3IKDA

Structure-based design of novel pin1 inhibitors (i)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
113
structure length
113
Chain Sequence
b'EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ikdA00
2LPVA 1FKHA 2L2SA 4TW8A 1PBKA 4GGQA 4DRHA 1KT0A 2F21A 2KGJA 1FKRA 2F4EA 4LAVA 2UZ5A 1FAPA 2LKNA 2MF9A 4DH0A 1QPLA 4JFMA 2XP9A 2KI3A 5DITA 1YATA 1L1PA 1D7IA 1R9HA 2XP6A 3ODKA 3IK8A 2KE0A 1U79A 4ITZA 4DRNA 4DT4A 1EYMA 3IHZA 1FKSA 1JVWA 4ODPA 1W26A 4JYSA 5B8IC 2KO7A 3CGNA 3KACA 2KFWA 3O5PA 4BF8A 1FKFA 4DRMA 1B6CA 2F2DA 5HW6A 5HWBA 2KR7A 2OFNA 1J4RA 3B7XA 4TYOA 4W9QA 1FKLA 3UI4A 4W9OA 2DG3A 5DIUA 2RURA 2ZR5A 1D7JA 3JYJA 1JNSA 1M5YA 3PRBA 3UI5A 4ODNA 3WH0A 2IF4A 1BKFA 3JYMA 5HW8A 2AWGA 3O5FA 3TDBA 2XPAA 3O5KA 1ZCNA 3UQAA 3O5JA 2VCDA 2K8IA 2LJ4A 4DIPA 3PA7A 3KCEA 4TW7A 4ODKA 1F8AB 4J4OA 2XPBA 3O5GA 4JFLA 1FKTA 4G50A 4IQCA 4LAWA 4N19A 5GPGA 3UF8A 3UI6A 4DZ2A 5I98A 2M08A 3KAFA 1NMWA 2D9FA 2FAPA 1Q6IA 4DRJA 1QZ2A 1Q6UA 2DG4A 1ZK6A 2ZQVA 4MGVA 3NRKA 2XP8A 4DRIA 4NNRA 2ZR6A 2XP7A 3EY6A 3NTPA 3OOBA 1JNTA 1QPFA 2PV2A 4ODRA 4C02B 4DRPA 5HT1A 1EQ3A 1Q6HA 2MLYA 3O5LA 1ROTA 4GIVA 3JXVA 3O5RA 1NMVA 3RGCA 1FKKA 1TCOC 4TW6A 4LAXA 2Y78A 3KZ7A 4JFIA 3LUOA 3RFWA 3IKGA 1A7XA 4DZ3A 3UQBA 3TC5A 4TX0A 2JZVA 4JFJA 4IQ2A 4FN2A 2MLZA 1BL4A 2RUDA 3O5DA 1D7HA 2PPOA 3NI6A 4JFKA 5HWCA 4TNSA 2PPNA 2XP5A 2MLXA 4FAPA 4DROA 1PINA 2M2AA 2XP4A 3I6CA 4LAYA 1FKIA 5D75A 4ODOA 2XP3A 1N1AA 3UQIA 1J4HA 1FD9A 3GPKA 4R0XA 4U84A 2ITKA 1T11A 2LGOA 3H9RB 4ODMA 2PV1A 3VAWA 1NSGA 1ROUA 2ZR4A 5BXJA 1FKBA 2Q5AA 1Q1CA 2PBCA 3KAGA 4ODQA 4DRQA 2DG9A 2N87A 2PV3A 4MSPA 2VN1A 5HKGA 4U86A 1HXVA 3KAIA 2RUCA 2RSEA 1FKDA 1FKGA 2ZQTA 3KABA 3PRDA 2MNTA 1P5QA 2PPPA 3O5MA 4QT2A 5HTGA 5J6EA 1F40A 4ODLA 4DRKA 3MDYB 3TCZA 2FKEA 3O5OA 4J4NA 1KT1A 3O5QA 5DIVA 5HW7A 2M1IA 4QT3A 3FAPA 3IKDA 2RQSA 3CGMA 3O5IA 4QIBA 4W9PA 3KAHA 1FKJA 4O2TA 4G2PA 5HUAA 1J6YA 1YW5A 1FJDA 2MPHA 4U85A 4IPXA 1J4IA 1C9HA 2RUQA 1Y0OA 3KADA 2ZQSA 1D6OA 3O5EA 2ZQUA
chains in the Genus database with same CATH superfamily
2L2SA 2F4EA 2MF9A 1W9PA 1YATA 2PN0A 2B31A 3AROA 4DRNA 4DT4A 4MAVA 1W26A 2WLZA 5B8IC 2KO7A 4BF8A 3O5PA 3AS2A 1X6LA 5HW6A 2KR7A 1E9LA 3B7XA 3CHFA 4W9OA 2DG3A 2ZR5A 1D7JA 1EIBA 4ZPVR 3TDBA 1ZCNA 1E44A 3O5JA 2K8IA 2WK2A 3WKZA 4ODKA 4JFLA 4ZS6A 4G50A 5I98A 4P8UA 3UI6A 3ARWA 1LG1A 3EIPA 2D9FA 4DRJA 4WJXA 2DG4A 1Q6UA 2ZQVA 1NWRA 1SYTA 1EDQA 2ZR6A 3NTPA 3OOBA 1WAWA 4C02B 4QZVB 2FDMA 1FKKA 4LAXA 3RFWA 1EHNA 1OGGA 4DZ3A 1LL6A 3ARRA 1RD6A 4TX0A 2JZVA 4UDMA 1E6RA 3O5DA 3CZ8A 2XP5A 4FAPA 1W9UA 1FKIA 1N1AA 4R0XA 1O6IA 2PV1A 2DT2A 2ZR4A 1JNEA 3KAGA 2Q5AA 4ODQA 3GTYX 2DSUA 2DT0A 3ARQA 2N87A 4MSPA 5HKGA 1W1YA 4L3NA 3KAIA 1LL4A 3GU0A 1HJWA 3KABA 4R5EA 3WL1A 1P5QA 2FKEA 5HW7A 1E15A 3RM9A 2RQSA 5GPRA 1J6YA 4G2PA 1YW5A 1HJVA 2MPHA 1C9HA 3IKGA 1GPFA 3WD0A 2OLHA 1FKHA 2KGJA 1W1VA 2LKNA 1QPLA 4JFMA 2XP9A 4HARA 3RMEA 1D7IA 2XP6A 3IK8A 1U79A 3PR9A 1EYMA 3IHZA 1JVWA 4ODPA 4DRMA 2P4VA 2OFNA 1J4RA 4MNLA 4W9QA 3UI4A 4ZPTR 4Z2GA 2RURA 4ZPWR 2DSZA 2A3AA 3ARXA 3PRBA 1ZBCA 2IF4A 1BKFA 1FFQA 3O5FA 3G6MA 1ZL1A 1WB0A 2XPAA 3O5KA 3WL0A 2VCDA 5DO2A 2G8ZA 3B9DA 3PA7A 1LQ0A 5DF0A 2B5UB 4J4OA 1OWQA 3O5GA 3UF8A 1H0GA 2DPEA 4DZ2A 5GPGA 4WKAA 1QZ2A 4P8XA 1ZK6A 2YBUA 4Z2JA 1ITXA 4DRIA 1SR0A 1JNTA 1QPFA 4ODRA 3O5LA 1ROTA 4GIVA 3JXVA 4TW6A 1L1PA 2Y78A 4JFIA 3LUOA 1A7XA 2DSVA 1E6PA 1JCHB 3TC5A 4MPKA 4FN2A 3NI6A 4JFKA 5HWCA 2MLXA 1PINA 3I6CA 1FD9A 3ARSA 3GPKA 1T11A 4PTMA 4DWSD 5BXJA 4S3KA 2PBCA 1HKJA 4MTVA 3ARTA 1HXVA 2RUCA 1FKDA 2ZQTA 3PRDA 4QT2A 1F40A 5J6EA 3AS1A 4DRKA 3MDYB 3TCZA 3O5OA 1KT1A 3WQVA 4QT3A 4AY1A 4P8WA 1XRVA 3O5IA 3CGMA 4W9PA 4Z2KA 4ML4A 1FKJA 3QOKA 4DWSC 4IPXA 2RUQA 3ODKA 3B9EA 4S3JA 1ZBWA 4TW8A 1PBKA 4GGQA 4DRHA 1FKRA 4LAVA 2UZ5A 1FAPA 4DH0A 4DWSB 3PRAA 4ITZA 4HBEA 3BXWA 1FKSA 3AS0A 4KR0B 4WKFA 4HBOA 2AOSA 3CGNA 2KFWA 1FKFA 1B6CA 1X6NA 2F2DA 4TYOA 1FKLA 5DIUA 1K9TA 3JYJA 3ARYA 1M5YA 3UI5A 4ODNA 5HW8A 3JYMA 2AWGA 3UQAA 2LJ4A 1W1TA 3KCEA 4TW7A 3RM8A 2XPBA 2M08A 3KAFA 3WIJA 4URIA 1LL7A 2WLYA 4MGVA 3W4RA 1D2KA 4NNRA 1OGBA 2XP7A 5DEZA 1LG2A 4WK9A 3CHEA 2PV2A 2YBTA 3CHDA 4WIWA 3RM4A 3ARZA 4DRPA 1EQ3A 4Q22A 2MLYA 4W5UA 3KZ7A 2ESCA 1FFRA 2A3CA 4JFJA 1ZU8A 4IQ2A 1NWUA 1BL4A 2RUDA 2DSWA 1HKKA 2WM0A 2O92A 4ODOA 1E6NA 1J4HA 3AS3A 4Z2IA 2ITKA 2LGOA 4KQZA 4ODMA 2DT1A 5GQBA 3WD1A 1GUVA 4Q7NA 1FKBA 2VN1A 3WD2A 1WNOA 1FKGA 3CH9A 2MNTA 3AQUA 5HTGA 1W9VA 4IT6A 3ARVA 4ODLA 1LJYA 1NH6A 4J4NA 3B8SA 3CHCA 3WD3A 2M1IA 4Z2LA 1ZBKA 3KAHA 1UR9A 4U85A 3WD4A 1J4IA 1Y0OA 3KADA 1D6OA 3O5EA 2ZQUA 2LPVA 1KT0A 2F21A 3ALGA 4WKHA 3ARUA 2KI3A 5DITA 1NWSA 1GOIA 1IX5A 4NZCA 1R9HA 1HKIA 2KE0A 1GRJA 2IUZA 1UR8A 4JYSA 2PI6A 5HWBA 2A3EA 4MNKA 4L72B 1JNSA 1NWTA 1CTNA 1H0IA 4DIPA 1HKMA 1F8AB 4LAWA 4NSBA 3BMBA 3WH0A 1FKTA 4IQCA 4N19A 3ARPA 3G6LA 1NMWA 2FAPA 1Q6IA 1HJXA 1XHGA 3NRKA 2XP8A 1JNDA 3EY6A 4MNJA 5HT1A 1Q6HA 3WQWA 3FY1A 4XAKA 3O5RA 1NMVA 3RGCA 1E6ZA 1TCOC 1VF8A 2G41A 2O9OA 2MLZA 1D7HA 2PPOA 3B9AA 4TNSA 2PPNA 1TFVA 4DROA 2XP4A 4LAYA 4LGXA 2XP3A 3UQIA 4U84A 5HBFA 3H9RB 3VAWA 1NSGA 1ROUA 4P8VA 4DRQA 1Q1CA 2QF8A 2ETNA 4IT4A 2DG9A 1W1PA 2PV3A 3OA5A 4U86A 2F23A 2RSEA 5HUAA 2PPPA 3O5MA 1ZB5A 5JH8A 5DIVA 3O5QA 4MNMA 4DWSA 3FAPA 1ZBVA 3IKDA 3ALFA 4QIBA 4O2TA 2A3BA 2DT3A 3FXYA 1FJDA 2EULA 1KFWA 4Z2HA 3KACA 2M2AA 5D75A 2ZQSA 3UQBA
chains in the Genus database with same CATH topology
2L2SA 2F4EA 2MF9A 1W9PA 1YATA 2B31A 3AROA 4DRNA 4DT4A 4MAVA 1W26A 2WLZA 5B8IC 2KO7A 4BF8A 3O5PA 3AS2A 1X6LA 5HW6A 2KR7A 1E9LA 3B7XA 3CHFA 4W9OA 2DG3A 2ZR5A 1D7JA 1EIBA 4ZPVR 3TDBA 1ZCNA 3O5JA 2K8IA 2WK2A 3WKZA 4ODKA 4JFLA 4ZS6A 4G50A 5I98A 4P8UA 3UI6A 3ARWA 1LG1A 2D9FA 4DRJA 4WJXA 2DG4A 1Q6UA 2ZQVA 1NWRA 1SYTA 1EDQA 2ZR6A 3NTPA 3OOBA 1WAWA 4C02B 4QZVB 2FDMA 1FKKA 4LAXA 3RFWA 1EHNA 1OGGA 4DZ3A 1LL6A 3ARRA 1RD6A 4TX0A 2JZVA 1E6RA 3O5DA 3CZ8A 2XP5A 4FAPA 1W9UA 1FKIA 1N1AA 4R0XA 1O6IA 2PV1A 2DT2A 2ZR4A 1JNEA 3KAGA 2Q5AA 4ODQA 2DSUA 2DT0A 3ARQA 2N87A 4MSPA 5HKGA 1W1YA 4L3NA 3KAIA 1LL4A 4R5EA 1HJWA 3KABA 3WL1A 1P5QA 2FKEA 5HW7A 1E15A 3RM9A 2RQSA 5GPRA 1J6YA 4G2PA 1YW5A 1HJVA 2MPHA 1C9HA 3IKGA 1GPFA 3WD0A 2OLHA 1FKHA 2KGJA 1W1VA 2LKNA 1QPLA 4JFMA 2XP9A 4HARA 3RMEA 1D7IA 2XP6A 3IK8A 1U79A 3PR9A 1EYMA 3IHZA 1JVWA 4ODPA 4DRMA 2OFNA 1J4RA 4MNLA 4W9QA 3UI4A 4ZPTR 4Z2GA 2RURA 4ZPWR 2DSZA 2A3AA 3ARXA 3PRBA 1ZBCA 2IF4A 1BKFA 1FFQA 3O5FA 3G6MA 1ZL1A 1WB0A 2XPAA 3O5KA 3WL0A 2VCDA 5DO2A 2G8ZA 3B9DA 3PA7A 1LQ0A 5DF0A 4J4OA 1OWQA 3O5GA 3UF8A 1H0GA 2DPEA 4DZ2A 5GPGA 4WKAA 1QZ2A 4P8XA 1ZK6A 2YBUA 4Z2JA 1ITXA 4DRIA 1SR0A 1JNTA 1QPFA 4ODRA 3O5LA 1ROTA 4GIVA 3JXVA 4TW6A 1L1PA 2Y78A 4JFIA 3LUOA 1A7XA 2DSVA 1E6PA 3TC5A 4MPKA 4FN2A 3NI6A 4JFKA 5HWCA 2MLXA 1PINA 3I6CA 1FD9A 3ARSA 3GPKA 1T11A 4PTMA 4DWSD 5BXJA 4S3KA 2PBCA 1HKJA 4MTVA 3ARTA 1HXVA 2RUCA 1FKDA 2ZQTA 3PRDA 4QT2A 1F40A 5J6EA 3AS1A 4DRKA 3MDYB 3TCZA 3O5OA 1KT1A 3WQVA 4QT3A 4AY1A 4P8WA 1XRVA 3O5IA 3CGMA 4W9PA 4Z2KA 4ML4A 1FKJA 3QOKA 4DWSC 4IPXA 2RUQA 3ODKA 3B9EA 4S3JA 1ZBWA 4TW8A 1PBKA 4GGQA 4DRHA 1FKRA 4LAVA 2UZ5A 1FAPA 4DH0A 4DWSB 3PRAA 4ITZA 4HBEA 3BXWA 1FKSA 3AS0A 4KR0B 4WKFA 4HBOA 2AOSA 3CGNA 2KFWA 1FKFA 1B6CA 1X6NA 2F2DA 4TYOA 1FKLA 5DIUA 1K9TA 3JYJA 3ARYA 1M5YA 3UI5A 4ODNA 5HW8A 3JYMA 2AWGA 3UQAA 2LJ4A 1W1TA 3KCEA 4TW7A 3RM8A 2XPBA 2M08A 3KAFA 3WIJA 4URIA 1LL7A 2WLYA 4MGVA 3W4RA 1D2KA 4NNRA 1OGBA 2XP7A 5DEZA 1LG2A 4WK9A 3CHEA 2PV2A 2YBTA 3CHDA 4WIWA 3RM4A 3ARZA 4DRPA 1EQ3A 4Q22A 2MLYA 4W5UA 3KZ7A 2ESCA 1FFRA 2A3CA 4JFJA 1ZU8A 4IQ2A 1NWUA 1BL4A 2RUDA 2DSWA 1HKKA 2WM0A 2O92A 4ODOA 1E6NA 1J4HA 3AS3A 4Z2IA 2ITKA 2LGOA 4KQZA 4ODMA 2DT1A 5GQBA 3WD1A 1GUVA 4Q7NA 1FKBA 2VN1A 3WD2A 1WNOA 1FKGA 3CH9A 2MNTA 3AQUA 5HTGA 1W9VA 4IT6A 3ARVA 4ODLA 1LJYA 1NH6A 4J4NA 3B8SA 3CHCA 3WD3A 2M1IA 4Z2LA 1ZBKA 3KAHA 1UR9A 4U85A 3WD4A 1J4IA 1Y0OA 3KADA 1D6OA 3O5EA 2ZQUA 2LPVA 1KT0A 2F21A 3ALGA 4WKHA 3ARUA 2KI3A 5DITA 1NWSA 1GOIA 1IX5A 4NZCA 1R9HA 1HKIA 2KE0A 2IUZA 1UR8A 4JYSA 2PI6A 5HWBA 2A3EA 4MNKA 4L72B 1JNSA 1NWTA 1CTNA 1H0IA 4DIPA 1HKMA 1F8AB 4LAWA 4NSBA 3WH0A 1FKTA 4IQCA 4N19A 3ARPA 3G6LA 1NMWA 2FAPA 1Q6IA 1HJXA 1XHGA 3NRKA 2XP8A 1JNDA 3EY6A 4MNJA 5HT1A 1Q6HA 3WQWA 3FY1A 4XAKA 3O5RA 1NMVA 3RGCA 1E6ZA 1TCOC 1VF8A 2G41A 2O9OA 2MLZA 1D7HA 2PPOA 3B9AA 4TNSA 2PPNA 1TFVA 4DROA 2XP4A 4LAYA 4LGXA 2XP3A 3UQIA 4U84A 5HBFA 3H9RB 3VAWA 1NSGA 1ROUA 4P8VA 4DRQA 1Q1CA 2QF8A 4IT4A 2DG9A 1W1PA 2PV3A 3OA5A 4U86A 2RSEA 5HUAA 2PPPA 3O5MA 1ZB5A 5JH8A 5DIVA 3O5QA 4MNMA 4DWSA 3FAPA 1ZBVA 3IKDA 3ALFA 4QIBA 4O2TA 2A3BA 2DT3A 3FXYA 1FJDA 1KFWA 4Z2HA 3KACA 2M2AA 5D75A 2ZQSA 3UQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPV A;  1FKH A;  2L2S A;  4TW8 A;  1PBK A;  4GGQ A;  4DRH A;  1KT0 A;  2F21 A;  2KGJ A;  1FKR A;  2F4E A;  4LAV A;  2UZ5 A;  1FAP A;  2LKN A;  2MF9 A;  4DH0 A;  1QPL A;  4JFM A;  2XP9 A;  2KI3 A;  5DIT A;  1YAT A;  1L1P A;  1D7I A;  1R9H A;  2XP6 A;  3ODK A;  3IK8 A;  2KE0 A;  1U79 A;  4ITZ A;  4DRN A;  4DT4 A;  1EYM A;  3IHZ A;  1FKS A;  1JVW A;  4ODP A;  1W26 A;  4JYS A;  5B8I C;  2KO7 A;  3CGN A;  3KAC A;  2KFW A;  3O5P A;  4BF8 A;  1FKF A;  4DRM A;  1B6C A;  2F2D A;  5HW6 A;  5HWB A;  2KR7 A;  2OFN A;  1J4R A;  3B7X A;  4TYO A;  4W9Q A;  1FKL A;  3UI4 A;  4W9O A;  2DG3 A;  5DIU A;  2RUR A;  2ZR5 A;  1D7J A;  3JYJ A;  1JNS A;  1M5Y A;  3PRB A;  3UI5 A;  4ODN A;  3WH0 A;  2IF4 A;  1BKF A;  3JYM A;  5HW8 A;  2AWG A;  3O5F A;  3TDB A;  2XPA A;  3O5K A;  1ZCN A;  3UQA A;  3O5J A;  2VCD A;  2K8I A;  2LJ4 A;  4DIP A;  3PA7 A;  3KCE A;  4TW7 A;  4ODK A;  1F8A B;  4J4O A;  2XPB A;  3O5G A;  4JFL A;  1FKT A;  4G50 A;  4IQC A;  4LAW A;  4N19 A;  5GPG A;  3UF8 A;  3UI6 A;  4DZ2 A;  5I98 A;  2M08 A;  3KAF A;  1NMW A;  2D9F A;  2FAP A;  1Q6I A;  4DRJ A;  1QZ2 A;  1Q6U A;  2DG4 A;  1ZK6 A;  2ZQV A;  4MGV A;  3NRK A;  2XP8 A;  4DRI A;  4NNR A;  2ZR6 A;  2XP7 A;  3EY6 A;  3NTP A;  3OOB A;  1JNT A;  1QPF A;  2PV2 A;  4ODR A;  4C02 B;  4DRP A;  5HT1 A;  1EQ3 A;  1Q6H A;  2MLY A;  3O5L A;  1ROT A;  4GIV A;  3JXV A;  3O5R A;  1NMV A;  3RGC A;  1FKK A;  1TCO C;  4TW6 A;  4LAX A;  2Y78 A;  3KZ7 A;  4JFI A;  3LUO A;  3RFW A;  3IKG A;  1A7X A;  4DZ3 A;  3UQB A;  3TC5 A;  4TX0 A;  2JZV A;  4JFJ A;  4IQ2 A;  4FN2 A;  2MLZ A;  1BL4 A;  2RUD A;  3O5D A;  1D7H A;  2PPO A;  3NI6 A;  4JFK A;  5HWC A;  4TNS A;  2PPN A;  2XP5 A;  2MLX A;  4FAP A;  4DRO A;  1PIN A;  2M2A A;  2XP4 A;  3I6C A;  4LAY A;  1FKI A;  5D75 A;  4ODO A;  2XP3 A;  1N1A A;  3UQI A;  1J4H A;  1FD9 A;  3GPK A;  4R0X A;  4U84 A;  2ITK A;  1T11 A;  2LGO A;  3H9R B;  4ODM A;  2PV1 A;  3VAW A;  1NSG A;  1ROU A;  2ZR4 A;  5BXJ A;  1FKB A;  2Q5A A;  1Q1C A;  2PBC A;  3KAG A;  4ODQ A;  4DRQ A;  2DG9 A;  2N87 A;  2PV3 A;  4MSP A;  2VN1 A;  5HKG A;  4U86 A;  1HXV A;  3KAI A;  2RUC A;  2RSE A;  1FKD A;  1FKG A;  2ZQT A;  3KAB A;  3PRD A;  2MNT A;  1P5Q A;  2PPP A;  3O5M A;  4QT2 A;  5HTG A;  5J6E A;  1F40 A;  4ODL A;  4DRK A;  3MDY B;  3TCZ A;  2FKE A;  3O5O A;  4J4N A;  1KT1 A;  3O5Q A;  5DIV A;  5HW7 A;  2M1I A;  4QT3 A;  3FAP A;  3IKD A;  2RQS A;  3CGM A;  3O5I A;  4QIB A;  4W9P A;  3KAH A;  1FKJ A;  4O2T A;  4G2P A;  5HUA A;  1J6Y A;  1YW5 A;  1FJD A;  2MPH A;  4U85 A;  4IPX A;  1J4I A;  1C9H A;  2RUQ A;  1Y0O A;  3KAD A;  2ZQS A;  1D6O A;  3O5E A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 2L2S A;  2F4E A;  2MF9 A;  1W9P A;  1YAT A;  2PN0 A;  2B31 A;  3ARO A;  4DRN A;  4DT4 A;  4MAV A;  1W26 A;  2WLZ A;  5B8I C;  2KO7 A;  4BF8 A;  3O5P A;  3AS2 A;  1X6L A;  5HW6 A;  2KR7 A;  1E9L A;  3B7X A;  3CHF A;  4W9O A;  2DG3 A;  2ZR5 A;  1D7J A;  1EIB A;  4ZPV R;  3TDB A;  1ZCN A;  1E44 A;  3O5J A;  2K8I A;  2WK2 A;  3WKZ A;  4ODK A;  4JFL A;  4ZS6 A;  4G50 A;  5I98 A;  4P8U A;  3UI6 A;  3ARW A;  1LG1 A;  3EIP A;  2D9F A;  4DRJ A;  4WJX A;  2DG4 A;  1Q6U A;  2ZQV A;  1NWR A;  1SYT A;  1EDQ A;  2ZR6 A;  3NTP A;  3OOB A;  1WAW A;  4C02 B;  4QZV B;  2FDM A;  1FKK A;  4LAX A;  3RFW A;  1EHN A;  1OGG A;  4DZ3 A;  1LL6 A;  3ARR A;  1RD6 A;  4TX0 A;  2JZV A;  4UDM A;  1E6R A;  3O5D A;  3CZ8 A;  2XP5 A;  4FAP A;  1W9U A;  1FKI A;  1N1A A;  4R0X A;  1O6I A;  2PV1 A;  2DT2 A;  2ZR4 A;  1JNE A;  3KAG A;  2Q5A A;  4ODQ A;  3GTY X;  2DSU A;  2DT0 A;  3ARQ A;  2N87 A;  4MSP A;  5HKG A;  1W1Y A;  4L3N A;  3KAI A;  1LL4 A;  3GU0 A;  1HJW A;  3KAB A;  4R5E A;  3WL1 A;  1P5Q A;  2FKE A;  5HW7 A;  1E15 A;  3RM9 A;  2RQS A;  5GPR A;  1J6Y A;  4G2P A;  1YW5 A;  1HJV A;  2MPH A;  1C9H A;  3IKG A;  1GPF A;  3WD0 A;  2OLH A;  1FKH A;  2KGJ A;  1W1V A;  2LKN A;  1QPL A;  4JFM A;  2XP9 A;  4HAR A;  3RME A;  1D7I A;  2XP6 A;  3IK8 A;  1U79 A;  3PR9 A;  1EYM A;  3IHZ A;  1JVW A;  4ODP A;  4DRM A;  2P4V A;  2OFN A;  1J4R A;  4MNL A;  4W9Q A;  3UI4 A;  4ZPT R;  4Z2G A;  2RUR A;  4ZPW R;  2DSZ A;  2A3A A;  3ARX A;  3PRB A;  1ZBC A;  2IF4 A;  1BKF A;  1FFQ A;  3O5F A;  3G6M A;  1ZL1 A;  1WB0 A;  2XPA A;  3O5K A;  3WL0 A;  2VCD A;  5DO2 A;  2G8Z A;  3B9D A;  3PA7 A;  1LQ0 A;  5DF0 A;  2B5U B;  4J4O A;  1OWQ A;  3O5G A;  3UF8 A;  1H0G A;  2DPE A;  4DZ2 A;  5GPG A;  4WKA A;  1QZ2 A;  4P8X A;  1ZK6 A;  2YBU A;  4Z2J A;  1ITX A;  4DRI A;  1SR0 A;  1JNT A;  1QPF A;  4ODR A;  3O5L A;  1ROT A;  4GIV A;  3JXV A;  4TW6 A;  1L1P A;  2Y78 A;  4JFI A;  3LUO A;  1A7X A;  2DSV A;  1E6P A;  1JCH B;  3TC5 A;  4MPK A;  4FN2 A;  3NI6 A;  4JFK A;  5HWC A;  2MLX A;  1PIN A;  3I6C A;  1FD9 A;  3ARS A;  3GPK A;  1T11 A;  4PTM A;  4DWS D;  5BXJ A;  4S3K A;  2PBC A;  1HKJ A;  4MTV A;  3ART A;  1HXV A;  2RUC A;  1FKD A;  2ZQT A;  3PRD A;  4QT2 A;  1F40 A;  5J6E A;  3AS1 A;  4DRK A;  3MDY B;  3TCZ A;  3O5O A;  1KT1 A;  3WQV A;  4QT3 A;  4AY1 A;  4P8W A;  1XRV A;  3O5I A;  3CGM A;  4W9P A;  4Z2K A;  4ML4 A;  1FKJ A;  3QOK A;  4DWS C;  4IPX A;  2RUQ A;  3ODK A;  3B9E A;  4S3J A;  1ZBW A;  4TW8 A;  1PBK A;  4GGQ A;  4DRH A;  1FKR A;  4LAV A;  2UZ5 A;  1FAP A;  4DH0 A;  4DWS B;  3PRA A;  4ITZ A;  4HBE A;  3BXW A;  1FKS A;  3AS0 A;  4KR0 B;  4WKF A;  4HBO A;  2AOS A;  3CGN A;  2KFW A;  1FKF A;  1B6C A;  1X6N A;  2F2D A;  4TYO A;  1FKL A;  5DIU A;  1K9T A;  3JYJ A;  3ARY A;  1M5Y A;  3UI5 A;  4ODN A;  5HW8 A;  3JYM A;  2AWG A;  3UQA A;  2LJ4 A;  1W1T A;  3KCE A;  4TW7 A;  3RM8 A;  2XPB A;  2M08 A;  3KAF A;  3WIJ A;  4URI A;  1LL7 A;  2WLY A;  4MGV A;  3W4R A;  1D2K A;  4NNR A;  1OGB A;  2XP7 A;  5DEZ A;  1LG2 A;  4WK9 A;  3CHE A;  2PV2 A;  2YBT A;  3CHD A;  4WIW A;  3RM4 A;  3ARZ A;  4DRP A;  1EQ3 A;  4Q22 A;  2MLY A;  4W5U A;  3KZ7 A;  2ESC A;  1FFR A;  2A3C A;  4JFJ A;  1ZU8 A;  4IQ2 A;  1NWU A;  1BL4 A;  2RUD A;  2DSW A;  1HKK A;  2WM0 A;  2O92 A;  4ODO A;  1E6N A;  1J4H A;  3AS3 A;  4Z2I A;  2ITK A;  2LGO A;  4KQZ A;  4ODM A;  2DT1 A;  5GQB A;  3WD1 A;  1GUV A;  4Q7N A;  1FKB A;  2VN1 A;  3WD2 A;  1WNO A;  1FKG A;  3CH9 A;  2MNT A;  3AQU A;  5HTG A;  1W9V A;  4IT6 A;  3ARV A;  4ODL A;  1LJY A;  1NH6 A;  4J4N A;  3B8S A;  3CHC A;  3WD3 A;  2M1I A;  4Z2L A;  1ZBK A;  3KAH A;  1UR9 A;  4U85 A;  3WD4 A;  1J4I A;  1Y0O A;  3KAD A;  1D6O A;  3O5E A;  2ZQU A;  2LPV A;  1KT0 A;  2F21 A;  3ALG A;  4WKH A;  3ARU A;  2KI3 A;  5DIT A;  1NWS A;  1GOI A;  1IX5 A;  4NZC A;  1R9H A;  1HKI A;  2KE0 A;  1GRJ A;  2IUZ A;  1UR8 A;  4JYS A;  2PI6 A;  5HWB A;  2A3E A;  4MNK A;  4L72 B;  1JNS A;  1NWT A;  1CTN A;  1H0I A;  4DIP A;  1HKM A;  1F8A B;  4LAW A;  4NSB A;  3BMB A;  3WH0 A;  1FKT A;  4IQC A;  4N19 A;  3ARP A;  3G6L A;  1NMW A;  2FAP A;  1Q6I A;  1HJX A;  1XHG A;  3NRK A;  2XP8 A;  1JND A;  3EY6 A;  4MNJ A;  5HT1 A;  1Q6H A;  3WQW A;  3FY1 A;  4XAK A;  3O5R A;  1NMV A;  3RGC A;  1E6Z A;  1TCO C;  1VF8 A;  2G41 A;  2O9O A;  2MLZ A;  1D7H A;  2PPO A;  3B9A A;  4TNS A;  2PPN A;  1TFV A;  4DRO A;  2XP4 A;  4LAY A;  4LGX A;  2XP3 A;  3UQI A;  4U84 A;  5HBF A;  3H9R B;  3VAW A;  1NSG A;  1ROU A;  4P8V A;  4DRQ A;  1Q1C A;  2QF8 A;  2ETN A;  4IT4 A;  2DG9 A;  1W1P A;  2PV3 A;  3OA5 A;  4U86 A;  2F23 A;  2RSE A;  5HUA A;  2PPP A;  3O5M A;  1ZB5 A;  5JH8 A;  5DIV A;  3O5Q A;  4MNM A;  4DWS A;  3FAP A;  1ZBV A;  3IKD A;  3ALF A;  4QIB A;  4O2T A;  2A3B A;  2DT3 A;  3FXY A;  1FJD A;  2EUL A;  1KFW A;  4Z2H A;  3KAC A;  2M2A A;  5D75 A;  2ZQS A;  3UQB A; 
#chains in the Genus database with same CATH homology
 2L2S A;  2F4E A;  2MF9 A;  1W9P A;  1YAT A;  2B31 A;  3ARO A;  4DRN A;  4DT4 A;  4MAV A;  1W26 A;  2WLZ A;  5B8I C;  2KO7 A;  4BF8 A;  3O5P A;  3AS2 A;  1X6L A;  5HW6 A;  2KR7 A;  1E9L A;  3B7X A;  3CHF A;  4W9O A;  2DG3 A;  2ZR5 A;  1D7J A;  1EIB A;  4ZPV R;  3TDB A;  1ZCN A;  3O5J A;  2K8I A;  2WK2 A;  3WKZ A;  4ODK A;  4JFL A;  4ZS6 A;  4G50 A;  5I98 A;  4P8U A;  3UI6 A;  3ARW A;  1LG1 A;  2D9F A;  4DRJ A;  4WJX A;  2DG4 A;  1Q6U A;  2ZQV A;  1NWR A;  1SYT A;  1EDQ A;  2ZR6 A;  3NTP A;  3OOB A;  1WAW A;  4C02 B;  4QZV B;  2FDM A;  1FKK A;  4LAX A;  3RFW A;  1EHN A;  1OGG A;  4DZ3 A;  1LL6 A;  3ARR A;  1RD6 A;  4TX0 A;  2JZV A;  1E6R A;  3O5D A;  3CZ8 A;  2XP5 A;  4FAP A;  1W9U A;  1FKI A;  1N1A A;  4R0X A;  1O6I A;  2PV1 A;  2DT2 A;  2ZR4 A;  1JNE A;  3KAG A;  2Q5A A;  4ODQ A;  2DSU A;  2DT0 A;  3ARQ A;  2N87 A;  4MSP A;  5HKG A;  1W1Y A;  4L3N A;  3KAI A;  1LL4 A;  4R5E A;  1HJW A;  3KAB A;  3WL1 A;  1P5Q A;  2FKE A;  5HW7 A;  1E15 A;  3RM9 A;  2RQS A;  5GPR A;  1J6Y A;  4G2P A;  1YW5 A;  1HJV A;  2MPH A;  1C9H A;  3IKG A;  1GPF A;  3WD0 A;  2OLH A;  1FKH A;  2KGJ A;  1W1V A;  2LKN A;  1QPL A;  4JFM A;  2XP9 A;  4HAR A;  3RME A;  1D7I A;  2XP6 A;  3IK8 A;  1U79 A;  3PR9 A;  1EYM A;  3IHZ A;  1JVW A;  4ODP A;  4DRM A;  2OFN A;  1J4R A;  4MNL A;  4W9Q A;  3UI4 A;  4ZPT R;  4Z2G A;  2RUR A;  4ZPW R;  2DSZ A;  2A3A A;  3ARX A;  3PRB A;  1ZBC A;  2IF4 A;  1BKF A;  1FFQ A;  3O5F A;  3G6M A;  1ZL1 A;  1WB0 A;  2XPA A;  3O5K A;  3WL0 A;  2VCD A;  5DO2 A;  2G8Z A;  3B9D A;  3PA7 A;  1LQ0 A;  5DF0 A;  4J4O A;  1OWQ A;  3O5G A;  3UF8 A;  1H0G A;  2DPE A;  4DZ2 A;  5GPG A;  4WKA A;  1QZ2 A;  4P8X A;  1ZK6 A;  2YBU A;  4Z2J A;  1ITX A;  4DRI A;  1SR0 A;  1JNT A;  1QPF A;  4ODR A;  3O5L A;  1ROT A;  4GIV A;  3JXV A;  4TW6 A;  1L1P A;  2Y78 A;  4JFI A;  3LUO A;  1A7X A;  2DSV A;  1E6P A;  3TC5 A;  4MPK A;  4FN2 A;  3NI6 A;  4JFK A;  5HWC A;  2MLX A;  1PIN A;  3I6C A;  1FD9 A;  3ARS A;  3GPK A;  1T11 A;  4PTM A;  4DWS D;  5BXJ A;  4S3K A;  2PBC A;  1HKJ A;  4MTV A;  3ART A;  1HXV A;  2RUC A;  1FKD A;  2ZQT A;  3PRD A;  4QT2 A;  1F40 A;  5J6E A;  3AS1 A;  4DRK A;  3MDY B;  3TCZ A;  3O5O A;  1KT1 A;  3WQV A;  4QT3 A;  4AY1 A;  4P8W A;  1XRV A;  3O5I A;  3CGM A;  4W9P A;  4Z2K A;  4ML4 A;  1FKJ A;  3QOK A;  4DWS C;  4IPX A;  2RUQ A;  3ODK A;  3B9E A;  4S3J A;  1ZBW A;  4TW8 A;  1PBK A;  4GGQ A;  4DRH A;  1FKR A;  4LAV A;  2UZ5 A;  1FAP A;  4DH0 A;  4DWS B;  3PRA A;  4ITZ A;  4HBE A;  3BXW A;  1FKS A;  3AS0 A;  4KR0 B;  4WKF A;  4HBO A;  2AOS A;  3CGN A;  2KFW A;  1FKF A;  1B6C A;  1X6N A;  2F2D A;  4TYO A;  1FKL A;  5DIU A;  1K9T A;  3JYJ A;  3ARY A;  1M5Y A;  3UI5 A;  4ODN A;  5HW8 A;  3JYM A;  2AWG A;  3UQA A;  2LJ4 A;  1W1T A;  3KCE A;  4TW7 A;  3RM8 A;  2XPB A;  2M08 A;  3KAF A;  3WIJ A;  4URI A;  1LL7 A;  2WLY A;  4MGV A;  3W4R A;  1D2K A;  4NNR A;  1OGB A;  2XP7 A;  5DEZ A;  1LG2 A;  4WK9 A;  3CHE A;  2PV2 A;  2YBT A;  3CHD A;  4WIW A;  3RM4 A;  3ARZ A;  4DRP A;  1EQ3 A;  4Q22 A;  2MLY A;  4W5U A;  3KZ7 A;  2ESC A;  1FFR A;  2A3C A;  4JFJ A;  1ZU8 A;  4IQ2 A;  1NWU A;  1BL4 A;  2RUD A;  2DSW A;  1HKK A;  2WM0 A;  2O92 A;  4ODO A;  1E6N A;  1J4H A;  3AS3 A;  4Z2I A;  2ITK A;  2LGO A;  4KQZ A;  4ODM A;  2DT1 A;  5GQB A;  3WD1 A;  1GUV A;  4Q7N A;  1FKB A;  2VN1 A;  3WD2 A;  1WNO A;  1FKG A;  3CH9 A;  2MNT A;  3AQU A;  5HTG A;  1W9V A;  4IT6 A;  3ARV A;  4ODL A;  1LJY A;  1NH6 A;  4J4N A;  3B8S A;  3CHC A;  3WD3 A;  2M1I A;  4Z2L A;  1ZBK A;  3KAH A;  1UR9 A;  4U85 A;  3WD4 A;  1J4I A;  1Y0O A;  3KAD A;  1D6O A;  3O5E A;  2ZQU A;  2LPV A;  1KT0 A;  2F21 A;  3ALG A;  4WKH A;  3ARU A;  2KI3 A;  5DIT A;  1NWS A;  1GOI A;  1IX5 A;  4NZC A;  1R9H A;  1HKI A;  2KE0 A;  2IUZ A;  1UR8 A;  4JYS A;  2PI6 A;  5HWB A;  2A3E A;  4MNK A;  4L72 B;  1JNS A;  1NWT A;  1CTN A;  1H0I A;  4DIP A;  1HKM A;  1F8A B;  4LAW A;  4NSB A;  3WH0 A;  1FKT A;  4IQC A;  4N19 A;  3ARP A;  3G6L A;  1NMW A;  2FAP A;  1Q6I A;  1HJX A;  1XHG A;  3NRK A;  2XP8 A;  1JND A;  3EY6 A;  4MNJ A;  5HT1 A;  1Q6H A;  3WQW A;  3FY1 A;  4XAK A;  3O5R A;  1NMV A;  3RGC A;  1E6Z A;  1TCO C;  1VF8 A;  2G41 A;  2O9O A;  2MLZ A;  1D7H A;  2PPO A;  3B9A A;  4TNS A;  2PPN A;  1TFV A;  4DRO A;  2XP4 A;  4LAY A;  4LGX A;  2XP3 A;  3UQI A;  4U84 A;  5HBF A;  3H9R B;  3VAW A;  1NSG A;  1ROU A;  4P8V A;  4DRQ A;  1Q1C A;  2QF8 A;  4IT4 A;  2DG9 A;  1W1P A;  2PV3 A;  3OA5 A;  4U86 A;  2RSE A;  5HUA A;  2PPP A;  3O5M A;  1ZB5 A;  5JH8 A;  5DIV A;  3O5Q A;  4MNM A;  4DWS A;  3FAP A;  1ZBV A;  3IKD A;  3ALF A;  4QIB A;  4O2T A;  2A3B A;  2DT3 A;  3FXY A;  1FJD A;  1KFW A;  4Z2H A;  3KAC A;  2M2A A;  5D75 A;  2ZQS A;  3UQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...