1HKJ A;  1FJD A;  3ODK A;  3PRB A;  4DRI A;  1ZCN A;  1EDQ A;  2KI3 A;  2AWG A;  2LPV A;  1UR9 A;  1QZ2 A;  4S3K A;  3O5J A;  3RM9 A;  2PV1 A;  1J4I A;  2M2A A;  4N19 A;  1KFW A;  3IHZ A;  4ZS6 A;  2G41 A;  2ITK A;  5HWC A;  4JFL A;  2VCD A;  2RUR A;  2ZQV A;  3AS1 A;  4ODN A;  3W4R A;  1HKM A;  1NH6 A;  1M5Y A;  3KAH A;  3AQU A;  4ODM A;  2DG4 A;  3O5L A;  1WB0 A;  3CGN A;  1X6L A;  3KCE A;  2DT2 A;  1F8A B;  3WL1 A;  1XRV A;  2YBU A;  3QOK A;  1LL4 A;  1SR0 A;  3B7X A;  3RFW A;  3EY6 A;  2XP6 A;  5J6E A;  2D9F A;  1NMV A;  4ZPW R;  3MDY B;  1P5Q A;  1EHN A;  4DH0 A;  1J4H A;  3RME A;  1E6P A;  1KT1 A;  2PI6 A;  4WKF A;  1LJY A;  1UR8 A;  1HKK A;  3KAI A;  5DIT A;  2LKN A;  4DRK A;  1FKK A;  4GIV A;  1Q6H A;  2DT0 A;  1Y0O A;  2KFW A;  4HBE A;  3RM4 A;  1PBK A;  1ZL1 A;  2XP3 A;  4PTM A;  1NWU A;  4W9Q A;  1FKG A;  4R0X A;  2XP5 A;  2PV2 A;  4DZ2 A;  3ARS A;  2RUQ A;  3PRA A;  3VAW A;  2RUD A;  4DIP A;  1LQ0 A;  3O5P A;  4ZPV R;  1BKF A;  3TDB A;  1VF8 A;  3NTP A;  5DIV A;  2MPH A;  3WH0 A;  4J4N A;  1N1A A;  3FY1 A;  1ITX A;  2DSZ A;  3WD2 A;  4MTV A;  5DO2 A;  3H9R B;  1U79 A;  1JNS A;  4O2T A;  3ARU A;  4Z2H A;  4S3J A;  3ARY A;  3KAG A;  1NSG A;  1NWR A;  1XHG A;  1EYM A;  3PR9 A;  4DRJ A;  5HT1 A;  2VN1 A;  3AS3 A;  2O9O A;  2OFN A;  4MNM A;  1CTN A;  4DT4 A;  2Y78 A;  1D7I A;  1O6I A;  3O5D A;  1KT0 A;  2N87 A;  2ZR4 A;  3KAD A;  2PPP A;  2FAP A;  3WQW A;  1L1P A;  4NNR A;  3PA7 A;  1FKI A;  4Z2I A;  1LL6 A;  3FXY A;  1R9H A;  2ZR5 A;  3ARR A;  1PIN A;  3UI4 A;  4ML4 A;  3CHC A;  2DPE A;  1F40 A;  5I98 A;  2XP8 A;  4MGV A;  3ARP A;  4JFI A;  3JXV A;  4G50 A;  3ARO A;  4DZ3 A;  3WIJ A;  4Q22 A;  2G8Z A;  3CHF A;  1ROU A;  5HW6 A;  4JFM A;  2JZV A;  3UQB A;  5GPR A;  1Q1C A;  1SYT A;  3ARX A;  3UI5 A;  4LAX A;  1W1V A;  5HTG A;  1FAP A;  3TCZ A;  1ZBK A;  1FKB A;  1D7J A;  2ESC A;  1TFV A;  2OLH A;  5B8I C;  1FFR A;  2PPN A;  3OOB A;  2WK2 A;  3CZ8 A;  1LL7 A;  4MPK A;  1T11 A;  1FKF A;  4TX0 A;  4G2P A;  3ARZ A;  1ROT A;  2LJ4 A;  2DT3 A;  4JFK A;  3NRK A;  4IQC A;  2DG9 A;  2KGJ A;  4P8V A;  3FAP A;  3NI6 A;  3LUO A;  4DRH A;  5HKG A;  2M08 A;  1E6N A;  5HUA A;  1W1T A;  5DIU A;  3WQV A;  4BF8 A;  4DRQ A;  1FKT A;  4KR0 B;  4R5E A;  1QPL A;  1OWQ A;  1GOI A;  2MF9 A;  3ARV A;  3RM8 A;  2F4E A;  2AOS A;  1JVW A;  1YW5 A;  4C02 B;  4AY1 A;  1HJW A;  1FKR A;  2PPO A;  1HJV A;  2MNT A;  3JYJ A;  2XP7 A;  3JYM A;  4MSP A;  5HBF A;  2RUC A;  4TNS A;  4JFJ A;  1J6Y A;  4WJX A;  1GPF A;  1WAW A;  3I6C A;  3CHE A;  5DEZ A;  1TCO C;  2WLY A;  1ZB5 A;  3CH9 A;  4Q7N A;  4W5U A;  1A7X A;  4FN2 A;  4J4O A;  3O5M A;  2WLZ A;  2MLZ A;  1HKI A;  2PV3 A;  1ZBV A;  3KAC A;  4NZC A;  1JNT A;  1OGB A;  1HXV A;  2FKE A;  3IKG A;  1ZK6 A;  4WKH A;  1YAT A;  4LAY A;  3WD1 A;  1BL4 A;  1Q6U A;  4LGX A;  1E15 A;  4MNK A;  2DG3 A;  2ZQT A;  2A3B A;  3IK8 A;  3WKZ A;  2LGO A;  1GUV A;  2WM0 A;  1EQ3 A;  3O5G A;  2DSW A;  5BXJ A;  4HAR A;  5HW7 A;  4ODL A;  1D2K A;  3WL0 A;  3O5Q A;  5GPG A;  1W26 A;  3RGC A;  3PRD A;  2XPA A;  1B6C A;  4U84 A;  4WKA A;  1LG2 A;  3GPK A;  1JNE A;  4P8U A;  3WD4 A;  1EIB A;  4ODP A;  3B8S A;  3CGM A;  2KE0 A;  4KQZ A;  2F21 A;  1FKL A;  1H0G A;  4TW6 A;  2YBT A;  2K8I A;  4DRP A;  4IT6 A;  4ITZ A;  2F2D A;  3UF8 A;  4L3N A;  1D6O A;  1RD6 A;  3ARQ A;  3WD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...