4NSBA

Crystal structure of the complex of signaling glycoprotein, spb-40 and n-acetyl salicylic acid at 3.05 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of signaling glycoprotein, SPB-40 and N-acetyl salicylic acid at 3.05 A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4nsbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4nsbA01
5CPSA 3L4XA 3A4XA 4Z2GA 3IANA 4ZFMA 2PWEA 3WDHA 2PF0A 1AQHA 3GBEA 4RE2A 1V3HA 1QW9A 2YL6A 1NP2A 3AS1A 1BAGA 3D5HA 1E40A 1FHDA 3VIMA 3WQ8A 4JHZA 1UR2A 1HXJA 4AY1A 3ZT6A 3BXWA 4BF7A 3HMCA 2V3FA 1ZJAA 2GJXB 2XM2A 2XFYA 1UWUA 4NRRA 1P6WA 5DMYA 1DWAM 1Q6GA 4L4OA 5HPOA 1UKPA 2A3EA 1HL9A 2CITA 4WLCA 4QAWA 2ZWYA 3EMZA 2X8RA 4CU6A 3WNPA 2PI6A 4KGJA 4E8CA 4ZEPA 1JYWA 1E15A 4RE4A 1CYGA 1N82A 2D2OA 3VMPA 4K68A 1KBBA 2D0GA 4BQ2A 2VCBA 1CGWA 3BAKA 1H2JA 1UWIA 1H09A 5DF0A 1C92A 4PTXA 1KQZA 2GJPA 3VD5A 5IXEA 1VFFA 3TP4A 5BYWA 1B31A 5I3DA 4A3HA 4Q22A 1AQ0A 1E3XA 3UG4A 3WQWA 1DWIM 4PTWA 1TR1A 1K9TA 3N17A 1QW8A 1XYZA 3CHFA 3CUJA 4P8VA 1E70M 3CLWA 2TAAA 1G5AA 2JIEA 3WDPP 5GNYA 4S3JA 3M7SA 2IXVA 3BSGA 3M07A 4U3CA 1CGTA 5AYIA 2WMIA 1CNVA 2ZX9A 3K4AA 4V2XA 3VPLA 4EE9A 2RGLA 3EYPA 2PB1A 3TOPA 3OG2A 4OKDA 3WQ4A 4MB3A 2D3LA 2UWFA 4CGTA 1UA7A 1JGIA 2J79A 1NWTA 3BMVA 3ALFA 4PSPA 1U30A 2CXGA 2X1IA 1G1YA 2UY5A 1MYRA 5D8ZA 3RMEA 4AIOA 2GK1A 1KR1A 1WNOA 1J9YA 2ZUUA 3VMOA 2QPUA 1M03A 1V0LA 2BY1A 1E56A 5JBEA 6A3HA 3CHCA 1WZKA 2VI0A 2VJXA 4P8UA 5FL0A 2E4TA 1W3HA 5JBDA 1ISWA 1OGSA 3AZSA 2YLAA 1CGUA 1W9UA 1BLIA 2XHYA 2XSBA 4W7UA 3T0BA 4Y7EA 5I6SA 2VR4A 3L2LA 2PC8A 1TVPA 1MW1A 3VTRA 3W82A 3B9AA 1US2A 2JE8A 5C8BB 4ZENA 3WF0A 3CUIA 1J0IA 3N18A 4W84A 2W4XA 2B31A 2VRKA 4AW7A 1W1YA 1E6QM 1AVAA 1JAEA 2VX5A 4KWUA 1W9XA 3BCFA 3CUGA 4F79A 3U5UA 1CXHA 1QVBA 4TUFA 1PX8A 2JF7A 4KMQA 2VL4A 1UR1A 3OLDA 2G3IA 1VEMA 1BVZA 1UWRA 1TUXA 1JF6A 1OM0A 3U5YA 1V0MA 2ZX8A 3POHA 3NYDA 4W7VA 1KGXA 2XPKA 4DUXA 1CWYA 1Z32X 4HZ6A 1RPKA 3OA5A 3WH7A 3VGGA 5ABHA 4RE3A 3GXFA 1QBBA 1ISXA 3T08A 5A6AA 2FHFA 3M6DA 3VIKA 3PZMA 5CSUA 4OUEA 4W5UA 4J3SA 1V03A 2JEQA 4GINA 3ARUA 2G8ZA 1MW0A 2YL8A 5BRPA 1OD0A 2D22A 4MTVA 2J8FA 2WMFA 4MB1A 5A8NA 4TTUA 2YDQA 1M04A 2VMFA 3RDKA 4DUWA 4OZOA 1UD3A 2EPKX 4BQ4A 3BGAA 4AD5A 4CU8A 2G3MA 4W93A 2BS9A 5EB8A 1DWFM 1PBGA 1ODZA 1B3VA 4HPHA 3K8LA 2W91A 2QLYA 2W92A 3WMBA 4JAWA 2WKLA 2E8ZA 3K1DA 1JZ4A 2XGBA 3GDBA 2OWXA 2YL9A 1VJSA 2WMJA 1EHNA 1FHLA 5M5DA 2YDRA 1GVYA 2WZIA 4S3KA 2CERA 1JD7A 5E0CA 5HOSA 4UQDA 1MXDA 2XWEA 4GPNA 7TAAA 2OLHA 4MDPA 2Y4SA 1J18A 4PMDA 4GZJA 3WD4A 5CZKA 2WSPA 4DWSB 2VTFA 3II1A 3ZMRA 2WK2A 2VZVA 2ZOXA 1JZ6A 1UZ4A 4JL1A 1C7TA 1H4PA 3VD3A 5A6LA 1IT0A 1TZ7A 1JYVA 4JZ5A 1EQPA 2DEPA 4JFSA 4MNLA 2D20A 1Q6DA 1VEPA 2QMKA 1V6WA 1VB9A 1JXKA 2G3NA 3EDDA 4M29A 3N15A 1XCWA 2WWDA 2FDMA 1UD6A 3OLEA 3A47A 1E73M 4PTVA 1M01A 4MB5A 5CLTA 4LYQA 3LPGA 5A2CA 4PMUA 1BYAA 3WL1A 3SCTA 5TD4A 1PIFA 3VILA 2JF6A 3AHVA 1C93A 1PEZA 3RM9A 5E6ZA 4ACZA 3AFBA 1E6PA 2NSXA 1XCXA 5JBFA 2QMJA 3KL0A 3W38A 5I2UA 1K9FA 3RJXA 3WH9A 2D0HA 1ZBKA 5A94A 3WUFA 3JUGA 1NARA 1CGXA 2ZUMA 1LWJA 4N42A 5BXTA 4HZ8A 4AEFA 3HU7A 3MUIA 4UFKA 5M03A 2BHUA 3IAPA 2WKGA 3ZJ6A 1OBAA 5AYBA 3AMLA 3VD4A 4HA4A 2WVVA 4UQ9A 4JFUA 1XGZA 1J12A 4TVUA 1UYQA 4J27A 3PZQA 1MWOA 5M3WA 3EMCA 1KGWA 1AQMA 5I24A 3GXIA 4FF5A 4W8BA 2YOCA 3VGHA 2DH3A 4LQ1A 4PEEA 1V0NA 2XUCA 4QLLA 5FD0A 1TG7A 1W3JA 1TMQA 3BAYA 2PWHA 2Z1SA 5BWFA 3PTMA 1HNYA 3AYSA 1OIFA 1WE5A 1ZB5A 4P7OA 2HVMA 1FH8A 1Q6EA 4WSJA 2UY2A 4W85A 1HF6A 2E9BA 3NSXA 3QHMA 7A3HA 3ECQA 4DM2A 4ML4A 4DWSD 3SCRA 4A3YA 3K8KA 3QHNA 1NOUA 3ZSSA 3EBVA 4X9YA 1KXHA 1LL7A 2OYMA 2ESCA 3OLIA 4LPCA 3MU7A 2J8GA 1HJXA 2VRQA 2C0HA 3AYRA 1R86A 4IPNB 3WFLA 1XH2A 3BAJA 3CUFA 2WHLA 5AC5A 1E6NA 4GQQA 1PJ9A 3TTQA 1CLVA 4J3WA 1OSEA 1JI1A 2VURA 2Y8KA 3AHXA 3IK2A 4AYSA 3WN6A 1DEDA 3F5LA 4P7RA 5IFTA 1HJSA 1PX4A 1VFMA 1C90A 3WKZA 2WZHA 3WDIA 1B0IA 1WDSA 3L4VA 3MV01 1TVNA 4CN4A 2VUYA 4L4PA 1PX3A 3F5KA 4PMQA 4J3VA 1HL8A 5BXRA 2PBGA 3BCDA 5A2AA 2YA1A 5JIPA 2VX6A 2WBKA 2HISA 1CTNA 4CVUA 5CJ5A 1GOWA 2ZX7A 2YLLA 3WFZA 4W8AA 1VEOA 4EKJA 5CGTA 1C91A 5C70A 2YL5A 4Z2JA 4FK9A 3VDHA 1W9PA 1GOQA 1X6NA 1JDCA 3N04A 5D8WA 5KZ6A 1JAKA 3WUEA 1HP4A 1W9DM 2W61A 2E9LA 1UD4A 5I0DA 1LG1A 1FP9A 4DWSC 4UFMA 1OIMA 3AHTA 4AXNA 1VJZA 3VM5A 1HKKA 1WZMA 2ZX6A 3WEMA 2VNCA 3VGFA 5I79A 4X0VA 2O9OA 2C8NA 4E4PA 4BS0A 2QPSA 2ZXDA 3UR7A 3POCA 2A3AA 4B15A 1CXKA 4JL2A 1V3MA 4GO8A 4GZIA 3GYCA 4QCEA 6TAAA 4LGXA 1QNPA 2CIPA 4DWSA 3AIEA 4XX6A 4B9ZA 2JFEX 1H11A 3GH4A 3EDFA 5IHRA 1D2KA 3N11A 3TA9A 4C7DA 2BVYA 4W87A 5A6KA 1UWSA 1E4IA 1GOIA 2XYLA 1KWGA 1GW1A 3HN3A 2WMKA 4HP5A 3AIUA 4AZGA 5I5RA 3WD0A 3F4VA 1HKJA 2E0PA 1FFRA 1FA2A 2XVNA 2YKKA 1EO7A 1BQCA 1KFWA 1FH9A 4OOUA 2EPNA 1JF5A 1QOXA 3AJ7A 2NW0A 4PMNA 2DQXA 2BVDA 3RIKA 2WSKA 1GHSA 3SIMA 2EQDA 3VM7A 4M82A 1EA9C 2CYGA 1GONA 5ABFA 2X0HA 1U2YA 1CZ1A 3SCNA 2X0YA 4MADA 3W81A 1DWHM 1XH1A 1ECEA 4Z2HA 4MAZA 3CO4A 2J75A 2FHCA 3VGEA 2O9TA 3NSMA 4U3AA 2WPGA 3KL3A 5A95A 2WANA 2DGAA 1UQZA 1OCQA 3ARXA 2GJRA 3I3BA 2J78A 5CLWA 2XVGA 3T2OA 1O7AA 4D6IA 1O6IA 1IZKA 2DSKA 5HNNA 3SUWA 1ODUA 5BXSA 6CGTA 3BAWA 1NM9A 2D0FA 3VNYA 4WSKA 3O2LA 5DFAA 1W3KA 1TCMA 2WB5A 3L4ZA 4TX8A 1H0IA 5ABFB 3L4YA 4V28A 4CD7A 5A6MA 1UH4A 2CPUA 1V08A 2DDXA 2BHYA 1EXPA 2GVYA 1GJUA 3BLPX 3UEQA 1I75A 3SCPA 4OBRA 4WKHA 2G41A 3OB8A 3MO4A 3WDRA 2XVKA 5HBFA 3WF4A 1EGZA 4NRSA 3CUHA 1QHPA 4D6HA 4P8XA 4B3LA 1SMAA 4E8DA 3T0DA 3PBGA 1JIBA 1EH9A 3WIJA 3PZIA 1WDRA 1H0GA 1ZU8A 4Z2LA 3SCWA 1DTUA 5A69A 3ZT7A 1SR0A 1CXIA 2QF8A 2GFTA 2WVUA 1E6RA 1W91A 3LMYA 4OIFA 3SUSA 4P7NA 4TVDA 2BY3A 3WBEA 3W25A 1KXTA 1QI3A 2JIWA 2CNCA 2J74A 1E71M 3DC0A 2GSJA 2FHBA 3BAXA 4MNMA 1HP5A 5I77A 3VNZA 4J28A 1UR4A 1E0VA 1HKIA 4PN2A 3U7BA 3WF3A 4Q7NA 3IJ9A 4J3UA 4AD1A 1NH6A 4UQCA 1PPIA 2G3JA 2CEQA 1QPKA 3ARSA 5EBAA 2WCAA 2VVSA 4D6DA 4TVCA 1FFQA 5F7UA 4PTMA 4UQEA 1E0WA 3WD3A 3GM8A 3SUVA 3MV11 2DT2A 3ARYA 4D6FA 2X2YA 5LYRA 5ECUA 2A3BA 2EBNA 4MJ4A 3GXDA 1V6VA 3K4DA 1XD1A 3S6TA 3J7HA 5IFPA 4V27A 3AIRA 4AZ7A 2YA2A 2XVPA 4UOZA 2DT0A 3W37A 3CTTA 4HMCA 4UNIA 4EK7A 4U5KA 5DT7A 2XSAA 2WWCA 4D72A 5CPTA 3W27A 1UD2A 1GVIA 1RP8A 3VGDA 4J3XA 4WF7A 2WLYA 3EMQA 3RO8A 3M46A 3VX1A 1CXLA 3QHOA 2VC9A 3OGRA 4H41A 3DYPA 4M81A 2XJ7A 4M24A 2RGMA 1S46A 1GNXA 3NCOA 2VRJA 3SUTA 1E9LA 5ABGA 7CGTA 5EFFA 4BA0A 1GQLA 1NWRA 1MQQA 1UKSA 4AIUA 4QP0A 4M8UA 4B3KA 2O9PA 1PZ3A 1PIGA 1BG4A 2WLZA 2WAGA 1B90A 1KR0A 2QHAA 2WYSA 4GZEA 4H7VA 4MDOA 1GCYA 1JZ3A 2VT0A 3RM8A 4GKLA 1B2YA 3L4WA 3KL5A 9CGTA 3WDJA 3VD9A 2D1ZA 1BPLB 4D6GA 3AIBA 3W6LA 2BXZA 3THCA 4LXFA 3TTYA 5CQ1A 2ZUTA 2EPOA 1Y7VA 1UKQA 2F8QA 4FLSA 2FGZA 3ARPA 3CMJA 1KWKA 4HPGA 1MQPA 2WC3A 2WMGA 3AIWA 3ZR5A 2D3NA 2PWFA 3AOFA 1QI0A 2WVSA 1OWQA 1WAWA 3MANA 5M17A 3ALGA 1H49A 2WMHA 5FL1A 2ZIDA 4MB4A 4CVWA 1U33A 1L8NA 1B3XA 5IHSA 1QHZA 2J7DA 1W1PA 1GQJA 1RP9A 1E43A 3SCUA 1BYBA 3MMWA 3W53A 4QLJA 3VDCA 4EAMA 3QOMA 2BY0A 3TTSA 2CBVA 4RL3A 2XTKA 3CGTA 2CBJA 2EXOA 3KWXA 3MMDA 5JH8A 4MNKA 1QNSA 3B9EA 1KXVA 1XRVA 3VIHA 4CN1A 1K9EA 2ZWZA 4QLKA 2XVLA 3GXMA 3UCQA 4CKQA 4OBSA 2WVVB 3AIVA 1A3HA 3WBAA 3PTKA 4UZSA 1B9ZA 4UFJA 5E6YA 1W3LA 2OWCA 4UR9A 3EDJA 4AD3A 1HVQA 2VQUA 1H5VA 5LA0A 3FY1A 2AMGA 3VIOA 4AMCA 3ZJ8A 2J7HA 1C3FA 1BFNA 5A6BD 1EDGA 1KQYA 2AOSA 4D6CA 3WH8A 1VF8A 3CHEA 1BHGA 1NWUA 2XIBA 1HX0A 5CXPA 3SURA 3BH4A 1XV8A 2WVTA 3GBDA 4PRWA 2NT0A 1W2PA 1SMDA 2VCAA 3T2PA 1BG9A 1WZLA 2ZXAA 2OSWA 1TA3B 1OGBA 4ZXLA 3MSGA 4YN5A 3VU2A 4B9YA 1OD8A 5D9MA 3AS3A 2VZOA 3CZEA 5I23A 5HDRA 1XD0A 4JKKA 3WL0A 4WJXA 1GPFA 4CUCA 4XB3A 2WNWA 1GQKA 2YBUA 2WCGA 3W29A 3FHQA 2VVNA 3ARZA 2BFGA 4GQRA 1KXQA 4N0RA 1EIBA 1Q6FA 1NWSA 2GDVA 2PWGA 4IUGA 3WEZA 4ZE5A 1CXEA 1MW2A 3VD7A 5A8OA 1BYCA 1JFHA 2ZUNA 2XWDA 1XH0A 4HMDA 1W2VA 1TE1A 3AS0A 2UY3A 4FMVA 2YBTA 1J01A 2WW5A 3WMCA 3B9DA 3W6MA 3VGBA 1CIUA 2OWWA 1BGGA 2W66A 1JDDA 2E40A 3WEOA 3OZPA 1J0YA 4UQBA 1FH7A 1LF1A 1UD5A 3CZJA 1H41A 4UOQA 1BVNP 2XFFA 1QNRA 1BF2A 1GOKA 1ZS2A 1W1TA 1WDQA 4HZ7A 4HU8A 3G6MA 1WKYA 1ISYA 2FH6A 3SCOA 1JZ2A 1G01A 1V3KA 3PHAA 3AXIA 1KCKA 1OB0A 3NIYA 3VX0A 2J47A 2PBOA 3RM4A 4NSBA 2A3HA 3PZOA 3ZQ9A 3CZGA 2V38A 3U7VA 2VQTA 3AQUA 2WBGA 4JIEA 5EMYA 5C71A 4F9JA 4KGLA 1LL4A 3WF1A 5FOOA 1VIWA 1LWHA 1XHGA 2ZE0A 4ACYA 2UY4A 3VIPA 1E72M 1H3GA 1JG9A 4PBGA 3ARRA 2ZUWA 5BXPA 4W89A 3QR3A 2OYLA 1E55A 3BLKA 2BNJA 4MNJA 4DM1A 1JL8A 1CGYA 3WMSA 1UA3A 4PMYA 3CZ8A 4GIAA 5E0FA 1WCGA 1JXJA 5CPQA 4P8WA 2CKSA 3ARWA 5E70A 3T09A 3CPUA 2WC7A 2Z1KA 3ZM8A 4D6EA 5AC4A 4IM4A 3I3DA 1QI5A 2JEPA 2W67A 4CCDA 2BV9A 4HU0A 1V3LA 3AZRA 1DWJM 3ZR6A 1MFVA 2Y24A 1EOMA 1W32A 3MKKA 1B3ZA 4JHOA 5FKYA 4QDMA 3B8SA 4UFHA 1E1EA 1J10A 4U2YA 1QBAA 3DYOA 4QCFA 2XM1A 1JZ5A 4E2OA 3CBWA 2DSUA 1UR8A 2XFRA 1WP6A 2CHOA 1KBKA 3AHYA 3DHUA 1WB0A 3WUGA 5CSYA 4ACZB 4PYSA 3NDYA 3MUZ1 3FN9A 3PZGA 1UQYA 2WCSA 1MFUA 4C7GA 3O6AA 3PTQA 3T0AA 1CBGA 4W8LA 4IPLA 4CN6A 3PZVA 3WD2A 3CMGA 2W63A 1UKOA 4FLQA 3ZJKA 3NUKA 3WNOA 1R7AA 4U33A 3AI0A 1LL6A 2J25A 1V6XA 3WNKA 3AISA 4KRTA 1V3JA 4GO9A 4WKFA 3WQVA 1DHKA 1K6AA 1CPUA 3QGVA 2VCCA 1V02A 3G6LA 4CD6A 1MVYA 4QFUA 3AMKA 1UZ1A 3MUAA 3LPPA 4D71A 3MSDA 2WM0A 1UOKA 3CIVA 1W9VA 4M1RA 1OGGA 4PCSA 2DSWA 4AZCA 1J0KA 1RH9A 2Y5EA 4F8XA 1OT1A 2GUYA 4A4AA 2V3GA 2CETA 3O9NA 1HJWA 1EDTA 1GUVA 3WD1A 1QI2A 2J4GA 1UD8A 5CGMA 3VOCA 3ARQA 4OJYA 3A3HA 5GNXA 1ZBWA 3MS8A 3RCNA 2GJXA 1IV8A 1BTCA 3W0KA 2J77A 2OSXA 4H2CA 1LLOA 3BC9A 4PUDA 4HOXA 5A8MA 1R8LA 1BGAA 1VRXA 5DEZA 1OINA 3EDEA 1NOWA 5DO8A 2X05A 1HIZA 4AZ5A 4H8HA 1UKTA 3APGA 3N13A 4JFVA 2WHMA 4CCEA 3CZLA 1C7SA 1VENA 4P7LA 3N9KA 2EJ1A 2J7FA 3SCQA 2J7CA 2EO7A 4MPKA 3AXHA 3PZ9A 1L0PA 1GHRA 1LG2A 5FIPA 4AZHA 3W4RA 1XC6A 2V3DA 3GH7A 2CHNA 4ZE4A 3ZIZA 2VZTA 4GI6A 1G94A 2FGLA 4EANA 2DSVA 1Q6CA 4R27A 2EPLX 1DWGM 4UOJA 1VAHA 4JFWA 3CHDA 2XGIA 3GNRA 1QHOA 3HJEA 3IAQA 3OLGA 3L4UA 1C8XA 1VBUA 1ZL1A 1B1YA 2VX7A 4PMVA 4AZIA 2ZUSA 3GNPA 3VIGA 1I1WA 4JFTA 4LX4A 5IDIA 5GPRA 4CD5A 4U31A 1B3WA 5EFDA 4M80A 3EDKA 1VBRA 3FAXA 3OGVA 1UWQA 4PMOA 3UG3A 1JD9A 4H8VA 1E6ZA 3KZSA 1V6UA 3L4TA 5BCAA 1B30A 3IJ8A 3NSNA 2E8YA 4J3TA 3AMGA 1CXFA 1JDAA 3WY1A 1LJYA 2DT3A 1E6SM 4AZ6A 1M7XA 4PSRA 3ZO9A 1FP8A 1QNQA 3W26A 3L2MA 4AWEA 4W7WA 2GK1B 5A6SA 3DHPA 4UZUA 3AICA 1ISZA 1E6XM 1JFXA 4KRUA 1JNDA 1R87A 3TTOA 3PZTA 2ZXQA 8CGTA 4D6JA 4H8UA 2Y8VA 1JYXA 4F9DA 4FLOA 1HJQA 3BAIA 2YA0A 1E0XA 4PMRA 3WF2A 2GDUA 4GI9A 3GTNA 4HA1A 2VX4A 1C8QA 2FH8A 3I3EA 4AZBA 1XSIA 1E3ZA 1ZBCA 3N12A 4GI8A 1C8YA 3SEPA 3VIJA 1KB3A 4HMEA 4B16A 1GQIA 3BSHA 1WZAA 5HXMA 4XUYA 3PN8A 3WSUA 1EDQA 3WNMA 1CENA 1G9HA 1SYTA 3AS2A 2DIEA 2JALA 2J62A 4XZBA 4YPJA 3VIFA 1E4MM 4CD4A 1YHTA 3RILA 2W5FA 1ITXA 4PCTA 4TTGA 3AMDA 1J0HA 3VUPA 1J11A 4ATDA 3UETA 2J7BA 4ATLA 2IXUA 2QV4A 4M56A 4PMZA 1JNEA 2YDSA 4H04A 1A47A 1WDPA 5LA1A 3S2CA 2BXYA 3CZKA 3VO0A 1EQCA 3KEHA 3U57A 1E5JA 3UG5A 1XSKA 3FNDA 3QOKA 4JCLA 4CCCA 3CH9A 4WKAA 3WNNA 3VVGA 1CGVA 4UCFA 4HTYA 4AIEA 3OGSA 2AAAA 5GQBA 2D23A 1B3YA 1VFOA 2CCRA 2EPMX 3NDZA 1JZ8A 1V6YA 3VMNA 4TOQA 2J7GA 4W88A 5A8QA 4AEEA 3AMCA 4OOZA 2VZUA 2F2HA 4JCMA 5CG0A 1V3IA 1RD6A 2V5DA 4UFIA 1ESWA 4Z2KA 1XYFA 2VO5A 4D1JA 2YIHA 4BQ3A 1EHAA 1ZJBA 2A3CA 4NF7A 3ZT5A 1GOMA 3WH5A 3AIQA 2BVTA 3FAWA 2WMIB 2XG9A 5FCZA 3VDAA 4Z2IA 3KE0A 3MMUA 1V02E 4BCEA 1MXGA 5A6JA 1E4NA 2W62A 4TXEA 1HJUA 2IUZA 3VIIA 4DUVA 2WC4A 4MJ2A 1H1NA 1HT6A 1OT2A 3VDBA 3ZOAA 1EO5A 3GNOA 5HPCA 3ARVA 1QNOA 1R7OA 5A2BA 3WELA 3RPMA 3UERA 3TONA 4LYRA 5D9PA 2YJQA 4KH2A 4LYPA 3ZJ7A 4XZWA 1TA3A 1CLXA 3PZNA 2Q8XA 1FOBA 1SFSA 2C7FA 2DPEA 4HA3A 4GXPA 5GNZA 1GOOA 2VOTA 4W86A 4YHGA 1WO2A 1G0CA 3WH6A 2CESA 1JI2A 3WDQA 2DH2A 4C7FA 2DSZA 1BYDA 3WUBA 1KGUA 2VZSA 5E09A 3SCVA 5D9OA 3RJYA 2WZEA 1X1NA 2EEXA 2V3EA 4AD4A 3D3AA 1XSJA 4R5EA 2G4FA 2F61A 2CBUA 3VKKA 1CECA 4AZCB 1K9DA 3DYMA 3FHAA 4IISA 2D24A 3WQ6A 1TFVA 1NP0A 3MUY1 4CU7A 1UR0A 1IZJA 3N1AA 2ZUVA 5A8PA 3WNLA 5ABEA 1PZ2A 1D3CA 1YQ2A 2VR5A 4AC1X 5KEZA 2V5CA 5BROA 2X09A 5BRQA 1KCLA 3SUUA 1JYNA 1UH2A 2ZX5A 4ATWA 8A3HA 4NZCA 1NQ6A 2PWDA 3A6OA 3AXXA 1UG6A 1M53A 4UQAA 3UR8A 4AD0A 4X0NA 4J7RA 3AZTA 4ZXOA 1MQRA 5E9AA 2DT1A 1CEOA 4BZYA 1ZBVA 2OSYA 3F5JA 4U5IA 4P7QA 3K46A 2MANA 4WK9A 4PMXA 3IJ7A 4D1IA 1HKMA 1F4HA 2CKRA 3LPFA 3GH5A 3SCSA 2BHZA 3W24A 1LQ0A 4AISA 1UH3A 3OIHA 4JKMA 4CD8A 3WQ5A 4F66A 1PAMA 3FXYA 3K8MA 3WENA 2WXDM 4HOWA 4W5ZA 1VFUA 4YHEA 1WPCA 4AD2A 3VINA 1BSIA 1DP0A 3AROA 1UWTA 3T2QA 3FW6A 2J7EA 1R85A 5JUVA 2Y2WA 1W1VA 3LPOA 1F4AA 5D9NA 1V0KA 4URIA 1AMYA 3THDA 1X6LA 2CBIA 1E5NA 1I1XA 2WHJA 4FLRA 1J0JA 4UTFA 1J0ZA 1MW3A 3OZOA 2XIIA 3E1F1 3A4WA 5AY7A 4U2ZA 2NT1A 3OBAA 5A1AA 4BQ5A 3ARTA 1JZ7A 1UHVA 1CDGA 1GZJA 1UR9A 5A6BA 4MAVA 3GZAA 4HOZA 2WHKA 5A3HA 2ZXBA 4NI3A 4TX6A 5I78A 4WIWA 3NJ3A 1US3A 4UFLA 1D7FA 4XV0A 2BY2A 2OYKA 2E3ZA 3ZSTA 4JKLA 1EOKA 1Q4NX 2DIJA 1HVXA 1E1FA 3AHZA 1GORA 1E4LA 3PZUA 1UUQA 1GJWA 3UESA 1HN1A 2ZICA 5D4YA 5DT5A 2O92A 1HJVA 4PUEA 1QI4A 1ISVA 1ITCA 1W9BM 3BMWA 3DECA 3A4AA 1NOFA 3W28A 5JIWA 2O9RA 5LA2A 2E9MA
chains in the Genus database with same CATH superfamily
5CPSA 3L4XA 1PINA 2CXEA 4AHPA 2GQ9A 1BQGA 4ZFMA 5CZJA 5CZSA 2PWEA 1EJUC 4DRNA 1BF6A 5CJNA 1U79A 4JYSA 2AL1A 1UJPA 4QISA 2YL6A 1US0A 4CQ8A 3CO8A 3WLIA 3D5HA 3CT2A 1FAPA 3U9IA 5CC3A 1R3RA 3O1NA 3ZT6A 1LT8A 3HMCA 1RQEA 1ITQA 1F2JA 1ZJAA 4JN7A 3PBMA 4UC5A 4NRRA 1P6WA 5DMYA 1DWAM 1Q6GA 1GVQA 2CITA 1HL9A 4INFA 4WLCA 1XC4A 4QAWA 2X8RA 4YL2A 1EJRC 1ZCOA 3B8VA 4C6MA 3BURA 3RPDA 4KCTA 5HWMA 4BQ2A 3PAJA 3O5JA 1CGWA 3EB4A 2PFHA 2NX1A 1BWLA 3LD5A 4NAFA 2E6FA 3ABSA 3TNBA 3VD5A 1MZHA 3TP4A 2ZRXA 1KD0A 5H6HA 2PRHA 3SJNA 4PTWA 1TR1A 2BBFA 3NOEA 3CUJA 1YE4A 1RLDA 1E70M 1Q7QA 3CLWA 3ABOA 2TAAA 3W75A 2JIEA 3WDPP 4IMEA 3KCEA 1MDRA 3M07A 4IOTA 1CNVA 4UWMA 2A4AA 4GD0A 4G2PA 2PDQA 3WQEA 5AHNA 2IPFA 4KRZA 3VPLA 3MB9A 3EYPA 5C7VA 4BKNA 3OG2A 4JY8A 2F2DA 2IKIA 4G9PA 2J79A 4WDUA 3O5FA 4U28A 4OFCA 4TIMA 2QUTA 4F2UA 1MYRA 2Y85A 4XZLX 5AVHA 1F73A 3NO1A 2KR7A 1PUDA 1IEXA 3CHCA 1XM3A 2POZA 5I3GA 1OG0A 2XP7A 1OGSA 4ADSA 1S2UA 1GZGA 1S5NA 3VOJA 3WLRA 1CGUA 1EEXA 1W9UA 4WCJA 1OYCA 5I6SA 2VR4A 1FKWA 3B9AA 3QGKC 4ZENA 3O5KA 3CUIA 1J0IA 1E6QM 2OEKA 1VCFA 4KWUA 3RU8X 4F79A 1JPMA 1QVBA 5A5WA 2JF7A 3M4HA 4XBKA 1VFSA 1WKDA 4MIMA 4HNOA 3OLDA 3UNDA 3H8AA 3RNDA 1VEMA 4FX7A 3T6CA 5IRPA 4K1GA 4B5SA 4W7VA 5JMUA 3DFNA 4DUXA 1J4RA 5TBOA 1CWYA 4ZOCA 5HJLA 3FJNA 3TSDA 4ZSTA 3VGGA 2IF4A 2Z2UA 2IKHA 1L9WA 4ICMA 1B57A 3VIKA 2WNQA 4W5UA 4J3SA 1Q6OA 1V03A 4NAFB 3ARUA 3R6IA 2DUZA 1POKA 2YL8A 2IS7A 1BKSA 1K7EA 3I10A 1RA5A 5HNRA 3IEBA 4DUWA 2VDIA 4IXHA 3W7CA 2EPKX 2ODOA 3BGAA 4AD5A 4GMEA 1UASA 4UMAA 4ZB0A 1AK5A 3NQ6A 1KM4A 5EB8A 4H7CA 1QDSA 1PBGA 3BSMA 3R5EA 1B3VA 2W91A 4XO6A 2OLSA 1XDLA 3WMBA 3NEVA 1Y5WA 7REQA 3EX4A 2HK1A 3GDBA 2OWXA 1VJSA 1EHNA 2H9AA 5M5DA 1Q5MA 5D09A 1GVYA 2WZIA 4IQLA 4ROQA 4HNTA 1MXDA 2XWEA 4DT4A 3I7RA 7TAAA 4PMDA 3WD4A 4ZQNA 2WSPA 1XUUA 4DWSB 1KRAC 1XISA 4K38A 4GH3A 2PGRA 2WK2A 1M41A 2ZOXA 4PR4A 1UZ4A 3UNTA 4Q6XA 1JZ6A 4Q8UA 5A6LA 3TWAA 1H62A 1ZJHA 1JYVA 4HPXA 4JZ5A 4Z1CA 4K1WA 3O5MA 4MNLA 2D20A 1VEPA 2QMKA 3W2LA 3GTFA 4M5PA 1VB9A 1JXKA 2VHLA 3N15A 1XCWA 1WXJA 2QJIA 4IIGA 3B9OA 1SO6A 3WO8A 3PANA 2WWDA 3OLEA 3A47A 4C6LA 3SN4A 4PTVA 3VAVA 4LYQA 1KBJA 1PIIA 1KLZA 2DW6A 3VOFA 1Z69A 4B5WA 1EFZA 2TMDA 4PMUA 3SB0A 3WL1A 3SCTA 3W3OA 1O68A 1PIFA 2YZ5A 1PEZA 3T40A 1XLHA 3AFBA 4Y6GA 1XCXA 3A3XA 5EMKA 4AH7A 1NJJA 1ZUAX 4HSNA 1NARA 2ZUMA 4LAOA 1LWJA 3R1ZA 4JFJA 4QIUA 1GVOA 3SW6A 3HU7A 2X16A 3R0DA 3BLIA 3IAPA 2WKGA 2ETNA 1OBAA 4B92A 3T0CA 1VR6A 1Q2RA 3T4CA 3UBPC 1J12A 2VM8A 1CT5A 3PZQA 5M3WA 2BGSA 2EPHA 3H26A 3IUHA 3B4UA 4FF5A 5AHIA 3N34A 4JFMA 2J8TA 2E7FA 4IFRA 1Q6HA 1GQNA 5AOUA 3OBKA 2Z1VA 3W7QA 1V6TA 5F2IA 2ZZ5A 2QCGA 3JW7A 1V0NA 2XUCA 3ITGA 1IXNA 1DBTA 5FD0A 4NU7A 1FWBC 2PWHA 2HS8A 2HROA 3HMJG 3PTMA 3NQEA 2PGEA 3E2VA 2FDSA 2V5BA 5KMYA 1Q6EA 3OZMA 4GJ1A 4IMFA 2V81A 3NZGA 2NQ9A 4ML4A 5CC5A 2ABBA 3LNPA 5AYZA 2OGJA 4A3YA 3TC3A 2DP3A 3LXAA 3QHNA 1NOUA 2X7VA 3RN6A 3FDKA 3RLVA 4GCAA 2ESCA 1FWFC 3BGJA 3OLIA 5ENLA 3VKDA 3MU7A 1HJXA 4ZBCA 1FKTA 2C0HA 2QAFA 1A50A 3KFTA 3ABQA 5C9XA 5EYWA 3CWHA 2H8XA 3M0KA 3CUZA 3MDYB 1E6NA 3W1RA 1PJ9A 3TTQA 1Z48A 2FVLA 4L3NA 3IK2A 3M9YA 4BEQA 1DEDA 5FESA 3PBYA 1QOPA 4IFKA 1K77A 1EJSC 2ZZ7A 3GG7A 3WDIA 4O4VA 2I5GA 1WDSA 3RXZA 2KX9A 1XBZA 1TVNA 3EXTA 3M0HA 4J4OA 2HXUA 1G69A 1VBHA 4J3VA 3O0KA 3E6EA 1HGYA 3VNDA 4UTIA 5BW6A 5A2AA 3KADA 3HPZA 5HWJA 3GYEA 3N29A 2WBKA 3VUSA 4CVUA 3R25A 3QFEA 2Z7KA 4DZHA 1VEOA 3EGJA 3VC6A 3GU2A 3GIYA 3QH2A 5GVJA 1H50A 3RAOA 1EC8A 3N04A 5D8WA 2VD8A 4OQVA 2J9ZA 1HP4A 4YXGA 1CX9A 1S38A 1W9DM 4QQ3A 3PC0A 1UD4A 2C1HA 1FP9A 2V8ZA 4DWSC 2OTDA 3AHTA 3M0LA 1HKKA 3DG3A 4X0VA 2QGHA 2QPSA 3PAOA 3UR7A 3L65A 2A3AA 5LXEA 3NQDA 2OB3A 6PTDA 4US5A 4W4QA 3TJ4A 4JL2A 2MNRA 4DJFC 4H8NA 2YGYA 4MWAE 4XX6A 3EDFA 3TA9A 3V0UA 3CAWA 2W0UA 2TODA 5DRCA 1GW1A 3HN3A 1S2AA 1RQHA 2WMKA 3AIUA 4AZGA 4DF0A 5I5RA 1XR2A 2E0PA 3PK7A 1FA2A 2YKKA 2HXTA 1PDZA 4HCDA 4M7SA 2EPNA 4FNRA 4IP4A 4XBSA 4ALDA 5BNKA 3RIKA 2WSKA 2EQDA 4GZ7A 4M82A 3WQPA 2EULA 2X0HA 3LCLA 3QPYA 1CZ1A 4N4PA 2OX4A 4WX2A 1U1HA 5CC6A 4JFKA 3W81A 1XH1A 2YW3A 4ORIA 1A0DA 3DXIA 4NXSA 1EKOA 3CO4A 2J75A 3D46A 3VGEA 3B05A 4RPQA 5A95A 2DGAA 4A05A 4R34A 3ARXA 3A9BA 4DJDD 5CLWA 3W7JA 4XTDA 2A3LA 1O7AA 3EKLA 2PRMA 1O6IA 2DSKA 5HNNA 4Q7IA 4GVIA 3SADA 3CYJA 3BWWA 1DXIA 4YVXA 6CGTA 2D0FA 3VNYA 4XZIA 5DFAA 1XLGA 2CW6A 3VZZA 4OT7A 4IT6A 3ODKA 5EMUA 3BQ6A 2CPUA 4HPNA 4EXQA 2BHYA 3T8QA 1EXPA 1GJUA 2QKFA 1XKYA 3OB8A 3DX5A 5FACA 3U4FA 3WDRA 4PCNA 2C1GA 2XVKA 5HBFA 3VZXA 4JIHA 4P8XA 4B3LA 3PUDA 1JIBA 4YCPA 2GGIA 4UR7A 1EH9A 3WIJA 3SSJA 4Z2LA 2UV8G 5A69A 1WOAA 4J3ZA 3GK0A 3LG3A 3ANVA 1CXIA 2QF8A 5DCEA 3UF8A 1F3XA 3TAKA 1F7BA 4L6DA 4OIFA 3OHMB 3RGCA 2GUBA 3EEGA 3QLLA 3WBEA 3FEMA 4S2BA 2ZVIA 3ME3A 5G5IA 3BAXA 1TV5A 3C3NA 4RXFA 1TJPA 1QJWA 3U7BA 3JS3A 1NVMA 2G4JA 2QJHA 1PHWA 3IV3A 5FA5A 4IHCA 2CEQA 3S1XA 1KBLA 4YMZA 3VNKA 3NI6A 3UG8A 3KOXA 2VD9A 4QT3A 5HW8A 4Z1AA 3MCNA 1E0WA 3SUVA 2DT2A 1K7XA 3ARYA 2G0WA 2NWSA 4DJFA 2EBNA 4QDWA 1L6SA 1XDJA 5FEPA 1V6VA 2DZVA 4JEJA 1TPB1 4LB3A 2GGHA 3ZYZA 5BOOA 2DT0A 4HN4A 3CTTA 3GX9A 1ZP4A 1F74A 4D72A 4O13A 5CPTA 1GEQA 1N8WA 2JKPA 3BMBA 2FFIA 4K8GA 5EMLA 4LF1A 1OABA 2EF9A 3DENA 2ZZ6A 3M46A 4DYKA 3OGRA 4H41A 5E9XA 2XJ7A 1A5SA 2P5NA 3W7PA 3KS5A 3SUTA 3R8GA 4XKYB 3GHSA 3W87A 1E9LA 5ABGA 4BA0A 1NWRA 1MQQA 1H60A 4HARA 4IIDA 4M8UA 1VPXA 1B90A 1T8XA 2QHAA 2V5KA 2VT0A 1QPOA 4ORMA 1B2YA 4AHQA 3UW6A 4BEUA 3NGFA 4HGXA 4YWIA 4NAEA 3AUJA 4GXWA 3RPTA 3H23A 5D38A 2ZUTA 3C4UA 5BU6A 2EPOA 2RDTA 4AC7C 3FJ4A 2FGZA 1U1UA 4H9ZA 2WMGA 3L66A 3EX2A 3ZR5A 2PWFA 1H7NA 3AOFA 4UTTA 1ZFJA 1A5NC 4TV5A 4Y96A 1H49A 2VEGA 2ZRZA 4DO7A 4MB4A 1L8NA 5IHSA 2J7DA 1NSGA 1OX4B 4TQTA 3SGGA 3O6DA 1LDCA 4XAKA 4QLJA 3M5XA 4IMCA 3CL7A 3O15A 4HD5A 4IQEA 1EP1A 2QDEA 4F0MA 5AHLA 2EXOA 5JH8A 4WXZA 5G4HC 4MNKA 1QNSA 3TC7A 5JVLA 1XRVA 3VIHA 1K9EA 2GWNA 4IQJA 1YX1A 4QLKA 3MWAA 1KO0A 1CB2A 1RVGA 3I6RA 1KA9F 4LBRA 1B9ZA 1HL2A 1W3LA 3COTA 3EDJA 1HVQA 2OT1A 2VQUA 5LA0A 3ZJ8A 3BOXA 3V3WA 1KCZA 3DN5A 5A6BD 1FWIC 4D6CA 3NL3A 4KEMA 3UA4A 4LEQA 1KM5A 3EXRA 2XIQA 1VHCA 3GBDA 2FTWA 2IPJA 1A0CA 2PDPA 1VFTA 2HEJA 5AHEA 3MYPA 1TQXA 2OSWA 5B80A 3P62A 1HFBA 2GGEA 2OELA 4ZXLA 1W5OA 3O8AA 2QUMA 1OD8A 2Q8ZA 2VZOA 3TW7A 5I23A 4O28A 3CNYA 2E25A 3K1GA 4JQ4A 4QT2A 4IUOA 4H4IA 4HB7A 1GQKA 2YBUA 3S8HA 3FHQA 2Y7GA 2VVNA 4HCHA 4Y9OA 3I68A 1KXQA 1R46A 5BXJA 1YEYA 2GDVA 4WY0F 1NMVA 1CXEA 1VP5A 5DMNA 2XWDA 1XH0A 5FF4A 3NQAA 1N1AA 4L72B 2R1LA 1L6WA 3AS0A 2B0MA 4GJIA 3TAOA 3WMCA 2DZTA 3B9DA 2YCKX 3PUGA 3AAMA 4A3UA 5DIVA 2W66A 3WEOA 4DH0A 1TCDA 3C61A 3CZJA 1XDMA 1UUOA 1Q6LA 1BVNP 1C9HA 1QNRA 4HSOA 3CAQA 3VKAA 2PDGA 4HZ7A 4HU8A 3G6MA 1WKYA 1ISYA 2G95A 1XLEA 4QR6A 3E0WA 1G01A 3T55A 2JGQA 4RNHA 5C9RA 3VX0A 3LK6A 2AQOA 4MWAB 2X41A 3V75A 3H9RB 4NSBA 3PZOA 3PB0A 3H70A 4ZTXA 2R9RA 2VQTA 4JIEA 4DBEA 5C5YA 3EWWA 1LL4A 5FSEC 1U5VA 2C16A 1LWHA 4N9EA 3NXFA 1H3GA 4PBGA 4LNYA 1W8GA 3W02A 3CXOA 1E55A 4CNUA 2UZ5A 3VABA 4HBKA 2BNJA 5U7SA 4N6EA 4UTLA 3QW4B 4MJMA 3U48A 3W7KA 1VIZA 4PMYA 4RJEA 4GIAA 4MSPA 4P8WA 1W1B1 2CKSA 3ARWA 1F6KA 2PZNA 3MP3A 5E70A 2QAPA 3CV7A 1P0NA 2Z1KA 1VPQA 1VBJA 4MSSA 3I3DA 2W67A 4HU0A 3FVMA 2A79A 4PB5A 4AY7A 2Y24A 5FKYA 1QFEA 4P2VA 4GACA 4UFHA 1J10A 1SO4A 4U2YA 4WVXA 3HG4A 3DYOA 4GK8A 4QCFA 3MMTA 4AYGA 4H9YA 3ABXA 4R85A 3Q67A 3UPMA 2DSUA 2NUWA 2DVUA 4I9AA 3I4KA 2MLYA 3TKFA 1FDZA 4PYSA 2L2SA 3QBUA 1E51A 2DU2A 4JQ2A 2WCSA 1S39A 4C7GA 3O6AA 4JTEA 3TNOA 2ZZ2A 3EWDA 2PLCA 3PR9A 1GKRA 4LRSA 3R4IA 2KO7A 2OZ8A 3DFHA 4DPQA 4OE7A 1GVEA 3CMGA 1S5TA 2W63A 1TJ0A 5AZ0A 3WNOA 1KRBC 1S1PA 2V63A 4MHBA 3EPNA 3H2NA 4QEEA 1PYFA 1FWCC 4C6KA 4E38A 1TWZA 1SW0A 3WQVA 5LGXA 2XP5A 1I2PA 1QNVA 1W54A 5GJMA 2VCCA 1V02A 2VGFA 3W1PA 1UZ1A 3LPPA 4ZOBA 4D71A 3WMLA 4XAZA 5EBUA 3W7LA 1OGGA 4PCSA 2DSWA 3WQCA 4A22A 3OHIA 3C2OA 4AF0B 1RH9A 3H4WA 3E2QA 4LUSB 8TIMA 2CETA 3CL8A 4JNMA 4ERGA 3STFA 2NXHA 2XPAA 3TN6A 4FHAA 4H3DA 4FI4A 3LZ3A 1EYEA 3ARQA 1JQXA 5GNXA 5CG7A 1IV8A 4O54A 3IRDA 5C9UA 9RUBA 4H2CA 4MWAC 2HDJA 1R8LA 4YTQA 5DRIA 2O4MA 1NOWA 5DO8A 2V5LA 3IIOA 4H8HA 3T8LA 2KGJA 3N13A 4LVGA 1NDZA 4HKPA 1XFCA 3CZLA 4XTIA 4DEFA 2WJZA 2EJ1A 1TJ2A 4IGNA 4LY4A 4MPKA 3AXHA 1M7OA 3PZ9A 4FALA 3L9CA 2YXOA 4ZB5A 3W4RA 3GH7A 4OV9A 2E77A 4R27A 3SRFA 1JDEA 5AB3A 3CHDA 4GYPC 1QHOA 2FZMA 3OLGA 1C8XA 1ZL1A 2YCLB 1B1YA 3JZEA 3GNPA 3PUOA 4GNJA 4O1AA 1XP3A 1EUNA 1MEHA 4LX4A 4W9PA 5EFDA 4GIYA 3VDGA 4TO8A 3EDKA 1VBRA 4I8YA 1JD9A 3BV7A 1E6ZA 3MP5A 3L5LA 4QJ4B 3KZSA 1V6UA 4JGDA 2PSNA 4ODNA 1QO5A 2E8YA 1CXFA 3ID7A 5HNTA 4AZ6A 3TYUA 1GK8A 4N19A 2E1WA 4DZIA 4L6OA 1GTHA 1QNQA 1DQUA 4W7WA 1ISZA 4H6RA 4LANA 1JFXA 2PA6A 3PZTA 1HZYA 5J5DA 1JYXA 3H2FA 1DXEA 3WF2A 1D9EA 4HA1A 1Q45A 1TPDA 3LRMA 4ITZA 2NUYA 4PUKA 1ZBCA 2PLKA 3OOBA 3OA3A 1IGWA 4ADTA 3HG3A 2XN1A 3N73A 1HTIA 2M2AA 2RUQA 3WSUA 1UROA 3IK8A 3QF0A 1WV2A 2JALA 4MWAD 2J62A 4YPJA 3STPA 4FOJA 2GZXA 1E4MM 4CD4A 3RILA 1ITXA 3BUVA 1JRCA 3S1UA 3AMDA 1DJWA 4L1XA 5LSMA 1J11A 3M0VA 4RW3A 1KM0A 1PWMA 2VEPA 2IXUA 4XAGA 4M56A 1A47A 4LS0A 4KFNA 2PS2A 3TXZA 1LT7A 3U57A 1E5JA 3UG5A 3FNDA 1AFSA 3E12A 3NZQA 5C55A 2OQYA 2YPIA 3VCCA 2AAAA 4UTUA 2OZ0A 5EKYA 5HMEA 4C6IA 2OFJA 2G5WA 4Z08A 3WQFA 5DY3A 3VMNA 1QU4A 4H9UA 2J7GA 3M16A 4GNVA 4QNEA 2QCHA 2F2HA 3M5YA 1NIUA 4UFIA 3Q65A 4UTJA 2UZ9A 4X60A 4AHOA 1XYFA 1LLZA 1NU5A 3R13A 3PG9A 5G4EA 1XL9A 1AG1O 3TQKA 5FCZA 1C9WA 5LIKX 1V02E 1MXGA 5HWBA 3RX2A 1RSCA 4XVEA 2PPGA 1HJUA 3W00A 3KAHA 3MHUA 2XGZA 2WC4A 3R12A 2FVMA 2PV3A 4DLFA 3RX4A 4HN8A 3URBA 1WKFA 4Q4QA 3TONA 1YNQA 1AODA 5G1YA 4LYPA 3TFCA 4QAIA 4XZWA 3ZLGA 5HQEA 2NV1A 1TA3A 3L2IA 4PGLA 1CLXA 2Q8XA 4L7ZA 4GY0A 2Z26A 3CTLA 2DPEA 4HA3A 5GNZA 1Z9AA 6REQA 1LRQA 4GYPA 4KEVA 3M5ZA 4ODMA 3ZWTA 1C9DA 2JBMA 4FNUA 3O0FA 3BLOA 1JI2A 1AL8A 1FWHC 4G8TA 3WDQA 4LAKA 3L12A 1N2VA 4N02A 4QSHA 1Z42A 1WDDA 3AYVA 3P82A 2AKMA 4ZVJA 4C7FA 3QRHA 2XP3A 2OZTA 3H24A 4EF8A 4QJ1A 5D9OA 2ZRYA 4GFIA 2WZEA 1X1NA 1Q8JA 4AD4A 1QPLA 4DRJA 7ENLA 4Y2WA 1T99A 4IISA 4WOZA 4LVFA 3PPCA 3DH7A 4UUIA 1NP0A 3MUY1 4V33A 3N14A 4WDTA 5HW6A 2PTXA 4YLWA 4F40A 3N1AA 2ZUVA 5AZ1A 4AXKA 4F0LA 2ACQA 3KBJA 1YQ2A 3WJYA 3E0LA 4JX6A 4AWUA 4XAFA 5G1TA 1EJVC 3B8UA 2X09A 5BRQA 4XVDA 1NFGA 4X61A 2AQVA 3SUUA 4ZQCA 1NQ6A 2PWDA 1K1DA 3UR8A 4AD0A 4X0NA 2Z6JA 4J7RA 3C0LA 5E9AA 1DJGA 1ZBVA 2C91A 3F5JA 1HKWA 1JUBA 3ES8A 1GTEA 2WSQA 4DO5A 2CLHA 2HNHA 1U83A 2ZZ1A 4C6DA 1P4CA 1RJPA 1G7UA 3SCSA 8XIMA 4GYJA 1YXYA 1UH3A 5AHFA 2OQLA 3GTHA 1QPFA 3R94A 4US5D 4CNSA 1PAMA 3FXYA 3K8MA 3G1YA 4U10A 4W5ZA 1OK4A 1YDNA 2RQSA 3WLJA 1X8FA 4E4UA 4AD2A 2RH9A 5FJUA 4WEVX 2D2HA 5KZMA 3MVIA 2D2GA 2J7EA 2YB4A 1FQ0A 4RE0A 2Y2WA 4GGBA 3O7UA 1KFCA 1VLIA 5DBUA 1JCTA 1AMYA 3LGDA 3KVMA 2ZR5A 4FLRA 2WHJA 2CLEA 4ZZ9A 5K4XA 1MW3A 3V1HA 4ASTA 2XIIA 4HNUA 4G7FA 3WLHA 3OBAA 3QSTA 3LN3A 4JN6A 1B6CA 2FPTA 1CDGA 1X38A 3I7QA 2PDCA 3GDKA 4HOZA 3WK2A 2I14A 3NM1A 4M0XA 3GFYA 3LBCA 4HZMA 2ZXBA 5I78A 4GX9A 1HW6A 4XAYA 2XP9A 1L2UA 4UXDA 3G1AA 2OYKA 4QX4A 4Q8TA 1NFBA 1Q4NX 3TFXA 4NNCA 2WSYA 3KTCA 3ONBA 4IH3A 1GJWA 1HN1A 4ZPTR 4DJDA 3LHUA 5B7ZA 1ALDA 3ICJA 4HTBA 4NAEB 1ISVA 1FUYA 1W9BM 1LOQA 1ZJIA 1NOFA 3APYA 5PTDA 2PODA 3CM4A 3BK0A 1SJBA 4Y8EA 4Z2GA 2MLZA 3IANA 4B5NA 4NJIA 1H5YA 2Q6ZA 1L1PA 3GBEA 2B7QA 3LCGA 3DFSA 3UR5A 1QW9A 1LCOA 4F0SA 1W37A 5HATA 1CI1A 3AS1A 1BAGA 3HG2A 1E40A 3TVAA 3VIMA 2NX3A 4D8AA 3CGNA 3IARA 4BF7A 2V3FA 2GJXB 1UWUA 3EMZA 5HMFA 3WNPA 2PI6A 4ZEPA 1JYWA 4GUJA 1N82A 2D2OA 5FF3A 2Z28A 3VMPA 4EPKA 4FX6M 2D0GA 2VCBA 4MUPA 3G0SA 4Z17A 2YB1A 3O16A 4DPPA 3U6WA 1H2JA 1UWIA 5IBXC 5DF0A 1KQZA 3FYOA 2PMQA 2VC5A 4A3HA 4Q22A 2H3DA 1AQ0A 1E3XA 5E93A 2X7WA 3C86A 3UG4A 2NQZA 3RR4A 4CCZA 1K8YA 3N4AA 4U86A 1QW8A 3CHFA 1EPVA 3F03K 2ZTJA 3GPKA 2IXVA 1G4SA 1OQFA 3KWSA 4G56A 4RV8A 2HSAA 2C71A 4GUGA 1CGTA 3W1NA 1PYMA 2VGBA 1X98A 2ZX9A 1OF6A 3K4AA 1XPGA 2RHGA 2QF7A 4V2XA 2PGWA 3SM0A 2PTDA 4OKDA 3UZJA 2WJFA 1NWTA 5J04A 1S5WA 3GWQA 2UY5A 4CQAA 4AIOA 3RMEA 2ZDSA 1JPKA 1P7TB 4O1EA 2DUAA 2Z24A 5G1MA 3VMOA 1M03A 4BHYA 2D69A 5I07A 1E56A 1XPYA 1AA1B 1VFHA 2E4TA 1ISWA 3AZSA 4H9XA 1OEPA 2XHYA 2XSBA 3IGHX 1DVJA 4W7UA 3T0BA 2Y7DA 4KS0A 2PC8A 1AW2A 1MW1A 3VTRA 5D2VA 4PUJA 2B31A 1W1YA 4CQ9A 1AVAA 1JAEA 2VX5A 3LV6A 4FNSA 4J1OA 4IPPA 2PBCA 4TUFA 3S5SA 1KTCA 4H00A 5HW7A 1DYSA 1UR1A 1K4HA 2OPJA 2X1TA 4LS1A 4LJ3A 3IKDA 1OM0A 3NQGA 3U5YA 3UGVA 4R53A 2ZX8A 3POHA 4LEFA 1KGXA 2XPKA 3CQKA 3QV7A 3WQOA 1Q85A 3LV5A 1K70A 3NTPA 2NVAA 4YTUA 1JVWA 1GJPA 3DHDA 3CV1A 5ABHA 4K8HA 3T08A 5A6AA 3R8RA 3C56A 2Z27A 3AXMA 1J6OA 2JEQA 4XISA 3HV9A 3RCMA 2GGGA 1OD0A 2J8FA 1UCWA 3HV8A 1A5OC 4GHRA 4TTUA 2PPNA 4UMCA 2VMFA 3RDKA 4H9TA 4CU8A 2G3MA 3EOLA 1I45A 1Q66A 1J4EA 3TCEA 3K13A 4DZ5A 1XRTA 3GIQA 4W93A 1EX5A 2DZWA 1XKJA 1DWFM 1ODZA 4HPHA 3K8LA 2QLYA 2W92A 5FJJA 3MJMA 3MC5A 1KLYA 2P3EA 2E8ZA 3K1DA 1H51A 1JZ4A 2XGBA 2WMJA 2VN1A 1FHLA 2YDRA 2CERA 4UQDA 4GPNA 3CIWA 4MDPA 1J79A 1TWIA 1SPQA 1XRFA 4GZJA 1O95A 1ZP3A 3II1A 1NAL1 1QAPA 1PTAA 5JH2A 1TZ7A 2R6OA 2PN0A 1EQPA 4NILA 4O12A 1V6WA 3T81A 4P5UA 1V4YA 2PC4A 2X2GA 3EWUA 5DLCA 3LCWA 1XX1A 3HA1A 1TTPA 4MB5A 2ZTKA 3GUWA 1JUKA 3PPFA 5I3JA 5A2CA 3JVAA 3QTGA 4TX9A 3LEPA 1M7PA 5TD4A 3XINA 4A21A 1RA0A 3VILA 3GR7A 1TTQA 1C93A 5E6ZA 1UPPA 1XLBA 2NSXA 4CQCA 5JBFA 2DG3A 3KL0A 1DOSA 1GVFA 2BGQA 2QXWA 2D0HA 1FWAC 1SVDA 1ZBKA 3QMSA 5LNUA 2PDUA 3RRXA 4H1ZA 1OFDA 4HZ8A 4AEFA 1D6OA 2BHUA 3MW7A 1A53A 3ZJ6A 3OU8A 5AYBA 1TRDA 1A4LA 2KE0A 4LUYA 1AL7A 1TPFA 6ALDA 1XGZA 1MWOA 1A5AA 3UY8A 3N2CA 3IJIA 1JCNA 3OIXA 4JPGA 4MPQA 2YOCA 3L0NA 2DH3A 3N19B 5LGZA 3B8DA 3NA8A 3CQJA 3LHZA 1I0DA 3NURA 4LUJA 4PEEA 3N9RA 3TW6A 4LS2A 3E74A 1TMQA 4A6GA 5BWFA 4DNHA 1WE5A 1XQLA 1W0MA 3AJXA 3KZ7A 2UY2A 1HQTA 3PNZA 1HF6A 3OBEA 3QHMA 1LBLA 7A3HA 3ECQA 3T0TA 2ZQVA 4N9DA 3IACA 3PWIA 3A12A 3ZSSA 1LL7A 4UTWC 5JXQA 1FKJA 4PL1A 3MCOA 2VRQA 4D8LA 4IPNB 4Q4RA 2R94A 3WFLA 1W5MA 1V7AA 1Q6UA 3CUFA 1QR7A 4GQQA 3ZVIA 1SJAA 1JI1A 2ZC1A 2VURA 1Q8AA 4AYSA 3TN3A 3TCZA 5XIMA 1R3TA 1V5XA 3GTIA 4KF1A 3UA3A 2PLJA 3DFQA 1FX6A 3MV01 1RLCL 2VYOA 3C2VA 4L4PA 1PX3A 1EL3A 2NXIA 3DFTA 3E5BA 2Q01A 4JTAA 4TW7A 1UOZA 3ES7A 4IPJA 5JIPA 3KBMA 2HISA 5CJ5A 3KP1A 4FXJA 4E0CA 1AH3A 1H7WA 4W8AA 6XIAA 3P81A 3C0QA 1LROA 2DJLA 3KOYA 2YL5A 2TPSA 3EB3A 3VDHA 3BJTA 1XXXA 1M65A 1DJNA 1A5CA 1DIEA 1UWAA 2V67A 3M6YA 3EX3A 4NNBA 2G96A 2PTYA 1K4GA 1OIMA 3VM5A 1WZMA 3WEMA 2VNCA 2O9OA 3FCPA 1XYMA 4C1NB 1DV7A 4UTTC 5C0QA 3RX3A 2Y62A 1V3MA 4GO8A 3GYCA 1R3WA 6TAAA 3UU0A 1QNPA 2CIPA 3G1SA 4DWSA 4GYKA 1J4IA 2VEKA 4PULA 5F4SA 4B9ZA 2JFEX 3BZJA 2FQIA 3N11A 4W87A 3LTYA 1UWSA 3K5XA 3LU2A 5TNVA 1HKJA 5HMDA 3DAQA 3TYCA 3VKBA 4RNIA 1BQCA 2QEZA 2ZR6A 1JF5A 3R43A 4QDPA 4PMNA 3DBNA 1SU5A 4TNSA 4K2SA 3PULA 4ML9A 1GHSA 1DIOA 3GAYA 3LGEA 1YTKA 4R88A 4Q4KA 1KM6A 3SCNA 2X0YA 1DWHM 2KFWA 3QC0A 2WNNA 2FHCA 1A49A 2O9TA 5TQLA 2WANA 4NZ3A 1UQZA 4L6HA 2DZPA 1MI3A 1OCQA 4D8ZA 4YCOA 2NUXA 3APTA 3QC3A 3LQLA 3LSCA 1SJCA 3T2OA 3GR8A 3FA3A 2V2CA 4OTKA 4Q8MA 3PY2A 1OF8A 1ODUA 4Y9MA 4EXAA 5BXSA 1FWTA 3BAWA 1NM9A 2QPXA 1KM1A 4WSKA 4QG6A 2E67A 5CPOA 1TCMA 2WB5A 3S0CA 1VS1A 3L4YA 1W5QA 2IW0A 3VAWA 2NQLA 3GXTA 5EMMA 1UH4A 3DBPA 4LVAA 3NQCA 5F2MA 3M0MA 4MFDA 2IMRA 1J8VA 4F0RA 2GVYA 1D8WA 3UEQA 5ECVA 4OBRA 2G41A 4O50A 2FZ9A 4CQBA 3T7VA 2QNEA 4E5TA 3R7MA 3PZIA 1GYNA 3SCWA 3E3HA 1H7XA 4GVFA 4D9PA 5AC6A 1SR0A 3H7UA 2GFTA 4O15A 1E6RA 1W91A 1T40A 1R9ZA 4C6NA 3E02A 4C1LA 3W25A 1ZHAA 4A2SA 1BRLA 1QI3A 3DC0A 2GSJA 4FOUA 4XG1A 4YIWA 2FHBA 4HK6A 1HP5A 5I77A 4F2BA 3VNZA 1HO4A 1VQTA 4MY1A 5KITA 1E0VA 5REQB 5KZDA 5IBXA 2HVOA 4J3UA 4AD1A 1NH6A 4UQCA 1PPIA 2P76A 1WQ5A 4JQAA 3ARSA 4S23A 5EBAA 2F7FA 1XLCA 2VVSA 2MNTA 2ZA1A 4D6DA 4TVCA 1FFQA 1P0BA 4PODA 3RCYA 4DJDC 1LZOA 4UQEA 3THUA 3MV11 3MSYA 1R3SA 4S3GA 1X97A 4ZPVR 4OBTA 3GXDA 3LXCA 1XD1A 2VDGA 1O4UA 3J7HA 4UOZA 1TELA 3OVRA 4UNIA 4EK7A 5DT7A 4NJHA 3IWPA 1UD2A 3TJLA 4H6EA 3G2GA 4J3XA 3ZS4A 1DJIA 4ODOA 2W79A 1KTBA 4I6VA 3S2NA 3EX6A 4JTQA 1FXQA 4BR1A 2VC9A 3W7GA 4M81A 4M24A 2RGMA 1S46A 5CBIA 2ZR4A 2ZC8A 3S9IA 2Z00A 1VYPX 7CGTA 4NJGA 1P0DA 1GQLA 1UKSA 1P0KA 2ZQTA 1XW8A 2VEMA 3EA2A 4B3KA 2O9PA 1PZ3A 1PIGA 1KR0A 3SGZA 2WYSA 3UWWA 3RGTA 5I03A 1TO3A 3FKRA 3RM8A 3NQ7A 5HJYA 3L4WA 4WGXA 3KL5A 2NWRA 3N4FA 2IQDA 1BPLB 4EP8C 1YIXA 3THCA 3AC0A 3TZNA 2Y7EA 3R58A 1DQXA 4Y90A 1S3TC 3TQVA 3CQ0A 3ARPA 1KWKA 3EA1A 2Z2AA 4HPGA 4O57A 3LRKA 1NDVA 3AIWA 2DG9A 3W1LA 2HCVA 3WLMA 2WVSA 1XIIA 1OWQA 4Y9PA 3MANA 2Y8UA 2OG9A 4JY9A 3OVPA 3PNUA 5FL1A 3P60A 1W1PA 1FKKA 3O6CA 2LLEA 1E43A 3FIGA 3SCUA 1BYBA 2P1FA 4YWSA 2ANUA 4L9XA 4EAMA 4UTHA 3W23A 1R30A 2ON3A 4AX7A 2HWGA 2CBVA 1FKDA 3CGTA 3MMDA 1QMLA 2RJHA 2ZWZA 2XVLA 5HJXA 3PTKA 4UZSA 2MPHA 5E6YA 2V9DA 4DLMA 3BL3A 5RUBA 3F4NA 3OQ8A 4BK9A 3BW3A 1SW7A 4PTNA 2ALRA 2FGBA 1BFNA 2Z29A 3RMJA 4RDYA 2AOSA 4A8RA 3NPXA 3KBNA 1VF8A 3CHEA 4YTRA 5D02A 1LWIA 1TTIA 1NWUA 1W3TA 3DGBA 3I4EA 2XIBA 3RLUA 1HX0A 5CXPA 3SURA 1TRIA 1XV8A 4CEUC 2GQ3A 4IF2A 2NT0A 3IVTA 4NZ5A 3G8RA 1SMDA 1IIHA 4I9MA 2ZZ4A 1O94A 2QIWA 3BOFA 4R7JA 4NJKA 1EPXA 3FJ6A 3LCXA 1WZLA 3MO7A 1TA3B 5AYXA 4BJHA 3LTSA 1PCWA 4O10A 4YN5A 1IF2A 4AG0A 2XSXA 3ANUA 4B9YA 3CZEA 4NZ4A 1XD0A 2H90A 2WJDA 4JKKA 4IX0A 3WL0A 1YMYA 3GNDA 1POJA 4LVBA 1XICA 1SUXA 4EPBC 4PB3A 3CK5A 3TWBA 3FVDA 3XIMA 4K37A 4G50A 4LYKA 3F2DA 1EIBA 1NWSA 3GAKA 4QZVB 3OYZA 3WEZA 4ZE5A 1Y5XA 2E09A 2V5JA 4O2TA 4OU1A 4M6QA 1TE1A 2UY3A 1ZAIA 4MG4A 1J01A 3FA4A 3P93A 2WW5A 4H9VA 2E1DA 2QJGA 4NX5A 5D75A 4GVGA 2ZA3A 2A0NA 4C6EA 4UIOA 1XBVA 1P48A 2RKXA 3MPGA 4NASA 2E40A 1DJXA 4X2PA 1NDWA 1ZTVA 1EEPA 1H41A 4MKSA 2KI3A 3MQTA 1ZS2A 3IIXA 3C52A 1FKXA 2A7NA 2XIJA 4JFLA 4EXBA 1JZ2A 3AXIA 2NQ5A 3BG3A 1OB0A 3NVTA 2QT3A 3IGSA 2J47A 2NVCA 5M1TA 4C5YA 4ZO7A 3RM4A 2V38A 3W22A 2VGGA 3U7VA 1WYIA 2OLAA 1WX0A 3R11A 4PH6A 5C71A 3WF1A 5FOOA 2GOKA 1KV8A 2UY4A 3PSWA 2Q3RA 1EWEA 1GKPA 4FAPA 1ZAJA 1EJ7L 3T9PA 4MNJA 4DM1A 1JL8A 1CGYA 4LRTA 3WMSA 5HULA 2ZRVA 2Y7FA 1T96A 5E0FA 3NQMA 5CPQA 1VC4A 1RPXA 3UWYA 1HXVA 3ANYA 2HBXA 1RR2A 3NNTA 4KCVA 3JU2A 3ZM8A 1XG3A 4L56A 4D6EA 4IM4A 1WKEA 2BV9A 3W1TA 4ES4A 3AZRA 2O7SA 3NAVA 1DWJM 3MUXA 2W6RA 3KVJA 4RDWA 1B3ZA 2I7GA 4FB7A 1QRQA 3B8SA 3LOTA 1E1EA 2ZFAA 5AVNA 1V8EA 2XM1A 4G7EA 1JZ5A 4PE8A 4E2OA 3D6NA 3EKZA 2SFPA 2XFRA 1WP6A 2VFDA 1PSCA 2RFGA 3B4YA 3B9NA 2CHOA 3AHYA 2QDHA 4YYCA 5J6EA 4M19A 3WUGA 3D47A 3NDYA 4GGHA 3MUZ1 5DY2A 3FN9A 3PZGA 4GABA 4W9OA 1UQYA 1AD1A 3S5OA 3NFUA 1H7RA 1ADDA 3CHVA 4W8LA 4DO6A 1TJ1A 4E4FA 4H6QA 1VPYA 1UKOA 4FLQA 1IWBA 1R7AA 3HQOA 5I00A 1GYLA 3EX1A 3LHVA 3WNKA 3O5PA 1TVLA 3RLGA 4WKFA 2I5QA 2F2KA 5AYYA 4Q7BA 3VI2A 4CD6A 1MVYA 3GU9A 3FEQA 3KHDA 4QFUA 2Q09A 2WM0A 4R7OA 1UOKA 3CIVA 1FKSA 4HNVA 1B5TA 4L5ZA 4E3TA 1PWLA 3RUBL 4CNTA 3W70A 4A4AA 1OJXA 5AC7A 3GLCA 1EDTA 3WD1A 1FWEC 2EG6A 4JEQA 2J4GA 3GVRA 3QPZA 3W2KA 4Q8VA 1REQA 3G1VA 4KCWA 3VOCA 1ECQA 3A3HA 1MXSA 4Z0SA 3HOJA 3BG9A 1ZBWA 4R9XA 3MS8A 3RCNA 2FB3A 1OG6A 2OSXA 3E0FA 2P88A 2BODX 1LLOA 1BGAA 4M3PA 5DEZA 3EDEA 3TC5A 4I7WA 5CGQA 5I09A 2X05A 3P61A 4O8RA 4LAVA 1IT8A 1QWKA 2IPGA 3B0UX 3P6LA 4IPXA 3HG5A 3KXQA 4AF0A 4I9JA 3N9KA 3SCQA 3UCCA 4Q8WA 1TV4A 2EO7A 4GC3A 4ZFCA 4E2BA 3NZRA 4LSBA 5H2ZA 3USZA 1YADA 1L0PA 1GHRA 4DIPA 1LG2A 5FF7A 2XFWA 5FIPA 2CLLA 1X96A 1XC6A 3ZIZA 2VZTA 4GI6A 1G94A 1QUMA 3EOEA 3OYXA 1S2VA 2DSVA 1PV8A 2EPLX 1DWGM 1VCGA 3TE9A 4UOJA 1RVKA 1VAHA 1XIGA 1EC9A 2INEA 2F4EA 3NZ1A 2DW7A 4GRSA 4L4MA 4JTIA 1GT8A 3BPWA 4HNLA 4JDYA 2CLKA 2P0IA 2YCIX 3E2RA 4J4KA 5I98A 2ZUSA 3VFCA 3B40A 1EB3A 1BRLB 4JFTA 1BSLA 5IDIA 5GPRA 1B3WA 3W71A 3M41A 1IWPA 2E5DA 4XBJA 4PMOA 4H8VA 2F21A 2GVLA 5I06A 3L4TA 5BCAA 4NIRA 2J6XA 1LJYA 2DT3A 1M7XA 3UP8A 5EY5A 1VFLA 1FP8A 3VYLA 4QG9A 5HMSA 3OTRA 3W26A 3IRSA 1OVDA 4LCRA 1WUFA 3N6HA 5A6SA 3AICA 3C2RA 4CLMA 4KRUA 3CWNA 1JNDA 4H8UA 1LOSA 3H21A 4F9DA 2I5IA 3GO2A 4Z1DA 4CNOA 2ONEA 3VOIA 1FTXA 1C8QA 1E3ZA 3G5EA 4Q3MA 4C6BA 4XZMX 4DQWA 3BV4A 3W7EA 5HXMA 1JPIA 3NG3A 3V5FA 3WNMA 1G9HA 2E28A 1SYTA 1JRBA 3STCA 2WNZA 2A6LA 3LS9A 4JIRA 1JR1A 1DE6A 1X1OA 2YZRA 4XSLA 3NO3A 1QK0A 3BVJA 1UJQA 3IPWA 4QITA 4C65A 5CEWA 2QS8A 3UETA 3KX6A 3OZYA 1BWVA 1LP6A 2QV4A 4MZYA 1JNEA 3VC5A 4A35A 1SQ7A 3S2CA 4XD4A 3VO0A 5CZ0A 4JX4A 4C6JA 3TLLA 2DUXA 2PCEA 3VXGA 1M5YA 4JCLA 3HGJA 4WKAA 3VVGA 4HTYA 3TC6A 1WBJA 4GE8A 1BEUA 2FZBA 5GQBA 2D23A 1B3YA 1KFBA 1I2RA 5FAJA 3NDZA 3UVIA 4IG2A 5BWAA 3RG6A 1I9CB 2VOMA 1Q4WA 2HK0A 4F48A 2VZUA 3FYPA 1V3IA 1A5MC 3G0UA 3BCJA 2UBPC 3MI2A 4QNWA 4ROPA 1BKFA 1OZQA 2Z4GA 3WFAA 2FFCA 2E6DA 2XU2A 3OVGA 4JTTA 4D1JA 4TX0A 4BQ3A 1ZJBA 4FXFA 3QZ6A 3EOUA 4DJED 1GOMA 2BVTA 3FAWA 1V79A 4WRHA 2XPBA 2PURA 1UB3A 2WMIB 4Z2IA 1EP2A 5A6JA 1WAUA 3MDWA 4TXEA 3T05A 3G0XA 4DUVA 4Q4SA 4MJ2A 2GSEA 5LZLA 5A2BA 3RPMA 1XCFA 3E9AA 3UERA 4RCXA 2F23A 3E2SA 3MZ2A 3P0XA 1MRQA 4A3QA 4JNZA 4LAMA 1FOBA 4ADUA 1P0EA 1YRRA 2C7FA 1F5ZA 4OHQA 4NVTA 4JN8A 4GXPA 4KIRA 2B7NA 2GVJA 4YHGA 2R24A 3P80A 4C6PA 1D7HA 5TAOA 1G0CA 3B0XA 3HPFA 2CESA 1EZWA 2R1MA 3GW0A 4RX0A 3NPWA 1MSSA 4M6PA 1UPMB 3S2LA 1WBHA 3EOSA 3GU0A 1KGUA 3TYZA 3LHWA 3LXBA 1OCBA 2QUVA 4DO4A 3UZXA 2GSHA 2G4FA 2F61A 1XJBA 1CECA 3IVUA 5T9CE 2JQXA 3DYMA 3FHAA 1YXCA 4QS6A 1WXZA 5LNSA 1DJZA 2D9FA 5CBBA 1IZJA 5LHFA 2KZHA 4OUIA 3ABRA 3C2YA 1ZENA 2DZUA 5F1UA 3SAZA 1OX4A 1D3CA 2FKPA 3L0GA 5BROA 1KCLA 4NZCA 3A6OA 3AXXA 2PDFA 1M7JA 1UG6A 1ZNNA 3A5FA 3PBUA 3NL5A 4UQAA 4ZXOA 2DT1A 1CEOA 2QCDB 5GJPA 3EPMA 1KFKA 3SO7A 2OSYA 4I7VA 3ZZ1A 3CPRA 3PRAA 3K46A 4NQ1A 3JR2A 3CQIA 4XWUA 5D2TA 1XWYA 1FWWA 5DMMA 4D1IA 2R1KA 3NQFA 2PWUA 4B5UA 4J9JA 2CKRA 3LPFA 3WLNA 1TPWA 4LT9A 4UMBA 3W24A 1RUSA 3EY6A 2CZ5A 4CD8A 1Z6KA 3WQ5A 4QJ5B 3TN5A 2PGFA 4LAWA 3WENA 2WXDM 1IX5A 3O5QA 4LUTA 1ZPTA 1WPCA 2FPYA 1PTDA 3CMFA 3H4XA 4GYFA 4RUBA 3FW6A 3GRIA 1FCUA 4DELA 3GU1A 3LA4A 2PPPA 5D9NA 3UD6A 2CBIA 3FS2A 3U2OA 4LW7A 3E1F1 1PTGA 3LY0A 5KSWA 4U2ZA 2A6NA 4X3ZA 4O17A 4KETA 1JDFA 1UHVA 2R8WA 4GY1A 4PTDA 3FDGA 3INPA 3UXKA 4NI3A 5JQ9A 3UYIA 1Z41A 1D7FA 1LTDA 3CB8A 2XZ9A 2BY2A 2DZXA 4JKLA 1HVXA 3AHZA 2OOFA 3OJGA 3JRKA 1AD4A 4B4FA 4L9ZA 1FRBA 2C18A 3SI9A 3WX7A 4LC8A 1XIMA 1LM1A 3WCZA 3GUGA 2O92A 4MWAA 4HU4A 4PUEA 1QI4A 1ITCA 4CNNA 2REQB 3W28A 2O9RA 3A4XA 1BWKA 3VOHA 3WDHA 3GG8A 1W3IA 1J5TA 1KTNA 4TMCA 4GCXA 4FIQA 1EYWA 3V4BA 4RE2A 4LB4A 1YKWA 4QGCA 1E1CA 4LUIA 1NP2A 3WBXA 1THFD 4JHZA 1HXJA 4AY1A 3GTXA 2NXGA 2YCEA 1TUFA 3B8WA 3A13A 4S3BA 2XM2A 2XFYA 4FP1A 1F8AB 1UIPA 4L4OA 5HPOA 1UKPA 4J2MA 2QCCA 4GJJA 4E8CA 4KGJA 2OXNA 1E15A 5K9DA 1TWSA 1QT1A 4RE4A 1CYGA 5H91A 5F1VA 2XP6A 4E6MA 2Z1BA 3BAKA 2PE4A 2YFNA 3DKLA 4PTXA 3MTWA 2AKZA 2GJPA 3T44A 5IXEA 1MEWA 1VFFA 3PRBA 2X42A 1B31A 2GOUA 3M43A 2O55A 3NDOA 1K9TA 3N17A 2JKEA 1XYZA 3SR7A 3B97A 3U2CA 5GNYA 4S3JA 1IE7C 2YFOA 3BSGA 3HGSA 4U3CA 3LTPA 3KDOA 2DORA 3WLPA 3PVFA 1OFOA 3WBYA 5LIYX 4ZOEA 2RGLA 2PB1A 3TOPA 3WQ4A 2D3LA 1JGIA 2GDQA 3UXAA 4YS1A 3BMVA 1ZRQA 3LI1A 3Q37A 1U30A 2CXGA 4M51A 2X1IA 2HMCA 5D8ZA 1OZMA 2GK1A 2VEFA 1YPIA 2VFEA 1J9YA 1UMYA 3R79A 1VLWA 3R0KA 2AQWA 3IUIA 6A3HA 4POCA 4MGVA 4ZGYA 3G1XA 3F2CA 2I17A 2VI0A 2VJXA 3TV8A 3P67A 4YYFA 1ONXA 3UJSA 1MUMA 4DHGA 1W3HA 5JBDA 4HSHA 3EPOA 1BLIA 2EGZA 5FEWA 4BI7A 3L2LA 1TVPA 1FCQA 2JE8A 1US2A 5C8BB 3WF0A 3N18A 4W84A 2W4XA 4AW7A 4FX8A 1ZALA 4JBRA 3UZYA 1W9XA 1F61A 4RKAA 3OO2A 3U5UA 1CXHA 3LM3A 4LTSA 1FKGA 1YDVA 3P5YA 3T07A 1PX8A 5CSRA 4G6CA 4KMQA 4J40A 4I90A 4WXYA 2NLIA 1AW5A 3OP2A 5I3HA 3P2VA 1QATA 1UWRA 3B7XA 1JF6A 1TUXA 4JTGA 3BGGA 3O63A 4E2VA 1V0MA 2Y0FA 1VRDA 1HKVA 3EWZA 3PJWA 3ABZA 2FAPA 3WK1A 5LIWX 1Q1CA 1FD9A 1F07A 3WLSA 3QEZA 4C6CA 3WH7A 2OU4A 1QBBA 3BJSA 1ISXA 2J24A 2Y61A 2ZQ0A 2FHFA 2PP0A 1FHUA 1KKOA 4P61A 3SZ8A 4C5ZA 1T5AA 3ATYA 5CSUA 3PZMA 4X2RA 1NFPA 1JPDX 2G8ZA 2LGOA 1T6MA 4UTMA 3KVLA 2WMFA 4DVOA 4MB1A 4UR8A 5A8NA 1M04A 1UD3A 4BQ4A 2NV2A 5K3VA 7TIMA 4RV3A 2BS9A 3H12A 1RHCA 1XIHA 3NWRA 4V1YA 4N9CA 3OODA 1P5BA 4GISA 4JAWA 3TOYA 5D32A 2DG4A 1E1CB 1FHVA 1X7FA 2ZDRA 4S3KA 3LNMA 1JCXA 1JD7A 5E0CA 4UBPC 2VUNA 1TMLA 3W2MA 1ME7A 1OC6A 2Y4SA 3G1FA 1QPRA 3UWVA 5CZKA 4IFKB 2PDKA 2AL2A 2VTFA 3ZMRA 4C1KA 1SZRA 4GBDA 1XBYA 1C7TA 1H4PA 2RJGA 1UC4A 4EPEC 4JFSA 4Q8QA 4O8AA 2GVEA 4IT4A 4M29A 4S3CA 1DKWA 5CPNA 4H19A 2VFGA 1JCJA 1R2TA 1O60A 2FDMA 1UD6A 3IK4A 3RLHA 4DYEA 4GA8A 5CLTA 1ICPA 4NXKA 2H3BA 4RPPA 3M5VA 4LV9A 3BLEA 1BYAA 1XYBA 5DN1A 3IIPA 3I7SA 4IIFA 2ZCGA 3FYYA 2JF6A 3AHVA 3NQ8A 3CWOX 1P43A 3RM9A 1NTHA 2PTZA 1PKYA 1E6PA 2QMJA 4AVNA 3AXKA 3WH9A 3W7OA 3SN1A 5A94A 3JXVA 2QJJA 1KT0A 1GYMA 3D3FA 3MUIA 4JTKA 5T8GA 4IMDA 3S5NA 1KFLA 3SY8A 2HVNA 3AMLA 2NV9A 3VD4A 4HA4A 2WVVA 4GLEA 5I02A 2CLOA 4YU1A 1UYQA 4IGHA 3EWBX 4KWWA 3EMCA 1KGWA 2FLIA 4GQBA 3O5DA 5I24A 3GXIA 1RAKA 3M47A 3WJXA 3G1HA 4XIAA 4G1NA 1EJXC 3VGHA 4LQ1A 3RITA 3RHGA 4DF2A 3EOOA 2G3FA 2RDXA 4QLLA 1TG7A 4R3UA 3UY7A 5D30A 1W3JA 1Z89A 3E49A 2Z1SA 4R33A 5HWCA 3AWOA 3AYSA 1ZQ5A 4P7OA 5K7JA 5HUAA 4REQA 5DANA 1W8SA 1YW1A 3PR2A 1VGAA 3PPHA 3FXGA 4W85A 3NSXA 5CC7A 1OFEA 3WLTA 4O16A 4DWSD 2I57A 1E9ZB 5BRBA 3K8KA 3VNLA 2C14A 3R10A 1PZ1A 4L65A 3UQIA 1RBOB 3Q2DA 1KXHA 2OYMA 3W76A 2YXGA 4OECA 3QR1A 3ITXA 4LPCA 4WUIA 3NM3A 3P3BA 4MKVA 1W1ZA 2IQTA 1DPMA 2QUUA 3A22A 1SFLA 5EA9A 2RAGA 2ZRUA 3WZ0E 3BAJA 4UDMA 4E2DA 1Q3NA 1G4PA 1M3UA 3EIPA 1CLVA 4J3WA 9XIMA 4UTWA 3E96A 1FKLA 1LRNA 4ZL1A 3F5LA 4L9YA 4P7RA 2ACRA 1TMHA 1PKMA 2CLIA 1HJSA 1V51A 1KC7A 1C90A 3WKZA 2WZHA 1Q6RA 5M2FX 1B0IA 4V1XA 3DOPA 1ICSA 3V0TA 2ZA2A 2F6KA 2WM1A 2A2IA 4NX0A 3QKZA 3QW3A 2JZVA 4PMQA 1HL8A 3BCDA 3NEHA 3NTYA 2W9MA 4IMAA 2YA1A 4YTSA 2OT0A 3OVQA 3UR2A 1CTNA 2E6YA 1GOWA 3GHUA 3WG6A 2ZX7A 3C2EA 3R2GA 2YLLA 2FB2A 3WFZA 3P7YA 5JH1A 4ODKA 1TZZA 4L1WA 3GFXA 2XH2A 1PVNA 3HM7A 3LHTA 2XIOA 4Z2JA 4HHHA 4FK9A 1ML1A 3LM7A 2I16A 1GOQA 2QDGA 1R3YA 3W85A 1JDCA 3DFYA 4A8LA 3REQB 3V1PA 1KRMA 5KZ6A 2W61A 2E9LA 2HPMA 3UCDA 4EF9A 1LG1A 1XUZA 3TQ0A 1OYBA 2I9UA 4UFMA 3S2MA 1XYLA 4WGHA 4AXNA 4HK7A 4MY9A 3SN0A 3VGFA 4LH8A 2C8NA 4EOUA 3L67A 2ZXDA 4QE5A 3KCLA 1CXKA 4IG2B 3VE7A 3ITTA 4S3AA 3R8HA 2WQPA 4QCEA 3ZXWA 4IXXA 3IS4A 4R9OA 4LBUA 2ZKMX 1XIBA 2DZSA 2ZZ3A 2C6QA 5A8GA 1H11A 1W5NA 1D2KA 1ROTA 3GKAA 5A6KA 5H8MA 3B8TA 4FOKA 5FJRA 1TQJA 1KWGA 5K9XA 3DFPA 4JHMA 1RBAA 1R38A 2PPOA 1G6CA 2XVNA 5LNRA 1EO7A 1PZ0A 1KFWA 4DAIA 1QPQA 2ATMA 2Y5SA 2NW0A 3H2AA 3E5PA 2BVDA 1O1HA 4LCQA 3A4JA 1A80A 3SIMA 5EGRA 3JYJA 2CYGA 2NX9A 5C7HA 1P6CA 1GONA 1LOLA 3MJYA 5ABFA 2FTYA 4JTRA 4IICA 2ABAA 1U2YA 4I5RA 3ITOA 1F9CA 3GD6A 2C79A 4MADA 3SRDA 2DQWA 2ZQUA 4K3ZA 4IIBA 4MAZA 3FGCB 4JQ1A 2RUDA 1KBIA 1B4EA 4IP7A 3LZ5A 4DF1A 2WPGA 3KL3A 1O12A 1YPFA 3KBSA 3BOLA 3MZNA 4PFMA 4O4WA 1VCVA 2CWXA 2WV8A 4DRHA 3NVDA 3I3BA 3JZUA 5KETA 2WSRA 2V6AA 1KT1A 3A23A 1QK2A 5DXXA 3M0ZA 5HUPA 3GY1A 3ITLA 5DX7A 1FWSA 1J2BA 3O2LA 4O1FA 3L4ZA 1OHLA 5ABFB 3DGRA 5MF5A 2CLMA 5C2GA 1RJQA 1QCWA 4V28A 5A6MA 2ACUA 1OFBA 3GIPA 2FKEA 2DDXA 5DITA 3GXPA 3BLPX 3S42A 4WDXA 4XUGA 3SCPA 3UT0A 4FAMA 4HYRA 1S2CA 3TQPA 4MGGA 3MO4A 1EGZA 4D6HA 4HHLA 3TJIA 3WLLA 2BOEX 3PBGA 3QSRA 1H1ZA 4WQ6A 1H0GA 3GR4A 1DTUA 2X1SA 3M0JA 3ZT7A 1MEIA 2EKCA 2VENA 2RUCA 4DXVA 2HPIA 2X0SA 2WVUA 1FWGC 3KRZA 4P7NA 2J27A 3OOQA 2AGTA 2JIWA 1E71M 5EL1A 2O56A 2YCLA 1SZEA 4QE1A 1UR4A 1HKIA 1C8VA 3IJ9A 3VNIA 2G3JA 3K30A 5U4NA 2PV1A 1QPKA 1LUCA 3H6OA 3G3MA 5G2IA 3FK4A 1FKRA 2ZVRA 4PTMA 3O05A 3WD3A 3QZAA 4S2CA 1DJYA 4GX8A 2GL5A 2PDYA 4D6FA 1UP0A 5D2YA 1OK6A 2A3BA 1U5JA 3HB9A 1PHQA 3FV9A 4MJ4A 3H4GA 4MKNA 2LJ4A 2DV0A 3K4DA 1VH7A 3S6TA 3PJTA 5AFDA 4JQ3A 5KTLA 3D0CA 4B5TA 5IFPA 3AIRA 2QW5A 2XVPA 1D7KA 7REQB 3W37A 4JD4A 4XO7A 3HURA 4RZ6A 4U5KA 2WWCA 3W27A 1TJRA 1SFJA 1RP8A 1TWWA 4Q4PA 4GUIA 1O5QA 3G3DA 4WF7A 2EG8A 1ZGDA 3KRBA 3O3RA 4B90A 3TTEA 4PUWA 2WLYA 5CJMA 3EMQA 4DRSA 2XN0A 4D2JA 1CXLA 2PEVA 1IEWA 3NCOA 2VRJA 4DWDA 2QQ6A 5EFFA 5BU9A