3IKDA

Structure-based design of novel pin1 inhibitors (i)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
113
structure length
113
Chain Sequence
EPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of novel human Pin1 inhibitors (I).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 36
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3ikdA00
1PBKA 3NI6A 2KFWA 1T11A 2DG4A 4DRQA 1NMWA 3O5LA 4MSPA 4FN2A 5J6EA 5HT1A 1Q6IA 2XP8A 3LUOA 4JFMA 2F2DA 4DRNA 3O5FA 4DIPA 1FKLA 2Y78A 4JFIA 1J6YA 4GIVA 4ODLA 2ZQVA 2PPPA 2LJ4A 4JYSA 1BKFA 1J4RA 3FAPA 3KADA 3KZ7A 3MDYB 1ROTA 2F21A 2F4EA 1JVWA 3IKGA 5DIVA 4DRKA 1YW5A 4J4OA 4NNRA 4W9PA 1FKHA 3ODKA 3GPKA 2AWGA 3OOBA 4QT3A 1YATA 4W9QA 1FKJA 4DT4A 4ODOA 4GGQA 5GPGA 2D9FA 4LAVA 2KI3A 2PBCA 4ODKA 3UQBA 1NSGA 4O2TA 2Q5AA 2M1IA 1FJDA 3KAIA 3O5IA 1U79A 2M08A 2MLYA 3KACA 2RUQA 3KCEA 4ODPA 4U84A 3O5OA 3O5PA 1KT0A 3RGCA 1ZCNA 1P5QA 4IPXA 2RSEA 2LGOA 2ZR6A 2MF9A 2RQSA 4LAWA 3JYMA 1FAPA 3IHZA 3JXVA 4G50A 3PA7A 1F40A 4FAPA 5I98A 3UQAA 2ZQTA 1FKRA 3TDBA 4TYOA 2LKNA 5DIUA 2KR7A 1FD9A 4LAXA 4J4NA 1R9HA 2FKEA 2XP6A 4N19A 4DZ3A 5BXJA 1JNTA 5HWBA 3O5QA 1A7XA 1F8AB 1Q6HA 2ZQSA 5HTGA 2XP3A 4DROA 1EYMA 4DRJA 3TCZA 1TCOC 2KE0A 2ZQUA 4TX0A 4LAYA 4IQ2A 4QT2A 4TW7A 1JNSA 5HUAA 5B8IC 4U85A 1QPLA 3KAGA 2M2AA 2XP9A 4DRIA 1N1AA 5D75A 1FKSA 4BF8A 3B7XA 4DRMA 1FKBA 1ROUA 4DRHA 1BL4A 3O5DA 3EY6A 2RURA 4ODQA 4ODMA 1PINA 1FKFA 2UZ5A 4ODNA 3UI6A 5HKGA 5HW7A 1J4HA 3UQIA 3KABA 1W26A 2XP7A 3VAWA 3O5MA 1KT1A 1C9HA 1ZK6A 3IKDA 1FKDA 5HW8A 1D6OA 2MLZA 2ZR4A 2MPHA 3H9RB 1D7IA 3UI5A 3PRDA 4U86A 2XPBA 5HW6A 2OFNA 3KAFA 4R0XA 3O5GA 4G2PA 2FAPA 4TW6A 1EQ3A 2RUCA 1QZ2A 2XPAA 3O5EA 1QPFA 2VCDA 1D7JA 1NMVA 3O5KA 4TW8A 4W9OA 2MLXA 2IF4A 4JFKA 3O5RA 4IQCA 2RUDA 2VN1A 4DZ2A 2MNTA 1Q1CA 3JYJA 3O5JA 4C02B 1HXVA 4JFJA 1L1PA 1FKIA 4QIBA 3CGMA 3TC5A 2ITKA 1Q6UA 2K8IA 2KGJA 2XP5A 2ZR5A 3UI4A 3WH0A 3RFWA 4ODRA 2DG9A 3PRBA 4JFLA 3UF8A 2DG3A 5HWCA 4MGVA 2PV2A 3KAHA 3NTPA 1Y0OA 1M5YA 2PPOA 1FKTA 1D7HA 2LPVA 2PPNA 2PV1A 3CGNA 2L2SA 3NRKA 4DRPA 2XP4A 1FKKA 2N87A 3I6CA 3IK8A 2KO7A 4ITZA 2PV3A 4TNSA 4DH0A 1J4IA 1B6CA 2JZVA 5DITA 1FKGA
chains in the Genus database with same CATH superfamily
1PBKA 1XHGA 1W9PA 3GU0A 2DT3A 3PR9A 4FN2A 3WD4A 3WD3A 3CH9A 1OGGA 4ODLA 2PPPA 4MNLA 1WB0A 1YW5A 4J4OA 4W9PA 3B9EA 1HJXA 3OOBA 2FDMA 4MNMA 4LAVA 3AS1A 3UQBA 1VF8A 4Z2HA 1NSGA 2M1IA 1FJDA 2MLYA 3KACA 4U84A 3O5OA 3O5PA 2RSEA 2LGOA 3CHCA 2RQSA 3ARUA 1IX5A 4TYOA 4DWSA 3WKZA 4N19A 1JNTA 3OA5A 3O5QA 2WLYA 3AS2A 4LAYA 3BMBA 4AY1A 1N1AA 5D75A 4XAKA 4BF8A 5HBFA 1EIBA 1ROUA 3B8SA 4ODMA 1NH6A 4URIA 1GPFA 3UI6A 1E15A 4Q7NA 1W26A 4Z2IA 2IUZA 4Z2LA 1D6OA 2MLZA 2MPHA 2A3EA 4U86A 3O5EA 2VCDA 2MLXA 4JFKA 1HKIA 4UDMA 3PRAA 2RUDA 1HJVA 3ARQA 1GRJA 4QIBA 2K8IA 2KGJA 2O9OA 3UI4A 3WH0A 3W4RA 1E9LA 2DG3A 3KAHA 1Y0OA 4DWSD 2L2SA 1W1PA 3I6CA 2N87A 1HKJA 3WD0A 3IK8A 4HBOA 2KO7A 3G6MA 2YBUA 2WLZA 3ARTA 5DITA 4MGVA 1UR8A 1T11A 2DG4A 1NMWA 1SYTA 1O6IA 3LUOA 2F2DA 3O5FA 2Y78A 4JFIA 1NWSA 1E44A 1J4RA 1HKKA 1ROTA 2F21A 1TFVA 5DIVA 3ARRA 1X6NA 3AROA 2QF8A 1UR9A 3AQUA 3B9AA 3ALFA 2AWGA 1LG1A 4W9QA 4DT4A 4Z2JA 4S3JA 2D9FA 3RM9A 4ZPVR 2DT1A 5GQBA 1ZBKA 3B9DA 3CZ8A 4G50A 3PA7A 4FAPA 2DSVA 2DT0A 4WKHA 2EULA 5DEZA 1W1VA 2YBTA 1X6LA 2XP3A 4TX0A 2PI6A 3KAGA 2M2AA 2XP9A 3WL1A 3WL0A 4DRIA 1JNEA 2G41A 3B7XA 1FKBA 3WQVA 4P8WA 3O5DA 4Q22A 3EY6A 2RURA 4ODQA 1PINA 4P8UA 1FKFA 2WK2A 1LG2A 5HKGA 1D2KA 3UQIA 1EDQA 2XP7A 3O5MA 1W9UA 1OGBA 1C9HA 1NWUA 2ZR4A 3H9RB 1JCHB 1E6RA 2OFNA 3KAFA 4W5UA 2FAPA 4TW6A 1QZ2A 4ZPWR 5DF0A 1K9TA 2B31A 1NMVA 2IF4A 4IQCA 2DSUA 2MNTA 4R5EA 1Q1CA 3ALGA 3O5JA 3FY1A 5DO2A 4ZS6A 4ODRA 2DG9A 3UF8A 2A3AA 4Z2KA 2PV2A 1WAWA 1FKTA 1D7HA 2LPVA 2PPNA 5GPRA 1ZB5A 1LL6A 1FKKA 4MNKA 3CHDA 4ITZA 3NI6A 3O5LA 1Q6IA 3ARWA 4JFMA 1HJWA 1J6YA 3ARSA 4GIVA 2ZQVA 1ZBWA 1BKFA 1LL7A 4MAVA 1H0GA 1E6ZA 3MDYB 3KZ7A 2F4EA 1JVWA 3IKGA 1HKMA 4NNRA 3ARXA 4Z2GA 3ODKA 4QT3A 1YATA 3EIPA 4ODOA 4GGQA 4ZPTR 4QZVB 4HARA 2PBCA 4ODKA 4O2TA 2Q5AA 4NSBA 1U79A 2M08A 5JH8A 2RUQA 3FXYA 1KT0A 3RGCA 1P5QA 2WM0A 2ZR6A 1FAPA 4LGXA 5I98A 3UQAA 2O92A 1FKRA 1W1YA 2KR7A 1FD9A 2F23A 3RMEA 1R9HA 2FKEA 3CHEA 1NWRA 2ZQSA 1A7XA 5HTGA 1CTNA 1TCOC 2KE0A 4QT2A 3WD2A 1JNSA 1WNOA 1QPLA 4DRMA 1BL4A 1LQ0A 3WIJA 4ODNA 3VAWA 4KR0B 1ZK6A 3IKDA 5HW8A 1D7IA 4MTVA 3GTYX 1FFQA 2XPBA 4KQZA 1EQ3A 1F40A 1W9VA 2XPAA 4DRQA 1QPFA 1D7JA 4W9OA 3O5RA 1KFWA 2VN1A 1FFRA 3WD1A 1HXVA 1L1PA 4L3NA 4WKFA 2ITKA 1Q6UA 3ARYA 2DSWA 4IT6A 1SR0A 2P4VA 1M5YA 2PPOA 2PV1A 3NRKA 2XP4A 2AOSA 1GOIA 2PV3A 4TNSA 4PTMA 4DH0A 2DPEA 1FKGA 4WIWA 4DWSB 1JNDA 2KFWA 4L72B 1ZBVA 1ZU8A 4MSPA 3RM4A 5HT1A 5J6EA 2XP8A 4WK9A 3ARPA 4DRNA 4DIPA 1FKLA 4ML4A 1NWTA 1ZL1A 2LJ4A 4JYSA 2ETNA 3ARZA 3FAPA 4IT4A 3KADA 4S3KA 2A3BA 4WKAA 3WQWA 4DRKA 1ZBCA 2DSZA 1FKHA 3GPKA 1FKJA 1ITXA 5GPGA 2KI3A 3AS3A 4DWSC 3CHFA 3KAIA 3O5IA 3KCEA 4ODPA 1EHNA 3QOKA 2G8ZA 4MPKA 1ZCNA 1GUVA 4IPXA 2MF9A 4LAWA 3JYMA 3IHZA 3JXVA 2ZQTA 3TDBA 2LKNA 5DIUA 4LAXA 4J4NA 5HWBA 2XP6A 4DZ3A 5BXJA 2OLHA 4NZCA 1LJYA 1F8AB 1Q6HA 1H0IA 1RD6A 2B5UB 4DROA 1EYMA 4DRJA 3TCZA 2ZQUA 4IQ2A 4TW7A 1XRVA 5HUAA 5B8IC 1LL4A 2ESCA 4U85A 2PN0A 4P8VA 1FKSA 4DRHA 4HBEA 1OWQA 3BXWA 3ARVA 2UZ5A 5HW7A 1J4HA 3KABA 1E6NA 4P8XA 3RM8A 1KT1A 3AS0A 1FKDA 1W1TA 3PRDA 5HW6A 4R0XA 3O5GA 4G2PA 2RUCA 4DRPA 3UI5A 4TW8A 2DT2A 3O5KA 4DZ2A 4WJXA 1E6PA 4C02B 3JYJA 4MNJA 4JFJA 1FKIA 3CGMA 3TC5A 2XP5A 2ZR5A 3RFWA 3PRBA 4JFLA 2A3CA 5HWCA 3NTPA 3CGNA 1J4IA 1B6CA 2JZVA 3G6LA
chains in the Genus database with same CATH topology
1PBKA 1XHGA 1W9PA 2DT3A 3PR9A 4FN2A 3WD4A 3WD3A 3CH9A 1OGGA 4ODLA 2PPPA 4MNLA 1WB0A 1YW5A 4J4OA 4W9PA 3B9EA 1HJXA 3OOBA 2FDMA 4MNMA 4LAVA 3AS1A 3UQBA 1VF8A 4Z2HA 1NSGA 2M1IA 1FJDA 2MLYA 3KACA 4U84A 3O5OA 3O5PA 2RSEA 2LGOA 3CHCA 2RQSA 3ARUA 1IX5A 4TYOA 4DWSA 3WKZA 4N19A 1JNTA 3OA5A 3O5QA 2WLYA 3AS2A 4LAYA 4AY1A 1N1AA 5D75A 4XAKA 4BF8A 5HBFA 1EIBA 1ROUA 3B8SA 4ODMA 1NH6A 4URIA 1GPFA 3UI6A 1E15A 4Q7NA 1W26A 4Z2IA 2IUZA 4Z2LA 1D6OA 2MLZA 2MPHA 2A3EA 4U86A 3O5EA 2VCDA 2MLXA 4JFKA 1HKIA 3PRAA 2RUDA 1HJVA 3ARQA 4QIBA 2K8IA 2KGJA 2O9OA 3UI4A 3WH0A 3W4RA 1E9LA 2DG3A 3KAHA 1Y0OA 4DWSD 2L2SA 1W1PA 3I6CA 2N87A 1HKJA 3WD0A 3IK8A 4HBOA 2KO7A 3G6MA 2YBUA 2WLZA 3ARTA 5DITA 4MGVA 1UR8A 1T11A 2DG4A 1NMWA 1SYTA 1O6IA 3LUOA 2F2DA 3O5FA 2Y78A 4JFIA 1NWSA 1J4RA 1HKKA 1ROTA 2F21A 1TFVA 5DIVA 3ARRA 1X6NA 3AROA 2QF8A 1UR9A 3AQUA 3B9AA 3ALFA 2AWGA 1LG1A 4W9QA 4DT4A 4Z2JA 4S3JA 2D9FA 3RM9A 4ZPVR 2DT1A 5GQBA 1ZBKA 3B9DA 3CZ8A 4G50A 3PA7A 4FAPA 2DSVA 2DT0A 4WKHA 5DEZA 1W1VA 2YBTA 1X6LA 2XP3A 4TX0A 2PI6A 3KAGA 2M2AA 2XP9A 3WL1A 3WL0A 4DRIA 1JNEA 2G41A 3B7XA 1FKBA 3WQVA 4P8WA 3O5DA 4Q22A 3EY6A 2RURA 4ODQA 1PINA 4P8UA 1FKFA 2WK2A 1LG2A 5HKGA 1D2KA 3UQIA 1EDQA 2XP7A 3O5MA 1W9UA 1OGBA 1C9HA 1NWUA 2ZR4A 3H9RB 1E6RA 2OFNA 3KAFA 4W5UA 2FAPA 4TW6A 1QZ2A 4ZPWR 5DF0A 1K9TA 2B31A 1NMVA 2IF4A 4IQCA 2DSUA 2MNTA 4R5EA 1Q1CA 3ALGA 3O5JA 3FY1A 5DO2A 4ZS6A 4ODRA 2DG9A 3UF8A 2A3AA 4Z2KA 2PV2A 1WAWA 1FKTA 1D7HA 2LPVA 2PPNA 5GPRA 1ZB5A 1LL6A 1FKKA 4MNKA 3CHDA 4ITZA 3NI6A 3O5LA 1Q6IA 3ARWA 4JFMA 1HJWA 1J6YA 3ARSA 4GIVA 2ZQVA 1ZBWA 1BKFA 1LL7A 4MAVA 1H0GA 1E6ZA 3KZ7A 3MDYB 2F4EA 1JVWA 3IKGA 1HKMA 4NNRA 3ARXA 4Z2GA 3ODKA 4QT3A 1YATA 4ODOA 4GGQA 4ZPTR 4QZVB 4HARA 2PBCA 4ODKA 4O2TA 2Q5AA 4NSBA 1U79A 2M08A 5JH8A 2RUQA 3FXYA 1KT0A 3RGCA 1P5QA 2WM0A 2ZR6A 1FAPA 4LGXA 5I98A 3UQAA 2O92A 1FKRA 1W1YA 2KR7A 1FD9A 3RMEA 1R9HA 2FKEA 3CHEA 1NWRA 2ZQSA 1A7XA 5HTGA 1CTNA 1TCOC 2KE0A 4QT2A 3WD2A 1JNSA 1WNOA 1QPLA 4DRMA 1BL4A 1LQ0A 3WIJA 4ODNA 3VAWA 4KR0B 1ZK6A 3IKDA 5HW8A 1D7IA 4MTVA 1FFQA 2XPBA 4KQZA 1EQ3A 1F40A 1W9VA 2XPAA 4DRQA 1QPFA 1D7JA 4W9OA 3O5RA 1KFWA 2VN1A 1FFRA 3WD1A 1HXVA 1L1PA 4L3NA 4WKFA 2ITKA 1Q6UA 3ARYA 2DSWA 4IT6A 1SR0A 2PPOA 1M5YA 2PV1A 3NRKA 2XP4A 2AOSA 1GOIA 2PV3A 4TNSA 4PTMA 4DH0A 2DPEA 1FKGA 4WIWA 4DWSB 1JNDA 2KFWA 4L72B 1ZBVA 1ZU8A 4MSPA 3RM4A 5HT1A 5J6EA 2XP8A 4WK9A 3ARPA 4DRNA 4DIPA 1FKLA 4ML4A 1NWTA 1ZL1A 2LJ4A 4JYSA 3ARZA 3FAPA 4IT4A 3KADA 4S3KA 2A3BA 4WKAA 3WQWA 4DRKA 1ZBCA 2DSZA 1FKHA 3GPKA 1FKJA 1ITXA 5GPGA 2KI3A 3AS3A 4DWSC 3CHFA 3KAIA 3O5IA 3KCEA 4ODPA 1EHNA 3QOKA 2G8ZA 4MPKA 1ZCNA 1GUVA 4IPXA 2MF9A 4LAWA 3JYMA 3IHZA 3JXVA 2ZQTA 3TDBA 2LKNA 5DIUA 4LAXA 4J4NA 5HWBA 2XP6A 4DZ3A 5BXJA 2OLHA 4NZCA 1LJYA 1F8AB 1Q6HA 1H0IA 1RD6A 4DROA 1EYMA 4DRJA 3TCZA 2ZQUA 4IQ2A 4TW7A 1XRVA 5HUAA 5B8IC 1LL4A 2ESCA 4U85A 4P8VA 1FKSA 4DRHA 4HBEA 1OWQA 3BXWA 3ARVA 2UZ5A 5HW7A 1J4HA 3KABA 1E6NA 4P8XA 3RM8A 1KT1A 3AS0A 1FKDA 1W1TA 3PRDA 5HW6A 4R0XA 3O5GA 4G2PA 2RUCA 4DRPA 3UI5A 4TW8A 2DT2A 3O5KA 4DZ2A 4WJXA 1E6PA 4C02B 3JYJA 4MNJA 4JFJA 1FKIA 3CGMA 3TC5A 2XP5A 2ZR5A 3RFWA 3PRBA 4JFLA 2A3CA 5HWCA 3NTPA 3CGNA 1J4IA 1B6CA 2JZVA 3G6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBK A;  3NI6 A;  2KFW A;  1T11 A;  2DG4 A;  4DRQ A;  1NMW A;  3O5L A;  4MSP A;  4FN2 A;  5J6E A;  5HT1 A;  1Q6I A;  2XP8 A;  3LUO A;  4JFM A;  2F2D A;  4DRN A;  3O5F A;  4DIP A;  1FKL A;  2Y78 A;  4JFI A;  1J6Y A;  4GIV A;  4ODL A;  2ZQV A;  2PPP A;  2LJ4 A;  4JYS A;  1BKF A;  1J4R A;  3FAP A;  3KAD A;  3KZ7 A;  3MDY B;  1ROT A;  2F21 A;  2F4E A;  1JVW A;  3IKG A;  5DIV A;  4DRK A;  1YW5 A;  4J4O A;  4NNR A;  4W9P A;  1FKH A;  3ODK A;  3GPK A;  2AWG A;  3OOB A;  4QT3 A;  1YAT A;  4W9Q A;  1FKJ A;  4DT4 A;  4ODO A;  4GGQ A;  5GPG A;  2D9F A;  4LAV A;  2KI3 A;  2PBC A;  4ODK A;  3UQB A;  1NSG A;  4O2T A;  2Q5A A;  2M1I A;  1FJD A;  3KAI A;  3O5I A;  1U79 A;  2M08 A;  2MLY A;  3KAC A;  2RUQ A;  3KCE A;  4ODP A;  4U84 A;  3O5O A;  3O5P A;  1KT0 A;  3RGC A;  1ZCN A;  1P5Q A;  4IPX A;  2RSE A;  2LGO A;  2ZR6 A;  2MF9 A;  2RQS A;  4LAW A;  3JYM A;  1FAP A;  3IHZ A;  3JXV A;  4G50 A;  3PA7 A;  1F40 A;  4FAP A;  5I98 A;  3UQA A;  2ZQT A;  1FKR A;  3TDB A;  4TYO A;  2LKN A;  5DIU A;  2KR7 A;  1FD9 A;  4LAX A;  4J4N A;  1R9H A;  2FKE A;  2XP6 A;  4N19 A;  4DZ3 A;  5BXJ A;  1JNT A;  5HWB A;  3O5Q A;  1A7X A;  1F8A B;  1Q6H A;  2ZQS A;  5HTG A;  2XP3 A;  4DRO A;  1EYM A;  4DRJ A;  3TCZ A;  1TCO C;  2KE0 A;  2ZQU A;  4TX0 A;  4LAY A;  4IQ2 A;  4QT2 A;  4TW7 A;  1JNS A;  5HUA A;  5B8I C;  4U85 A;  1QPL A;  3KAG A;  2M2A A;  2XP9 A;  4DRI A;  1N1A A;  5D75 A;  1FKS A;  4BF8 A;  3B7X A;  4DRM A;  1FKB A;  1ROU A;  4DRH A;  1BL4 A;  3O5D A;  3EY6 A;  2RUR A;  4ODQ A;  4ODM A;  1PIN A;  1FKF A;  2UZ5 A;  4ODN A;  3UI6 A;  5HKG A;  5HW7 A;  1J4H A;  3UQI A;  3KAB A;  1W26 A;  2XP7 A;  3VAW A;  3O5M A;  1KT1 A;  1C9H A;  1ZK6 A;  3IKD A;  1FKD A;  5HW8 A;  1D6O A;  2MLZ A;  2ZR4 A;  2MPH A;  3H9R B;  1D7I A;  3UI5 A;  3PRD A;  4U86 A;  2XPB A;  5HW6 A;  2OFN A;  3KAF A;  4R0X A;  3O5G A;  4G2P A;  2FAP A;  4TW6 A;  1EQ3 A;  2RUC A;  1QZ2 A;  2XPA A;  3O5E A;  1QPF A;  2VCD A;  1D7J A;  1NMV A;  3O5K A;  4TW8 A;  4W9O A;  2MLX A;  2IF4 A;  4JFK A;  3O5R A;  4IQC A;  2RUD A;  2VN1 A;  4DZ2 A;  2MNT A;  1Q1C A;  3JYJ A;  3O5J A;  4C02 B;  1HXV A;  4JFJ A;  1L1P A;  1FKI A;  4QIB A;  3CGM A;  3TC5 A;  2ITK A;  1Q6U A;  2K8I A;  2KGJ A;  2XP5 A;  2ZR5 A;  3UI4 A;  3WH0 A;  3RFW A;  4ODR A;  2DG9 A;  3PRB A;  4JFL A;  3UF8 A;  2DG3 A;  5HWC A;  4MGV A;  2PV2 A;  3KAH A;  3NTP A;  1Y0O A;  1M5Y A;  2PPO A;  1FKT A;  1D7H A;  2LPV A;  2PPN A;  2PV1 A;  3CGN A;  2L2S A;  3NRK A;  4DRP A;  2XP4 A;  1FKK A;  2N87 A;  3I6C A;  3IK8 A;  2KO7 A;  4ITZ A;  2PV3 A;  4TNS A;  4DH0 A;  1J4I A;  1B6C A;  2JZV A;  5DIT A;  1FKG A; 
#chains in the Genus database with same CATH topology
 1PBK A;  1XHG A;  1W9P A;  3GU0 A;  2DT3 A;  3PR9 A;  4FN2 A;  3WD4 A;  3WD3 A;  3CH9 A;  1OGG A;  4ODL A;  2PPP A;  4MNL A;  1WB0 A;  1YW5 A;  4J4O A;  4W9P A;  3B9E A;  1HJX A;  3OOB A;  2FDM A;  4MNM A;  4LAV A;  3AS1 A;  3UQB A;  1VF8 A;  4Z2H A;  1NSG A;  2M1I A;  1FJD A;  2MLY A;  3KAC A;  4U84 A;  3O5O A;  3O5P A;  2RSE A;  2LGO A;  3CHC A;  2RQS A;  3ARU A;  1IX5 A;  4TYO A;  4DWS A;  3WKZ A;  4N19 A;  1JNT A;  3OA5 A;  3O5Q A;  2WLY A;  3AS2 A;  4LAY A;  3BMB A;  4AY1 A;  1N1A A;  5D75 A;  4XAK A;  4BF8 A;  5HBF A;  1EIB A;  1ROU A;  3B8S A;  4ODM A;  1NH6 A;  4URI A;  1GPF A;  3UI6 A;  1E15 A;  4Q7N A;  1W26 A;  4Z2I A;  2IUZ A;  4Z2L A;  1D6O A;  2MLZ A;  2MPH A;  2A3E A;  4U86 A;  3O5E A;  2VCD A;  2MLX A;  4JFK A;  1HKI A;  4UDM A;  3PRA A;  2RUD A;  1HJV A;  3ARQ A;  1GRJ A;  4QIB A;  2K8I A;  2KGJ A;  2O9O A;  3UI4 A;  3WH0 A;  3W4R A;  1E9L A;  2DG3 A;  3KAH A;  1Y0O A;  4DWS D;  2L2S A;  1W1P A;  3I6C A;  2N87 A;  1HKJ A;  3WD0 A;  3IK8 A;  4HBO A;  2KO7 A;  3G6M A;  2YBU A;  2WLZ A;  3ART A;  5DIT A;  4MGV A;  1UR8 A;  1T11 A;  2DG4 A;  1NMW A;  1SYT A;  1O6I A;  3LUO A;  2F2D A;  3O5F A;  2Y78 A;  4JFI A;  1NWS A;  1E44 A;  1J4R A;  1HKK A;  1ROT A;  2F21 A;  1TFV A;  5DIV A;  3ARR A;  1X6N A;  3ARO A;  2QF8 A;  1UR9 A;  3AQU A;  3B9A A;  3ALF A;  2AWG A;  1LG1 A;  4W9Q A;  4DT4 A;  4Z2J A;  4S3J A;  2D9F A;  3RM9 A;  4ZPV R;  2DT1 A;  5GQB A;  1ZBK A;  3B9D A;  3CZ8 A;  4G50 A;  3PA7 A;  4FAP A;  2DSV A;  2DT0 A;  4WKH A;  2EUL A;  5DEZ A;  1W1V A;  2YBT A;  1X6L A;  2XP3 A;  4TX0 A;  2PI6 A;  3KAG A;  2M2A A;  2XP9 A;  3WL1 A;  3WL0 A;  4DRI A;  1JNE A;  2G41 A;  3B7X A;  1FKB A;  3WQV A;  4P8W A;  3O5D A;  4Q22 A;  3EY6 A;  2RUR A;  4ODQ A;  1PIN A;  4P8U A;  1FKF A;  2WK2 A;  1LG2 A;  5HKG A;  1D2K A;  3UQI A;  1EDQ A;  2XP7 A;  3O5M A;  1W9U A;  1OGB A;  1C9H A;  1NWU A;  2ZR4 A;  3H9R B;  1JCH B;  1E6R A;  2OFN A;  3KAF A;  4W5U A;  2FAP A;  4TW6 A;  1QZ2 A;  4ZPW R;  5DF0 A;  1K9T A;  2B31 A;  1NMV A;  2IF4 A;  4IQC A;  2DSU A;  2MNT A;  4R5E A;  1Q1C A;  3ALG A;  3O5J A;  3FY1 A;  5DO2 A;  4ZS6 A;  4ODR A;  2DG9 A;  3UF8 A;  2A3A A;  4Z2K A;  2PV2 A;  1WAW A;  1FKT A;  1D7H A;  2LPV A;  2PPN A;  5GPR A;  1ZB5 A;  1LL6 A;  1FKK A;  4MNK A;  3CHD A;  4ITZ A;  3NI6 A;  3O5L A;  1Q6I A;  3ARW A;  4JFM A;  1HJW A;  1J6Y A;  3ARS A;  4GIV A;  2ZQV A;  1ZBW A;  1BKF A;  1LL7 A;  4MAV A;  1H0G A;  1E6Z A;  3MDY B;  3KZ7 A;  2F4E A;  1JVW A;  3IKG A;  1HKM A;  4NNR A;  3ARX A;  4Z2G A;  3ODK A;  4QT3 A;  1YAT A;  3EIP A;  4ODO A;  4GGQ A;  4ZPT R;  4QZV B;  4HAR A;  2PBC A;  4ODK A;  4O2T A;  2Q5A A;  4NSB A;  1U79 A;  2M08 A;  5JH8 A;  2RUQ A;  3FXY A;  1KT0 A;  3RGC A;  1P5Q A;  2WM0 A;  2ZR6 A;  1FAP A;  4LGX A;  5I98 A;  3UQA A;  2O92 A;  1FKR A;  1W1Y A;  2KR7 A;  1FD9 A;  2F23 A;  3RME A;  1R9H A;  2FKE A;  3CHE A;  1NWR A;  2ZQS A;  1A7X A;  5HTG A;  1CTN A;  1TCO C;  2KE0 A;  4QT2 A;  3WD2 A;  1JNS A;  1WNO A;  1QPL A;  4DRM A;  1BL4 A;  1LQ0 A;  3WIJ A;  4ODN A;  3VAW A;  4KR0 B;  1ZK6 A;  3IKD A;  5HW8 A;  1D7I A;  4MTV A;  3GTY X;  1FFQ A;  2XPB A;  4KQZ A;  1EQ3 A;  1F40 A;  1W9V A;  2XPA A;  4DRQ A;  1QPF A;  1D7J A;  4W9O A;  3O5R A;  1KFW A;  2VN1 A;  1FFR A;  3WD1 A;  1HXV A;  1L1P A;  4L3N A;  4WKF A;  2ITK A;  1Q6U A;  3ARY A;  2DSW A;  4IT6 A;  1SR0 A;  2P4V A;  1M5Y A;  2PPO A;  2PV1 A;  3NRK A;  2XP4 A;  2AOS A;  1GOI A;  2PV3 A;  4TNS A;  4PTM A;  4DH0 A;  2DPE A;  1FKG A;  4WIW A;  4DWS B;  1JND A;  2KFW A;  4L72 B;  1ZBV A;  1ZU8 A;  4MSP A;  3RM4 A;  5HT1 A;  5J6E A;  2XP8 A;  4WK9 A;  3ARP A;  4DRN A;  4DIP A;  1FKL A;  4ML4 A;  1NWT A;  1ZL1 A;  2LJ4 A;  4JYS A;  2ETN A;  3ARZ A;  3FAP A;  4IT4 A;  3KAD A;  4S3K A;  2A3B A;  4WKA A;  3WQW A;  4DRK A;  1ZBC A;  2DSZ A;  1FKH A;  3GPK A;  1FKJ A;  1ITX A;  5GPG A;  2KI3 A;  3AS3 A;  4DWS C;  3CHF A;  3KAI A;  3O5I A;  3KCE A;  4ODP A;  1EHN A;  3QOK A;  2G8Z A;  4MPK A;  1ZCN A;  1GUV A;  4IPX A;  2MF9 A;  4LAW A;  3JYM A;  3IHZ A;  3JXV A;  2ZQT A;  3TDB A;  2LKN A;  5DIU A;  4LAX A;  4J4N A;  5HWB A;  2XP6 A;  4DZ3 A;  5BXJ A;  2OLH A;  4NZC A;  1LJY A;  1F8A B;  1Q6H A;  1H0I A;  1RD6 A;  2B5U B;  4DRO A;  1EYM A;  4DRJ A;  3TCZ A;  2ZQU A;  4IQ2 A;  4TW7 A;  1XRV A;  5HUA A;  5B8I C;  1LL4 A;  2ESC A;  4U85 A;  2PN0 A;  4P8V A;  1FKS A;  4DRH A;  4HBE A;  1OWQ A;  3BXW A;  3ARV A;  2UZ5 A;  5HW7 A;  1J4H A;  3KAB A;  1E6N A;  4P8X A;  3RM8 A;  1KT1 A;  3AS0 A;  1FKD A;  1W1T A;  3PRD A;  5HW6 A;  4R0X A;  3O5G A;  4G2P A;  2RUC A;  4DRP A;  3UI5 A;  4TW8 A;  2DT2 A;  3O5K A;  4DZ2 A;  4WJX A;  1E6P A;  4C02 B;  3JYJ A;  4MNJ A;  4JFJ A;  1FKI A;  3CGM A;  3TC5 A;  2XP5 A;  2ZR5 A;  3RFW A;  3PRB A;  4JFL A;  2A3C A;  5HWC A;  3NTP A;  3CGN A;  1J4I A;  1B6C A;  2JZV A;  3G6L A; 
#chains in the Genus database with same CATH homology
 1PBK A;  1XHG A;  1W9P A;  2DT3 A;  3PR9 A;  4FN2 A;  3WD4 A;  3WD3 A;  3CH9 A;  1OGG A;  4ODL A;  2PPP A;  4MNL A;  1WB0 A;  1YW5 A;  4J4O A;  4W9P A;  3B9E A;  1HJX A;  3OOB A;  2FDM A;  4MNM A;  4LAV A;  3AS1 A;  3UQB A;  1VF8 A;  4Z2H A;  1NSG A;  2M1I A;  1FJD A;  2MLY A;  3KAC A;  4U84 A;  3O5O A;  3O5P A;  2RSE A;  2LGO A;  3CHC A;  2RQS A;  3ARU A;  1IX5 A;  4TYO A;  4DWS A;  3WKZ A;  4N19 A;  1JNT A;  3OA5 A;  3O5Q A;  2WLY A;  3AS2 A;  4LAY A;  4AY1 A;  1N1A A;  5D75 A;  4XAK A;  4BF8 A;  5HBF A;  1EIB A;  1ROU A;  3B8S A;  4ODM A;  1NH6 A;  4URI A;  1GPF A;  3UI6 A;  1E15 A;  4Q7N A;  1W26 A;  4Z2I A;  2IUZ A;  4Z2L A;  1D6O A;  2MLZ A;  2MPH A;  2A3E A;  4U86 A;  3O5E A;  2VCD A;  2MLX A;  4JFK A;  1HKI A;  3PRA A;  2RUD A;  1HJV A;  3ARQ A;  4QIB A;  2K8I A;  2KGJ A;  2O9O A;  3UI4 A;  3WH0 A;  3W4R A;  1E9L A;  2DG3 A;  3KAH A;  1Y0O A;  4DWS D;  2L2S A;  1W1P A;  3I6C A;  2N87 A;  1HKJ A;  3WD0 A;  3IK8 A;  4HBO A;  2KO7 A;  3G6M A;  2YBU A;  2WLZ A;  3ART A;  5DIT A;  4MGV A;  1UR8 A;  1T11 A;  2DG4 A;  1NMW A;  1SYT A;  1O6I A;  3LUO A;  2F2D A;  3O5F A;  2Y78 A;  4JFI A;  1NWS A;  1J4R A;  1HKK A;  1ROT A;  2F21 A;  1TFV A;  5DIV A;  3ARR A;  1X6N A;  3ARO A;  2QF8 A;  1UR9 A;  3AQU A;  3B9A A;  3ALF A;  2AWG A;  1LG1 A;  4W9Q A;  4DT4 A;  4Z2J A;  4S3J A;  2D9F A;  3RM9 A;  4ZPV R;  2DT1 A;  5GQB A;  1ZBK A;  3B9D A;  3CZ8 A;  4G50 A;  3PA7 A;  4FAP A;  2DSV A;  2DT0 A;  4WKH A;  5DEZ A;  1W1V A;  2YBT A;  1X6L A;  2XP3 A;  4TX0 A;  2PI6 A;  3KAG A;  2M2A A;  2XP9 A;  3WL1 A;  3WL0 A;  4DRI A;  1JNE A;  2G41 A;  3B7X A;  1FKB A;  3WQV A;  4P8W A;  3O5D A;  4Q22 A;  3EY6 A;  2RUR A;  4ODQ A;  1PIN A;  4P8U A;  1FKF A;  2WK2 A;  1LG2 A;  5HKG A;  1D2K A;  3UQI A;  1EDQ A;  2XP7 A;  3O5M A;  1W9U A;  1OGB A;  1C9H A;  1NWU A;  2ZR4 A;  3H9R B;  1E6R A;  2OFN A;  3KAF A;  4W5U A;  2FAP A;  4TW6 A;  1QZ2 A;  4ZPW R;  5DF0 A;  1K9T A;  2B31 A;  1NMV A;  2IF4 A;  4IQC A;  2DSU A;  2MNT A;  4R5E A;  1Q1C A;  3ALG A;  3O5J A;  3FY1 A;  5DO2 A;  4ZS6 A;  4ODR A;  2DG9 A;  3UF8 A;  2A3A A;  4Z2K A;  2PV2 A;  1WAW A;  1FKT A;  1D7H A;  2LPV A;  2PPN A;  5GPR A;  1ZB5 A;  1LL6 A;  1FKK A;  4MNK A;  3CHD A;  4ITZ A;  3NI6 A;  3O5L A;  1Q6I A;  3ARW A;  4JFM A;  1HJW A;  1J6Y A;  3ARS A;  4GIV A;  2ZQV A;  1ZBW A;  1BKF A;  1LL7 A;  4MAV A;  1H0G A;  1E6Z A;  3KZ7 A;  3MDY B;  2F4E A;  1JVW A;  3IKG A;  1HKM A;  4NNR A;  3ARX A;  4Z2G A;  3ODK A;  4QT3 A;  1YAT A;  4ODO A;  4GGQ A;  4ZPT R;  4QZV B;  4HAR A;  2PBC A;  4ODK A;  4O2T A;  2Q5A A;  4NSB A;  1U79 A;  2M08 A;  5JH8 A;  2RUQ A;  3FXY A;  1KT0 A;  3RGC A;  1P5Q A;  2WM0 A;  2ZR6 A;  1FAP A;  4LGX A;  5I98 A;  3UQA A;  2O92 A;  1FKR A;  1W1Y A;  2KR7 A;  1FD9 A;  3RME A;  1R9H A;  2FKE A;  3CHE A;  1NWR A;  2ZQS A;  1A7X A;  5HTG A;  1CTN A;  1TCO C;  2KE0 A;  4QT2 A;  3WD2 A;  1JNS A;  1WNO A;  1QPL A;  4DRM A;  1BL4 A;  1LQ0 A;  3WIJ A;  4ODN A;  3VAW A;  4KR0 B;  1ZK6 A;  3IKD A;  5HW8 A;  1D7I A;  4MTV A;  1FFQ A;  2XPB A;  4KQZ A;  1EQ3 A;  1F40 A;  1W9V A;  2XPA A;  4DRQ A;  1QPF A;  1D7J A;  4W9O A;  3O5R A;  1KFW A;  2VN1 A;  1FFR A;  3WD1 A;  1HXV A;  1L1P A;  4L3N A;  4WKF A;  2ITK A;  1Q6U A;  3ARY A;  2DSW A;  4IT6 A;  1SR0 A;  2PPO A;  1M5Y A;  2PV1 A;  3NRK A;  2XP4 A;  2AOS A;  1GOI A;  2PV3 A;  4TNS A;  4PTM A;  4DH0 A;  2DPE A;  1FKG A;  4WIW A;  4DWS B;  1JND A;  2KFW A;  4L72 B;  1ZBV A;  1ZU8 A;  4MSP A;  3RM4 A;  5HT1 A;  5J6E A;  2XP8 A;  4WK9 A;  3ARP A;  4DRN A;  4DIP A;  1FKL A;  4ML4 A;  1NWT A;  1ZL1 A;  2LJ4 A;  4JYS A;  3ARZ A;  3FAP A;  4IT4 A;  3KAD A;  4S3K A;  2A3B A;  4WKA A;  3WQW A;  4DRK A;  1ZBC A;  2DSZ A;  1FKH A;  3GPK A;  1FKJ A;  1ITX A;  5GPG A;  2KI3 A;  3AS3 A;  4DWS C;  3CHF A;  3KAI A;  3O5I A;  3KCE A;  4ODP A;  1EHN A;  3QOK A;  2G8Z A;  4MPK A;  1ZCN A;  1GUV A;  4IPX A;  2MF9 A;  4LAW A;  3JYM A;  3IHZ A;  3JXV A;  2ZQT A;  3TDB A;  2LKN A;  5DIU A;  4LAX A;  4J4N A;  5HWB A;  2XP6 A;  4DZ3 A;  5BXJ A;  2OLH A;  4NZC A;  1LJY A;  1F8A B;  1Q6H A;  1H0I A;  1RD6 A;  4DRO A;  1EYM A;  4DRJ A;  3TCZ A;  2ZQU A;  4IQ2 A;  4TW7 A;  1XRV A;  5HUA A;  5B8I C;  1LL4 A;  2ESC A;  4U85 A;  4P8V A;  1FKS A;  4DRH A;  4HBE A;  1OWQ A;  3BXW A;  3ARV A;  2UZ5 A;  5HW7 A;  1J4H A;  3KAB A;  1E6N A;  4P8X A;  3RM8 A;  1KT1 A;  3AS0 A;  1FKD A;  1W1T A;  3PRD A;  5HW6 A;  4R0X A;  3O5G A;  4G2P A;  2RUC A;  4DRP A;  3UI5 A;  4TW8 A;  2DT2 A;  3O5K A;  4DZ2 A;  4WJX A;  1E6P A;  4C02 B;  3JYJ A;  4MNJ A;  4JFJ A;  1FKI A;  3CGM A;  3TC5 A;  2XP5 A;  2ZR5 A;  3RFW A;  3PRB A;  4JFL A;  2A3C A;  5HWC A;  3NTP A;  3CGN A;  1J4I A;  1B6C A;  2JZV A;  3G6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...