4NSBA

Crystal structure of the complex of signaling glycoprotein, spb-40 and n-acetyl salicylic acid at 3.05 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of signaling glycoprotein, SPB-40 and N-acetyl salicylic acid at 3.05 A resolution
rcsb
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4nsbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4nsbA01
4YHGA 5AYBA 3WDPP 3HJEA 4ZXOA 4ZE4A 3A4AA 3WQ5A 4C7DA 4MB1A 1FFRA 3IANA 3UESA 4N0RA 1UD5A 4P7NA 2VRKA 5CG0A 3BLPX 4PMQA 1EQPA 1GONA 2C8NA 2ZE0A 4AEFA 1U30A 3KE0A 4M80A 4BQ5A 4GZEA 4HOZA 1RP9A 2QF8A 1M04A 5EB8A 3FNDA 4U3CA 1P6WA 3WDJA 5ABGA 1KGXA 2G41A 1UWQA 2JFEX 1UD6A 4D6IA 4NZCA 1US2A 1PEZA 5GNZA 4AZ7A 1WDPA 1ZL1A 4GKLA 4JFUA 4W8AA 4D1JA 4MB4A 2VQUA 3RDKA 5C70A 1UR0A 1VEPA 3CZLA 5BROA 1JGIA 3RIKA 3IAQA 3SIMA 2XM2A 4U5IA 1NWUA 2ZWYA 1CZ1A 3K8MA 5DMYA 3O9NA 1F4AA 1ZBVA 5E09A 2VX4A 4Q22A 3W53A 2J8GA 1V6YA 2G3IA 4ATWA 1B3XA 2VZTA 4PMZA 2E0PA 3ZJKA 2CYGA 4AD5A 4CU6A 4IM4A 1JAKA 3N04A 4JKMA 1LG1A 1LL7A 3VD9A 4UR9A 5JBDA 2XIBA 1KB3A 3WDRA 3MANA 1QVBA 4LYQA 1KFWA 2BXYA 5HXMA 1EO5A 3D3AA 1NOUA 3F5JA 1BVNP 1GCYA 2D22A 1JD7A 1BAGA 3CIVA 3BAWA 1CDGA 2XYLA 3VM7A 3W82A 2VR4A 4B3KA 4MTVA 1QNPA 3W29A 5JBEA 5FOOA 4UQCA 3ARSA 1E71M 2YL8A 4HZ7A 5I24A 2DSUA 1DWJM 4MJ4A 4ATLA 4U5KA 3VGDA 2G8ZA 5ABHA 5LYRA 1WP6A 4DWSA 1DTUA 4WSJA 2WPGA 1E70M 5I2UA 1HKJA 2WWCA 2YDSA 2OYMA 1JFHA 2J25A 5BRPA 2J7DA 2WC7A 3SCUA 2VX7A 3GM8A 4N42A 2VZVA 1BG9A 4AIOA 3WY1A 2ZUUA 5A6SA 2WZHA 1ISZA 1CGYA 1UWSA 2F8QA 3U57A 2JIEA 5IFPA 1UZ1A 5D9NA 3II1A 3SCNA 4WSKA 5LA1A 1XH0A 5HPOA 1NARA 1A3HA 3AMGA 4JZ5A 1UWIA 1V3IA 3QHMA 1UWUA 1EIBA 1Q6EA 2YLAA 2E4TA 3WEMA 1J12A 2WKLA 2CETA 4CN6A 2BS9A 5A8PA 3WD1A 4FK9A 1LL6A 1J01A 2Y24A 1C92A 4URIA 4UZUA 1HJWA 2GFTA 3POHA 1GJWA 1CYGA 1AQMA 1QNRA 2ZUVA 1UWRA 3ARTA 1VAHA 2VL4A 4CD7A 2DT0A 3UG3A 1PX3A 1K9TA 5HPCA 3L4TA 3WH9A 3D5HA 4GZJA 1TA3A 5BWFA 3PTMA 3BAKA 2PI6A 4X0NA 4H04A 1EO7A 4PYSA 2QPUA 4PMYA 1QI4A 5CLTA 1GVYA 3ARRA 1XV8A 3FAXA 2VZSA 1CLXA 1UUQA 2EJ1A 3K4AA 2VQTA 1G0CA 1QNSA 2Y4SA 2Z1KA 1UH4A 2DIEA 1Q6FA 1J0HA 1CGXA 1E9LA 1CXHA 5E6ZA 2NT0A 4FLRA 4D72A 4W8LA 5AYIA 4MNJA 1CXLA 3QHNA 1XD1A 4AISA 3A6OA 5CQ1A 3RM4A 1NWRA 1NP2A 4UZSA 2VX5A 2XM1A 2D3NA 3CMGA 4AZIA 4PTWA 5C71A 1BF2A 1EOKA 1QI0A 3OGVA 4DM1A 2CBUA 3ZSTA 1BYCA 1KXQA 4D6FA 2WVVB 1KXVA 1OT2A 5HNNA 2CBIA 1K9DA 1YQ2A 4GO8A 1W2VA 2VX6A 2ZX8A 3M07A 1QHOA 3U5YA 3WL0A 4WF7A 4GQQA 2CKSA 3JUGA 6CGTA 4WIWA 2RGLA 3KZSA 1E4NA 3UETA 3TOPA 1NOFA 2EPOA 3MSDA 3SURA 1BGAA 2W67A 2VRQA 4OKDA 1HT6A 3EDFA 2FGZA 1M53A 3AJ7A 3ARPA 4WLCA 3WF1A 4PTXA 4WJXA 3CZEA 4UFIA 2J79A 6A3HA 2JE8A 2V3DA 4HPGA 3T0AA 2JIWA 5HDRA 3VMPA 1JZ2A 2BVDA 2X0YA 3BAJA 3CHCA 3VUPA 2PWEA 1Q6CA 2Y2WA 1WDQA 1XYZA 3AHVA 4JFVA 4EAMA 2QHAA 1C7SA 3MO4A 2WW5A 1TVPA 4TVCA 2X2YA 2XWEA 1BPLB 5CPTA 4NSBA 1WAWA 1CLVA 1NQ6A 2ESCA 1Z32X 1X6NA 3VX1A 5IHSA 2DIJA 1UKOA 1AQ0A 1H41A 2OSYA 4LPCA 1OCQA 4CN1A 2WVTA 5D9OA 4P8WA 2D0HA 2V3FA 3EBVA 3MKKA 3QHOA 1UG6A 5I77A 2VOTA 1XSJA 3SEPA 1KXHA 3FAWA 4QAWA 1ODZA 3WH7A 3QOKA 4UNIA 1JDCA 5IXEA 1HL9A 3WNOA 3L4UA 3MV01 3M46A 3VGFA 2G3MA 3K46A 5JUVA 2O9RA 2EQDA 3THCA 5AC5A 4R5EA 5M03A 3ZJ7A 3G6MA 2WLYA 3GNPA 2XSBA 5FD0A 4W7UA 3EMZA 1ZJBA 2D3LA 2WXDM 2D20A 4GINA 4J28A 3VU2A 5FCZA 1V02E 1FHDA 3VD3A 1MQRA 2YIHA 4D1IA 1ISVA 1V3KA 4JKLA 3TP4A 2E9MA 1ISYA 3T09A 4D6DA 2BVTA 3L4WA 2FHFA 5ABEA 3SCWA 2X09A 1UKSA 1WZKA 1OM0A 3CGTA 1C7TA 1V6UA 3AISA 1VB9A 4AD3A 1HXJA 3OLEA 1MQPA 1CBGA 4W7WA 2VUYA 3WFZA 1CGVA 1V03A 2G3JA 2DSZA 2JF6A 1EDTA 3L4XA 2XVPA 3AIBA 1R8LA 3W27A 3WQ6A 4WKAA 4FLQA 4AIEA 5BXTA 1BYDA 3AOFA 1BG4A 1GQKA 2UY2A 3RPMA 1VFFA 1ISXA 1LL4A 1LG2A 1D3CA 1BGGA 1OIMA 4HU0A 4CCDA 1JF5A 1I1WA 1GOQA 4P7RA 1ITXA 1AVAA 2GDVA 1E43A 4MDOA 2NT1A 4AZGA 1JFXA 5EFFA 5TD4A 1M7XA 3NCOA 4UOZA 1HF6A 3THDA 4UQEA 1H0GA 1H1NA 2OSWA 2ZX9A 1ZBWA 3W28A 3AZSA 3J7HA 2G3NA 3UERA 4PMUA 3GXIA 1H0IA 1B30A 2PB1A 4UFLA 2VURA 4WKHA 3B8SA 1DWHM 1BFNA 3AIUA 3WQ4A 3KL0A 3ZM8A 1ESWA 4TX8A 3ARVA 2YL6A 4C7GA 1OGSA 4DUXA 1G01A 4W8BA 3TONA 4GQRA 1JAEA 2E8YA 1OT1A 1JNEA 3BAYA 1B3VA 4XV0A 8CGTA 2ZIDA 4H7VA 1GHRA 1E6QM 3CTTA 4MJ2A 1CIUA 2X05A 3EDKA 2WSKA 1OINA 2XG9A 2EPKX 4H41A 3GH4A 1UYQA 3SUWA 2VMFA 4TTGA 3K8KA 3APGA 1CXEA 1KQYA 2YA1A 4U3AA 2EPLX 3A3HA 1C93A 1MFVA 4TXEA 3GXMA 4AMCA 2DSVA 1HP5A 4MAVA 2JALA 3VNYA 3GBEA 1UD2A 4KMQA 3PBGA 1E5JA 2VI0A 3PZNA 3W24A 2QMKA 1E0WA 1UKPA 4W89A 1MW2A 1X1NA 1XC6A 2XFRA 4X0VA 3AMDA 1KGUA 3CHFA 4P8UA 2NW0A 1TE1A 2BHYA 1C8XA 1QOXA 2PWFA 3AI0A 2PWDA 4UFJA 3AZRA 1BTCA 4QLKA 1V02A 3AHXA 2W5FA 2CHOA 3VIGA 4W84A 4BS0A 4ML4A 3AICA 1UD8A 2OLHA 2Q8XA 3WD4A 2CCRA 1E1FA 2BY0A 3VDBA 3AIEA 3CPUA 3BCFA 4CUCA 1J0YA 4W93A 5JBFA 1NM9A 5A8MA 1BQCA 4M1RA 3QGVA 4FLOA 1E3ZA 1CENA 3GXDA 2PC8A 4MB3A 1B3ZA 3WH5A 4BA0A 2Y5EA 2EPNA 3SCTA 3M6DA 1CEOA 2JEPA 5KEZA 2WC4A 3VIPA 4PSPA 3WUGA 3LPOA 3ZQ9A 4B15A 3MUAA 3F4VA 1J10A 2GSJA 2WMKA 1FFQA 2YOCA 4D6JA 2BHZA 4HPHA 2WYSA 3PHAA 3HMCA 5BXRA 4CN4A 1UR8A 1OSEA 5I5RA 3VKKA 2WBGA 2W63A 3NDZA 1IT0A 1JZ6A 4V28A 3L4VA 4GIAA 4JL2A 3ZMRA 1KR0A 1V6VA 2WVVA 2XIIA 1VEOA 1ITCA 2V5DA 3W37A 1X6LA 1TFVA 3AIWA 4UQDA 2CPUA 4DWSC 4LXFA 2YA2A 3WBEA 5JIWA 3VGEA 3W81A 4W88A 5I23A 1E4LA 5BYWA 3DHUA 3A47A 3VD4A 3LPPA 1DWFM 3UG4A 2DT2A 3O6AA 4E8DA 3DHPA 3NDYA 5ABFB 2DPEA 1E4MM 3T2QA 3ECQA 2GJXB 2WCGA 3AXXA 1V3MA 1KBKA 2J62A 1TZ7A 4HA1A 3M7SA 1ZU8A 3N18A 2GVYA 4FMVA 2WCSA 3SCQA 4S3KA 7CGTA 3TTSA 1QHPA 2C0HA 3FHQA 1EDGA 5EFDA 1EOMA 1QNQA 2E9LA 3BAXA 2J75A 2TAAA 4D6HA 1JDAA 3A4WA 2GJRA 4PBGA 1UD4A 2FH6A 4PUDA 3WMBA 5D8ZA 1YHTA 3TTYA 3OB8A 1UOKA 2WMHA 2EO7A 5A6BA 4D6CA 1GQLA 1UKQA 2XFFA 4Z2GA 3SCVA 3TTQA 1MFUA 4ZENA 3W6LA 4HA4A 3OLDA 4J3VA 5AC4A 3WNMA 3IJ7A 4H2CA 2V3EA 2BHUA 4CD5A 3PZVA 3E1F1 5CPSA 4HOXA 4PUEA 2DSWA 5F7UA 1NH6A 2XVNA 3VPLA 1JYVA 2WC3A 3ZIZA 4UOQA 4A4AA 1PX8A 1CXIA 4W86A 1HNYA 5DO8A 4CCCA 1V08A 1UWTA 1OB0A 2FH8A 3ZSSA 4EKJA 4KRTA 2DT1A 3BGAA 2HISA 4LGXA 1H09A 3WEZA 1QI2A 3VDHA 1JZ7A 2ZUNA 1R86A 2GDUA 2WHMA 1JZ5A 3CHDA 3F5KA 2QMJA 4ATDA 1W32A 3B9EA 4GI9A 4LX4A 4RE4A 1J11A 1N82A 4YPJA 1RD6A 1J0ZA 1C8QA 1HIZA 4PTVA 4BZYA 1H49A 4A3HA 1KGWA 2AMGA 5A6KA 1E56A 4RL3A 7A3HA 5EMYA 1UQZA 2OWXA 4QP0A 2D23A 1SYTA 3WD3A 1TR1A 2CITA 3BC9A 2ZX5A 4Z2IA 2DH3A 4U2ZA 4NRRA 3VVGA 1QNOA 1OD0A 4HMCA 3VIJA 1KCLA 3SUTA 1E4IA 1WZLA 4OOUA 2XTKA 4J3TA 4P7OA 3CUIA 2NSXA 3WUFA 3WENA 3L2MA 5A69A 2ZXDA 1VFMA 1I1XA 2X0HA 3OBAA 1BHGA 1HJVA 2F61A 1GOIA 4AYSA 1WKYA 5ECUA 2W92A 5IHRA 2XHYA 2WHKA 1XRVA 1CPUA 1PAMA 1S46A 3NSMA 5DF0A 4J3XA 3MU7A 3ZR5A 4RE3A 1UA7A 4M29A 4IUGA 4IPLA 1JYXA 2FHCA 2WMGA 4H8VA 1HJQA 3WNPA 5E0FA 3TA9A 3U5UA 3IK2A 2DSKA 1EXPA 1E3XA 3VGBA 1TMQA 1RP8A 3FY1A 4NRSA 2YL9A 2BVYA 4DWSD 4AW7A 3EDJA 4GI6A 4CKQA 2J7BA 3MS8A 1PX4A 1U33A 5E70A 3I3DA 1SMDA 2CNCA 3GH5A 3VM5A 4MPKA 4BCEA 4LQ1A 2VRJA 3WDIA 3WQ8A 3CZGA 1CGWA 1V6XA 1EH9A 3CHEA 1JI1A 3WN6A 1NWTA 3CZ8A 1WDRA 5BCAA 2CBJA 3CUFA 3FW6A 2YBUA 1FOBA 3AHTA 3WD2A 4PEEA 1ZBCA 3AIRA 3AMCA 4Q7NA 3ZJ6A 1U2YA 3GBDA 3VILA 4AZ6A 5AY7A 1GHSA 3VDAA 3W6MA 1PJ9A 2J47A 5KZ6A 3BXWA 3WL1A 1XGZA 1H4PA 1JYNA 3AZTA 2J77A 1UQYA 2VT0A 1E40A 4HOWA 3GH7A 3ARQA 3ARWA 1W1PA 3VMOA 3QR3A 1BSIA 1CGTA 3QOMA 4B9ZA 2BY1A 4MAZA 4KH2A 4JFWA 3RILA 1MQQA 1V3LA 2BNJA 1HN1A 1VF8A 3CZKA 3IJ8A 4M8UA 3AS3A 1J0IA 5M3WA 2XGBA 5I6SA 2FDMA 1W3LA 1JYWA 3BAIA 1FP8A 2CEQA 4JCMA 2D24A 3CUJA 4AC1X 1HVQA 3VTRA 4MDPA 3MUZ1 4M82A 4BQ3A 5A6JA 3WEOA 1NWSA 3B9AA 4AXNA 1VFOA 3S6TA 4NF7A 2PBGA 1HKMA 1AMYA 2WVSA 3IAPA 2VTFA 2QV4A 2CERA 3L4ZA 2RGMA 2V38A 5I0DA 4Z2HA 5D9PA 2WMFA 3OZOA 4DUVA 1NOWA 5DEZA 2QPSA 1LLOA 2EPMX 2XWDA 1LQ0A 1LWJA 4TVDA 4JKKA 3N15A 4J3UA 4HZ8A 4CGTA 5CXPA 2WVUA 1W3HA 1QPKA 4DM2A 1B3WA 2BY2A 4JHOA 2VCCA 3WNNA 3SUUA 1E6PA 2VCBA 4OBRA 4B3LA 3I3EA 4B9YA 3KWXA 1G5AA 1B90A 1GOKA 2VC9A 4A3YA 2W4XA 3T0BA 2DEPA 4K68A 2V3GA 2XSAA 3UCQA 1E0XA 3KL5A 4JIEA 1FHLA 5ABFA 1W9BM 6TAAA 5E9AA 3DYOA 2DDXA 1WE5A 3BSGA 4OIFA 4MB5A 4AD0A 5CLWA 3PTKA 1JZ3A 2GJXA 4J3SA 1GVIA 5CZKA 2A3CA 2OYKA 2IUZA 1H3GA 3BSHA 2YDQA 4JL1A 1W2PA 1V3HA 1UH3A 2D0GA 1CGUA 2Z1SA 1JZ8A 4JAWA 1SR0A 3F5LA 4TTUA 2OSXA 3GDBA 1EDQA 4E8CA 5A8NA 3BMWA 5I78A 4CVWA 1FH7A 2JEQA 4XUYA 2E8ZA 1I75A 5C8BB 2C7FA 3OGRA 4S3JA 2WKGA 5A6LA 3PZUA 4P8XA 1E6NA 4ZXLA 1V6WA 3T0DA 1B0IA 4H8HA 3W4RA 3G6LA 4NI3A 3OLIA 1XCXA 3U7VA 2BV9A 2ZXAA 2ZICA 2YKKA 1UZ4A 3ALGA 3RM9A 4Z2LA 3VNZA 2O9PA 2PWGA 3GZAA 3MV11 3A4XA 1US3A 5FL0A 1W9PA 2XVGA 3PZOA 1RH9A 2VR5A 2GK1A 2QLYA 3GNRA 4D6GA 3PZ9A 4YHEA 2MANA 5BXSA 1VJZA 1WCGA 3N9KA 4CD6A 4Y7EA 3VDCA 1EQCA 3CLWA 2D2OA 4OUEA 1OGBA 2VVNA 4HZ6A 5A2BA 1PIFA 2VJXA 5I3DA 5D9MA 1Q6GA 3NIYA 2YBTA 4P8VA 3UR8A 1MWOA 3UEQA 4UQAA 3N11A 4UFMA 2WCAA 2Y8KA 2CESA 3L2LA 3RO8A 2PWHA 3B9DA 1D2KA 1C91A 2FHBA 1G9HA 3ZT6A 4QFUA 4ACZB 2DT3A 1JXKA 1GOOA 5JH8A 4AD2A 2IXVA 4KRUA 2WK2A 2W66A 1H5VA 1FP9A 4GXPA 1MW1A 5A6AA 3PZMA 3AS2A 4F66A 4HP5A 1JG9A 1H2JA 1W91A 1XHGA 2CBVA 1E0VA 3W26A 3WBAA 5A2CA 2ZX7A 3AHYA 1R85A 3EDDA 3CZJA 1GOMA 3RM8A 1SFSA 1UHVA 2UY5A 2ZUTA 4HA3A 1KBBA 3LPGA 3KL3A 4AD1A 4J7RA 5A8QA 3AMLA 1VENA 1HX0A 3T2PA 3VIKA 5GNYA 4AZCB 4AIUA 5A95A 1VBRA 4WK9A 3PZGA 1DWIM 2ZUSA 1CTNA 1KQZA 3AS0A 4XX6A 3SCPA 2VNCA 9CGTA 2A3EA 1B9ZA 3EYPA 1ZS2A 4R27A 4OBSA 1ZBKA 1KWGA 2F2HA 2D1ZA 1WO2A 3OG2A 3NSXA 1V3JA 4ZE5A 2AAAA 3AS1A 1TG7A 2VZOA 2V5CA 4L4PA 4QCFA 3VMNA 3KEHA 2DQXA 1E1EA 2UY3A 1Q4NX 2W61A 1M03A 3DECA 3ARZA 4PCSA 4TX6A 4E2OA 3NUKA 1W9VA 3WFLA 1WZAA 3WMCA 4F8XA 3PZTA 3POCA 5LA0A 3PZQA 1B3YA 1W3JA 2YA0A 5DFAA 2WB5A 3WKZA 1OD8A 3W25A 2JF7A 3WNKA 1W1TA 4M81A 4Z2KA 3WDHA 3MMWA 4PMRA 2BXZA 4KWUA 4M56A 3NJ3A 5CJ5A 4J3WA 5A6MA 5FIPA 4AZHA 4IPNB 3VIFA 3WSUA 1MXGA 1B31A 1HJXA 5HOSA 1UR9A 1W3KA 5LA2A 2WZEA 1W1VA 3VIOA 3ZR6A 2E9BA 3RCNA 1GNXA 3AXIA 4W7VA 2O9TA 1GQJA 3I3BA 1QHZA 3VGGA 1XD0A 5CSUA 3WIJA 3ALFA 2J4GA 1UH2A 3ARUA 2XJ7A 1LWHA 3OGSA 4FLSA 2GK1B 3K8LA 1C8YA 3GYCA 3OA5A 3WF2A 1JIBA 5E0CA 3N13A 1V0NA 2D0FA 5I79A 3ZOAA 1V0MA 4DUWA 1VFUA 1XSIA 1E6ZA 1KWKA 1LJYA 3CUGA 4TOQA 1QW8A 2ZUMA 4GO9A 2WHLA 3K1DA 5FKYA 2FGLA 3VD7A 3MMDA 4QDMA 2ZWZA 3PN8A 1TCMA 1PZ3A 2E3ZA 1W9DM 1EGZA 1CXKA 1UA3A 3FXYA 2A3BA 1E55A 4PRWA 1MYRA 5D8WA 2CIPA 5GQBA 2ZOXA 3WMSA 4CD8A 4AY1A 2XUCA 3BCDA 4BQ4A 1QI5A 4JHZA 3VGHA 2J7EA 3AROA 1D7FA 5BRQA 3GXFA 4OZOA 2VVSA 3OIHA 3IJ9A 3WD0A 2WZIA 1GJUA 1GUVA 2YDRA 4U33A 3UG5A 1VIWA 1SMAA 4U2YA 1W1YA 1E6SM 3AIQA 4UQ9A 3ZO9A 2J8FA 3K4DA 1O7AA 2CHNA 1HL8A 3WQVA 4B16A 3AQUA 1NP0A 3WF0A 1R87A 1J0KA 4HTYA 1J18A 2WSPA 2X1IA 3LPFA 3VINA 3N12A 3ARXA 1TUXA 3NSNA 2WANA 4XZWA 1BYBA 3HN3A 4X9YA 4WKFA 3UR7A 2J7CA 2XFYA 4ZEPA 1O6IA 4XZBA 1TVNA 1BYAA 8A3HA 4C7FA 3AYRA 5GPRA 4TUFA 3WF3A 1JF6A 4F9JA 4JFSA 2VO5A 4KGLA 3VOCA 3CO4A 4EE9A 1KR1A 3AHZA 3ARYA 4QCEA 5A2AA 4EANA 4PTMA 1JL8A 3SUVA 2UY4A 2O9OA 4LYPA 3ZJ8A 4PCTA 3AXHA 4AEEA 1WB0A 2YL5A 2ZUWA 2W62A 4D71A 4GZIA 3DYMA 1V0KA 5A6BD 1LF1A 1HKIA 1FH8A 1KCKA 1Q6DA 2UWFA 4OOZA 3GTNA 3OZPA 3VX0A 2WBKA 3DYPA 4Z2JA 1JI2A 3PTQA 4V27A 5D4YA 2A3HA 5BXPA 1WPCA 2VZUA 1GPFA 1MW0A 4DWSB 1XH1A 3AMKA 4CD4A 4BF7A 5CPQA 3EMQA 3OLGA 3VO0A 1XYFA 4KGJA 3RJYA 4HMEA 4P7LA 1PPIA 2J7FA 4CVUA 4UOJA 3SUSA 4HMDA 1FA2A 3DC0A 3ZT7A 1ZB5A 1BLIA 1IZKA 1VBUA 3RMEA 1QBAA 4QLJA 1KXTA 2EXOA 2WM0A 4PMOA 4RE2A 5HBFA 4GPNA 4ZFMA 1QI3A 1ISWA 1XCWA 3HU7A 1MVYA 4F9DA 3W38A 3O2LA 5DT5A 3PZIA 1MXDA 5JIPA 1C90A 1W9XA 3T2OA 4IISA 1AQHA 1VEMA 1R7AA 5A3HA 5M5DA 1DWAM 4UQBA 1WZMA 4UFKA 1IZJA 1UR4A 4CCEA 1QW9A 3CMJA 3FN9A 3VIIA 1VRXA 1DHKA 2DGAA 2X8RA 3VIHA 3U7BA 3GNOA 4LYRA 2CXGA 2DH2A 1EA9C 4MNKA 1V0LA 1JD9A 1K6AA 1XH2A 2J7HA 2ZX6A 4PMVA 4UFHA 1JXJA 3EDEA 4JCLA 1E6RA 4ACZA 3LMYA 2XVKA 1UR1A 4AWEA 1TA3B 2WMIA 4AZBA 4HU8A 1Y7VA 4W5UA 5M17A 1UKTA 1XSKA 4PN2A 1VJSA 1J9YA 4V2XA 2EEXA 1EHNA 3S2CA 1G1YA 2J78A 2WMJA 5CSYA 1B1YA 2W91A 1GOWA 2BFGA 1OIFA 2CKRA 3WH8A 1HJSA 5CGTA 3ZT5A 4TVUA 1CXFA 2IXUA 3WUEA 1IV8A 5A8OA 2OYLA 1K9EA 7TAAA 1CECA 5EBAA 1W9UA 1DP0A 2GJPA 3SCOA 4XB3A 4FF5A 4AZCA 2O92A 3AFBA 1C3FA 2BY3A 4MADA 3SCRA 4AZ5A 2ZXBA 4E4PA 2XPKA 1WNOA 5DT7A 1UR2A 4CU7A 1OGGA 3NYDA 1DEDA 4PMNA 1E72M 2J7GA 2WHJA 2WAGA 4W85A 4CU8A 4AD4A 1OBAA 3CBWA 2PF0A 2OWWA 3BH4A 5IDIA 4D6EA 1PIGA 1MW3A 3T08A 4YN5A 3WUBA 3WNLA 4W87A 3FHAA 1QBBA 2WLZA 3N17A 1WDSA 4W5ZA 3AIVA 4GI8A 4ACYA 3BMVA 1B2YA 1HJUA 2GUYA 3MUY1 4PMDA 3BLKA 1A47A 1F4HA 3VD5A 5E6YA 3N1AA 2HVMA 1JNDA 1H11A 2YJQA 5A94A 2VCAA 5CGMA 5A1AA 1HKKA 4JFTA 4MNMA 3EMCA 4EK7A 4PSRA 1CNVA 2WNWA 3WH6A 1HP4A 3MSGA 1K9FA 3RJXA 1E15A 3WQWA 1FH9A 2A3AA 5IFTA 1M01A 2OWCA 3L4YA 4P7QA 1OWQA 1PBGA 4L4OA 3VIMA 4OJYA 4BQ2A 1JDDA 1GORA 2G4FA 4QLLA 2J74A 1E6XM 1ZJAA 4UCFA 3CH9A 1GW1A 3WF4A 3MUIA 1EHAA 2E40A 1BVZA 1R7OA 5FL1A 1PZ2A 1CWYA 1ODUA 2YLLA 2AOSA 3WELA 3WDQA 1HVXA 1RPKA 1J0JA 4H8UA 2B31A 3SCSA 1GQIA 3CUHA 3TTOA 1L0PA 1ECEA 3W0KA 1JZ4A 4J27A 1G94A 1GZJA 2Y8VA 4UTFA 2PBOA 5GNXA 1L8NA 2XVLA 4PMXA 4M24A 3AYSA 4MNLA 2WWDA 1DWGM 3MMUA 1E5NA 2ZXQA 2EBNA 1E73M 4U31A 1UD3A 2XGIA 2WMIB 4F79A
chains in the Genus database with same CATH superfamily
3IV8A 4QISA 3I68A 3WQ5A 3QN3A 1PBKA 2ABAA 1UD5A 1KFBA 2A3LA 5CG0A 3JYMA 3W9ZA 3QC3A 4LS1A 1EJVC 3TJXA 1GRJA 5CZ0A 4PUMA 5DRIA 4BQ5A 4GZEA 2AQVA 2Z24A 5EB8A 3MZNA 1W26A 3BJSA 2JFEX 4DAIA 4MYXA 1EP1A 5GNZA 4JFUA 3E5BA 4W8AA 4KWSA 4MB4A 3PNUA 3QZ6A 3HPZA 1VEPA 1JGIA 3QMRA 1TTJA 3RIKA 1NDWA 4XZIA 1CZ1A 1F4AA 3RRXA 3SRFA 4DBEA 2G3IA 2VCDA 2A7PA 2PD5A 2GZXA 4US6A 4YNGA 1VR6A 4PBFA 2E0PA 5AFDA 4CU6A 4UTMA 1JAKA 3LBMA 5A8GA 1XLGA 2C6QA 3MCMA 4UR9A 2XIBA 3E74A 4JFLA 3W22A 3MANA 4ZB2A 3WDRA 4DPQA 2BXYA 5AYZA 5H8UA 4ZQOA 1NOUA 1BVNP 2D22A 3UQAA 2GGIA 3E3HA 2XYLA 3VM7A 5AC7A 2VR4A 5F1UA 4MTVA 5JBEA 3QVQA 3R11A 5FOOA 4UQCA 2VDHA 2QIIA 1VFSA 4IQCA 2DSUA 2VKZG 5C9WA 4MJ4A 4GGQA 1VPYA 3BSMA 4U5KA 3GXTA 1XLLA 5K3VA 1OFOA 2EULA 3ANVA 2NUWA 1I60A 1WP6A 5LYRA 4WSJA 4LAXA 3VNKA 3H2AA 2YDSA 2Q71A 3DH7A 2WC7A 2MF9A 2VX7A 1XRFA 1TV2A 2VZVA 4AIOA 4L1GA 3WY1A 3C2OA 2ZUUA 2WZHA 2F8QA 3PRDA 3OODA 3SCNA 1P0EA 4WSKA 1NARA 3PBWA 3AMGA 1P1MA 4JZ5A 3E9AA 5TBOA 3WEMA 4JQ2A 2WKLA 4CN6A 2DG3A 2BX7A 4H9XA 4V1XA 3LLDA 1JUBA 4JD4A 1PV8A 4NI8A 1LL6A 1J01A 4UZUA 4ICCX 1HJWA 3LM3A 1I8JA 2X1UA 1H7RA 4M1BA 4H6QA 1BRLA 3E49A 2POZA 4XISA 2HROA 4O0ZA 1K9TA 1DQUA 3SBFA 1JQVA 3D5HA 3MZ2A 2VFHA 2GQ3A 4DF2A 5CGQA 5EU9A 4ODPA 1OF6A 4JFJA 1EO7A 2IF4A 1ONXA 1QI4A 2DQWA 3PNZA 1GVYA 3FAXA 2VZSA 3VOJA 1UUQA 1IEQA 1DXFA 1G0CA 1QNSA 3EPOA 1HXVA 4H00A 1GGOA 3AU6A 4R9OA 3VOHA 1CGXA 1E9LA 4PCPA 4JN8A 3GVGA 5E6ZA 1SW0A 1YXDA 1B57A 1XBYA 2BWGA 4AX7A 5IBXC 2QIWA 3NPWA 4DJEC 1IXQA 3SJ3A 4AISA 1KC7A 1FWWA 2R1KA 4LBUA 1RUSA 3RM4A 2I9EA 2XM1A 3CPRA 2EHHA 4N7QA 2INZA 1K3UA 3CMGA 1L6WA 1QI0A 1EOKA 4DM1A 4KEUA 3SY1A 2CBUA 2X7WA 2NQZA 4D6FA 2WVVB 1KXVA 4NNAA 5HNNA 2CBIA 3BG5A 2VX6A 4WF7A 4GQQA 1XXXA 1J4RA 1QWGA 2FJUB 3R25A 1GTHA 4O14A 2RGLA 2DZTA 4JTJA 3KDNA 2GWGA 4E8GA 1NOFA 1HO4A 3G1SA 3SURA 6REQB 1BGAA 2W67A 2VRQA 4LV4A 3GY1A 3M0KA 2ISDA 1EF3A 1YXCA 1H1YA 4PTXA 4WJXA 5FF2A 3CZEA 1ZPTA 1XLCA 2DG9A 6A3HA 4LEFA 5HKGA 4MUZA 3RUBL 3KRBA 4LW7A 3BAJA 3CHCA 4BEUA 1EIXA 1BXCA 1XYZA 4JFVA 2OMAA 1BXBA 4EAMA 1HKWA 3U0HA 1VH7A 3MO4A 3B8IA 1TVPA 2FPYA 1IX5A 2XWEA 1DL3A 5CPTA 3TDBA 1VP5A 8TIMA 1CLVA 4FNUA 3ZS4A 2ESCA 4IH3A 3DHFA 2G0WA 1C9DA 1H41A 1X8CA 3GKFA 5D9OA 1S2UA 4P8WA 3B0VC 3QYQA 1SZGA 3MJMA 2CLLA 4DZIA 3QHOA 2Z28A 1RK6A 4RZBA 1O5KA 1FKSA 2ZTKA 4KWWA 1KXHA 5D09A 2TYSA 4C6FA 4NT0A 2ZA3A 1QR7A 2QCDA 3WQPA 1J93A 1US0A 1LRTA 4OHQA 3M46A 4RKAA 2G3MA 1GTEA 3N2CA 3VGFA 5JUVA 2OQLA 2EQDA 4GE8A 5FAGA 3ZJ7A 3G6MA 3TYUA 3GNPA 5FD0A 4MKVA 2D20A 3LGGA 4J28A 2F21A 1FHDA 3VD3A 1MQRA 4WJEA 3T09A 2BVTA 3W88A 2FHFA 4J4KA 2C14A 1YDYA 1T41A 3FXGA 1O5RA 2YCJA 4DRHA 3EIPA 1OM0A 1SO4A 3LU2A 2M1IA 1KW1A 3UXIA 4IL0A 3LUTA 4NNBA 1V6UA 1EJRC 4AD3A 3OLEA 2HE8A 2XFWA 3R10A 4W7WA 3EOEA 4F0SA 3OQ8A 2VUYA 4XBJA 1L6GA 3CQKA 3S5OA 4QSHA 1K03A 2G3JA 2XVPA 1F07A 3ID7A 4WKAA 3EAUA 1BYDA 1W5MA 3GX9A 2ISSA 1Z41A 3NAVA 5DBTA 4LY4A 1ISXA 2MPHA 2OGJA 1JEZA 1OIMA 3RK8A 3BW3A 3M7WA 4WRHA 3P60A 5KSWA 4JXCA 4LV9A 1E9IA 1JF5A 2VELA 2R6OA 2J88A 4P7RA 4JTFA 4QXIA 3H21A 3MDWA 4MDOA 4AZGA 1A50A 4DJED 3N2OA 3GC2A 1M7XA 3SGZA 5I7GA 3NCOA 1H1NA 3URAA 3QXBA 2ZX9A 3IRSA 1F3TA 1LP6A 2DG4A 3W28A 4PMUA 3I7SA 4IPPA 3GXIA 2HNEA 4ZS6A 1Q13A 1P0DA 2VURA 4C6QA 3WJWA 4TX8A 1RY8A 4KRZA 3NR0A 4DUXA 5M1TA 3PUDA 1G01A 5LNVA 4QX4A 1OT1A 3B0XA 5HULA 3BAYA 5D2YA 2DW6A 1MZRA 5H8MA 4IP7A 2DZVA 2YW4A 4YU1A 3H2NA 1J2WA 3PR2A 4NX0A 4H41A 4OGZA 1XPYA 3S2NA 2P88A 3N14A 2VMFA 4DRPA 2XPBA 3K8KA 3HGRA 1ITQA 1KQYA 1R9XA 2YA1A 2EPLX 2O56A 1MFVA 4AMCA 1J4IA 3O5GA 2DSVA 3NL2A 4MAVA 3NXLA 4YVPA 3UWUA 2YZRA 3PZNA 2P0IA 2AL2B 1E0WA 4GYKA 2YB1A 2I56A 2CZFA 4JEJA 5KZEA 3A9IA 1MW2A 3GS6A 4U28A 1TCOC 3QF0A 2XFRA 3F2BA 1KGUA 5T26A 3CHFA 4P8UA 1K7FA 1TE1A 5D30A 2BHYA 3VKAA 3AI0A 1Q7MA 2PWDA 4UFJA 1CT5A 1GYLA 4ODQA 1XGEA 1MDLA 2Z6JA 1GWJA 3O5QA 4ML4A 5CH9A 3AICA 2IMRA 1KA9F 1JCLA 3I6EA 1TPUA 1ROTA 3FJ4A 3CIWA 2PP1A 1VQTA 4K6AA 3G24A 3KAFA 4CUCA 4LY8A 2BOEX 2QKFA 4PB4A 4JYDA 4DROA 1M7PA 3NL6A 3B03A 3GXDA 2PC8A 3M64A 2WJDA 4MB3A 4Q4QA 1HKVA 3R8RA 4BA0A 2Y5EA 2WC4A 2P10A 3F4NA 4XZMX 5FJRA 3V75A 3H2OA 5AHIA 3LPOA 3GU1A 4XD6A 4QSFA 4UIOA 2C16A 2GSJA 4TQTA 1YADA 2ZQTA 1TWWA 3BLOA 3OVGA 2F6UA 1LDCA 3PHAA 4JTDA 1FKKA 3M44A 1QOQA 5I5RA 2WBGA 2W63A 3NDZA 4GX9A 2RUCA 1IT0A 3VNDA 4RNIA 4V28A 3ZWSA 2I5IA 4GIAA 3ZMRA 4DI9A 1TFVA 4LXFA 4DWSC 4XVDA 5HMFA 3OOQA 4W88A 5I23A 1E4LA 3CQHA 1XIHA 4BF9A 3UR5A 1U22A 3VD4A 2P0OA 3LPPA 1DWFM 5F2GA 3O6AA 2IKHA 3DHPA 4YVVA 3NDYA 4LC8A 2DPEA 3EB3A 1E4MM 4MGVA 2YPIA 3TH6A 2GJXB 3S1UA 2Q3OA 1KBKA 1XLIA 1D6OA 1TZ7A 3M7SA 4DHGA 4FX7A 3SCQA 3TTSA 2XH4A 1FKLA 2ZVIA 1QHPA 3H4GA 1C29A 4LBSA 2PLJA 3BOXA 5I03A 1EDGA 3BAXA 2CZDA 2B0MA 2INEA 4AVNA 1N55A 2Z1BA 3A4WA 2NQ9A 3WK0A 1SFJA 2GJRA 3U48A 4DF0A 3BLEA 4PBGA 1A7XA 1XLMA 1UD4A 2FH6A 3WK3A 4C6DA 3URBA 3TTYA 1TMHA 2ZZ2A 1UOKA 4GJ1A 2EO7A 1KTBA 3DCPA 3V18A 4IOTA 1A5LC 1LROA 3SCVA 3COTA 4O8RA 1MFUA 3KLKA 3IJ7A 1SW3A 3GHSA 3DBPA 4C6MA 1MNZA 4DJFA 2B7QA 3OEXA 4HHHA 3W7OA 3VPLA 1Z8AA 2WC3A 2BP1A 1J96A 4NUWA 3ZIZA 4UOQA 4U84A 1F6PA 2OGYA 3MKCA 1CXIA 2RUDA 3SSZA 1XBVA 1RY0A 3ZSSA 1OB0A 5DQPA 2NQLA 3AUJA 2LJ4A 2DT1A 4LGXA 1H09A 3EPMA 1QI2A 2GDUA 5DMLA 2ODOA 1KBJA 1GT8A 3IIZA 3QKZA 4NAFB 4RE4A 4DNMA 1RD6A 4R88A 2VXNA 1U5HA 3T05A 4H83A 4A3HA 5XIAA 2WNNA 1XG3A 4BF5A 1EWEA 1V7AA 2LPVA 2OWXA 4QP0A 1R3VA 4AHQA 2XZ9A 1TR1A 3BC9A 2ZX5A 4Z2IA 3ABRA 1JCXA 3VVGA 1QNOA 4JR5A 1Q2RA 4HMCA 2P8BA 1KCLA 3C86A 2DZWA 5BU9A 4A8IA 2V6AA 1FXQA 1SVDA 3CUIA 4I7UA 1YMYA 1B4EA 1A5KC 3RRAA 5LSMA 3MHUA 2ZXDA 3Q67A 1I1XA 2YXOA 1BHGA 1HJVA 3MQTA 1UOZA 1GOIA 4AYSA 1BWVA 2PU0A 5ECUA 3P5ZA 2PSNA 2XHYA 1KTCA 1XRVA 3TXZA 1FAPA 3MU7A 1TZZA 4RE3A 4IUGA 1KM4A 1JYXA 2AGKA 2IW0A 2PCEA 5CZTA 4H8VA 4FSAA 4YWIA 5LIYX 3BO9A 1N1AA 3CIXA 4LNCA 1EXPA 1S39A 1BTMA 1OG0A 4LAVA 3CV7A 1OZMA 3A22A 4WVXA 2WNQA 3HQ1A 1B4KA 5G1TA 4DWSD 1TMLA 1EC8A 4NJJA 5J5RA 3TFXA 4CKQA 4LUSA 1PX4A 3QMTA 4UTKA 1Q6LA 1PKMA 1TELA 3T55A 1RCOB 2ALDA 3KS5A 3FJNA 3KBWA 3RGTA 1CB2A 4HJWA 3CZGA 1KFKA 1X1OA 3TC7A 3CYJA 1WDRA 2PPOA 2PDXA 4L1XA 3AHTA 1GEHA 3WD2A 3MI3A 4DB7A 4H2HA 5HUPA 2RUQA 4RX0A 1ZBCA 3AMCA 4HHMA 1K6WA 4Q7NA 1E9YB 3TOYA 1CW2A 1PTGA 4HU4A 4M7TA 5AY7A 1GHSA 3E38A 3W6MA 5M2FX 1Q85A 1WUEA 3WL1A 3HO8A 1H4PA 1ALDA 5BZAA 4HNOA 4HNCA 3ARQA 2VEGA 4DF1A 3OZYA 4V1YA 4WHBA 3R43A 1L2UA 5CBJA 2OZ8A 1P0KA 2ANUA 4HSHA 1MO0A 5GJPA 5CSRA 1TPB1 4IT1A 3RILA 1MQQA 3KVKA 1V3LA 4ZOCA 3L65A 3DG6A 5M3WA 3UCCA 1JNSA 4CNSA 4FXJA 4G6CA 1V4YA 5HWJA 1JYWA 1X38A 4NZJA 5AVHA 3BAIA 4LC6A 4B5NA 4Y96A 4AC1X 3SI9A 4EOUA 1O68A 4A8NA 1HVQA 4MDPA 1C9WA 2FMNA 1I2OA 4AXNA 4ORIA 4Q32A 3S6TA 4NF7A 2PBGA 4H6RA 1AMYA 2BXVA 2BG5A 3AJXA 1J8VA 1LLOA 2XWDA 4GNVA 3C0QA 2WJEA 3T81A 2KE0A 4HZ8A 1SU5A 4JN6A 5FEPA 2FZNA 3NM1A 1QPKA 2DZUA 1B3WA 3GAKA 1DHPA 2G3FA 4JHOA 3L9CA 1P5QA 3SUUA 2QNEA 1ADOA 1E6PA 1YRRA 3N6HA 3GNXA 3P14A 3PFRA 5I3FA 1UUOA 4GIYA 2WOQA 3KOFA 1O5QA 4G2PA 1FWHC 3QTPA 3C2FA 4MB5A 3UZYA 2ZZ6A 5PTDA 4J3SA 5CZKA 3B0UX 4HPNA 2YDQA 4LAZA 3NL3A 4JNZA 2K8IA 1W2PA 4Y8EA 1V3HA 2V2DA 1R3RA 1XBXA 1XKYA 2OLAA 3DI0A 4AWTA 4JAWA 1ZFJA 4KWVA 3W00A 4MG4A 4ZQCA 1RJRA 3BMWA 3C0LA 4IMFA 1KKOA 3IVSA 2NLYA 2NSOA 5HWCA 1DXEA 3B9NA 5AB3A 2E8ZA 4K8HA 3A9BA 4S3JA 3E2SA 2ZC1A 3BVJA 2KI3A 3TN3A 1YE6A 2YCIX 2NQJA 2PGWA 1XCXA 4RPPA 4NJKA 3UA4A 5AECA 3PANA 5HTGA 1ICSA 2IPGA 4MY8A 3E02A 4O1BA 1UZ4A 4I9AA 4S3EA 1AZ1A 4YL2A 1HG3A 1US3A 3W7PA 2H8XA 1TPWA 3PZOA 2VR5A 1EQ3A 1VHCA 2JKAA 2GK1A 3GNRA 4D6GA 4YHEA 4G1KA 2O0TA 1FUYA 1VJZA 3N9KA 4OT7A 4Y7EA 1K8ZA 1KKRA 5HK4A 4ZGYA 1F76A 3CLWA 2D2OA 3CPGA 4HPJA 1PXGA 4A6GA 2VJXA 5I3DA 4GXMA 5D9MA 1U79A 4P8VA 4Z0SA 4DT4A 3UEQA 7XIMA 1W3TA 3N11A 4UFMA 2WCAA 3DX5A 3H70A 3IS4A 1NFGA 3VAWA 1G9HA 3ZT6A 4AG0A 1TWDA 3KACA 4ACZB 5C9UA 3OHIA 2IXVA 1R3YA 2WK2A 1H5VA 4GXPA 1MW1A 5A6AA 2DJXA 8XIMA 1W91A 3WQFA 3H53A 3N6QA 1E0VA 2ZX7A 1KRBC 2NX9A 5G5IA 4YS1A 2XINA 1UHVA 3G8EA 2UY5A 2QJJA 4C1LA 3G1FA 3AMLA 1HX0A 3T2PA 3QPEA 2YZ5A 2GSHA 3URQA 4C6NA 3NGFA 4WK9A 3PZGA 4B5SA 1CTNA 3AS0A 3K4WA 2A3EA 2HS8A 1IXPA 3BGJA 5C9XA 4C6OA 3TEVA 1ZBKA 1R3QA 3KBSA 3OG2A 3GPKA 3GR7A 1V3JA 4QZVB 3NOYA 4LUJA 1KRCC 2INFA 2DQXA 4QJ1A 1E1EA 5AHLA 2W61A 1M03A 3EWXA 4XAPA 4E2OA 1W9VA 3CWNA 1WZAA 3WMCA 3IRDA 3PZTA 5LA0A 4TU1A 3PZQA 1B3YA 1RJQA 4Y9NA 1GYMA 6PTDA 1X98A 3RCYA 1P0BA 3WNKA 4W4QA 3SW6A 3SECA 1W1TA 4M81A 1K7EA 3MMWA 3LHUA 2BXZA 2OXNA 4KWUA 4M56A 3V4BA 1DJIA 1BF6A 4J3WA 3DKLA 4J4NA 2PDYA 5CZSA 1ZCCA 1Q7ZA 4AZHA 4G5DA 3Q37A 1WX0A 4JQ4A 1W3KA 2QCNA 3BG3A 1G7UA 3VIOA 3RCNA 1GNXA 4C6EA 5DBUA 1ADDA 1PCKA 4PZVA 1GQJA 1HL2A 3VGGA 1XD0A 4K39A 5CSUA 1FKTA 3QQ0A 2J4GA 1VHNA 3WCZA 1CB7B 4FLSA 3A5VA 3CM4A 3TR9A 4EX4A 3Q45A 3A21A 3GNDA 4TR9A 4M6VA 1Q8AA 3WLKX 2OU4A 1RLDA 2Z1VA 5E0CA 2PN0A 3N13A 4A3QA 2D0FA 4C1NA 2X1SA 5K9DA 3VXGA 1LM1A 4DUWA 1VFUA 4QR6A 4BEQA 3PULA 3TQVA 3NA8A 3C2YA 4C6PA 1QNVA 4NAEB 3O0KA 1ECQA 1QW8A 4UTTA 3KZPA 2ZUMA 4GO9A 3KCJA 4XD5A 5FKYA 5C9ZA 3KABA 3VD7A 3R94A 2I5QA 4AF0A 2ZWZA 1IR2A 3PN8A 1OK4A 1PZ3A 1W9DM 2PDMA 3A23A 3LSBA 4G1NA 4MLRA 1E55A 2ZR5A 2RJGA 4UTHA 2A6NA 1SSGA 3NQ6A 1P7TA 1VFHA 4H9TA 4U86A 1J5SA 2ZOXA 4GC4A 2J7EA 3RGCA 3AROA 3C5QA 3GXFA 4OZOA 4WEVX 1RCQA 3BOFA 3NL5A 3WD0A 1GJUA 3KW3A 3CYVA 1W1YA 3QQWA 3G1RA 2CZVA 3ZO9A 3K4DA 1O7AA 2CHNA 3DI1A 4B16A 1TJ2A 1KM1A 3O5IA 1Q8JA 1R87A 2PDGA 1J0KA 4HTYA 3T4CA 1PWLA 2PDLA 3N12A 3L7RA 3VINA 1WBJA 4Z1AA 3O06A 2GUBA 4LUTB 2FQIA 3GVWA 4ICNA 4PCNA 1M5WA 4ZEPA 3BWWA 5F4SA 1Q7QA 1OX4B 3AYRA 2Q8LA 4W9PA 4AUBA 5GPRA 4TUFA 4F9JA 4JFSA 2VO5A 5DCBA 3UPWA 3VOCA 1AD4A 2HWGA 4Y8FA 4QCEA 1EP2A 1QAPA 3ZJ8A 4PCTA 4PL2A 1RQBA 3LQLA 4EF9A 4AWSA 3OJGA 2ZUWA 2RHGA 1OCJA 3CQIA 1T99A 4D71A 3QY8A 3NNTA 1RALA 5EPDA 1V0KA 5A6BD 4IXHA 3B4UA 1VLWA 4QE4A 1PDYA 1KCKA 5LZLA 1F9CA 3GTNA 1TV4A 2GL5A 4O19A 3DYPA 1JI2A 3PTQA 4V27A 2A3HA 2GGJA 2VZUA 1GPFA 5DMNA 3ONBA 1REQA 4BF7A 4H01A 3OLGA 4GYFA 2V81A 4KGJA 1E1CA 4HMEA 1O94A 1LOLA 4XAZA 3LNMA 4J2MA 3TQKA 4PR4A 4XD3A 1FA2A 3DC0A 1FWFC 1FX6A 3E0FA 3Q2DA 5ABTA 2E6AA 3O16A 4RXGA 1A0EA 5HBFA 3N9SA 4ZFMA 4R3UA 4AHPA 1MVYA 3U2OA 5TNVA 2FZMA 3PZIA 5DLCA 4E4UA 3TSDA 3UYIA 4JYEA 3L68A 4KFNA 4AQLA 5JIPA 1C90A 1AQHA 4AWUA 1WZMA 1F05A 1I4NA 1SUXA 3ITXA 4UFKA 4HT3A 2BOGX 2QF7A 3GHTA 4YYFA 4KEZA 2OZTA 2WQPA 3VIHA 3U7BA 2IKJA 5GPGA 3DERA 1LLZA 1V0LA 1K6AA 4LAWA 4PMVA 3W74A 3DFNA 4PB3A 4Q8PA 3ITYA 4EXBA 1TA3B 3HG4A 4AZBA 4HU8A 1Y7VA 4W5UA 3P67A 1XSKA 2EEXA 1SGJA 5I3GA 1ZAHA 4I9TA 5CSYA 3USBA 1OIFA 3WH8A 4GUIA 1PUDA 4R7JA 3L67A 3QSTA 1CECA 5EBAA 1SW7A 3P2VA 4H7ZA 1J6PA 1DP0A 4NG3A 5T9CE 3FX4A 4XB3A 5HATA 1PHWA 1IR1A 2O92A 4GX8A 3BANA 3SCRA 4AZ5A 4E4PA 4KETA 2XPKA 1Q6IA 4O8AA 1P5BA 1QWKA 4KS0A 2VENA 1WNOA 5DT7A 3KS6A 1B54A 2PWVA 3U2CA 2ISWA 3LHWA 2WHJA 2WAGA 4H6EA 3IGSA 4AD4A 5JVLA 1OBAA 2FZ8A 1NFPA 1V93A 1E51A 3ATZA 4PCFA 4OWGA 1MW3A 3DG3A 4YN5A 5I3HA 1JVNA 3SIZA 1Y5XA 4TMBA 4W87A 3EWUA 2WLZA 2DP3A 4JN7A 4EF8A 3N17A 3AALA 3UXDA 5EMUA 1QMLA 4JY9A 3MUY1 4HN8A 1UC4A 3WQCA 4PB5A 4ZTXA 5I98A 3A13A 1U5JA 2KAUC 4L61A 3IPWA 2Y88A 4UCGA 3BV4A 2AMXA 1VCVA 1XW8A 1OY0A 3EMCA 1QPNA 4JX5A 1VBGA 1S1PA 3SADA 1FKIA 1ELSA 3O5LA 4H4IA 4KKXA 1NVMA 3DFYA 4GBDA 2GWNA 1XI3A 2ZZ1A 1EX1A 2DV0A 3MO7A 4K36A 4JEQA 1FY6A 2V5KA 1V5XA 2J74A 1E6XM 4N9EA 4UCFA 3BICA 5HUOA 5LHEA 1MEIA 1AW2A 2C18A 3SN0A 4JTTA 3TNBA 2FVLA 4ZQNA 4FIQA 2FPTA 4BF8A 4NJIA 1IF2A 3WELA 3WDQA 1HVXA 3NDOA 3CQ0A 1J0JA 2JK2A 4H8UA 3FDKA 3P84A 1OADA 2A7NA 2B31A 3DGBA 4G2DA 2BSLA 3M5YA 4RDWA 2Y85A 1L0PA 3W0KA 1JZ4A 1Q6UA 1Q4WA 1JCTA 1GZJA 2Y8VA 3NPUA 4HCHA 1L8NA 1XKJA 4GISA 3MSYA 1ME7A 1VJIA 3TTEA 4MNLA 3NGJA 2PDUA 3MMUA 1E5NA 4B4FA 1E73M 3JS3A 3PB0A 1ITUA 2WMIB 4F79A 5F1VA 2Z6IA 4YHGA 1YXYA 3MUXA 4AEOA 5AYBA 3WDPP 5HA7A 2E6FA 4ZXOA 2FVMA 2I5GA 1FWAC 3IANA 3UESA 4B2DD 1W5OA 3DKJA 4ZPTR 3BLPX 3S1VA 4PMQA 1EQPA 1JDEA 1GONA 4JGDA 2ZE0A 2M08A 1U30A 5HWBA 1AFSA 3TNOA 5CG7A 2QF8A 4JX4A 2GVGA 4IZGA 2NUXA 3H22A 4YTSA 1P6WA 1TQJA 3W73A 2ABBA 2N87A 4AZ7A 1WDPA 1XYLA 2XIQA 5LIKX 2JZVA 2ZDSA 3B06A 3GUWA 1XIDA 4TW7A 3IAQA 2XM2A 2ZWYA 3K8MA 1IWBA 2FAPA 2X30A 4N6EA 5FSDC 1S2VA 1ZBVA 2VX4A 1GVQA 2QDHA 2CHRA 2XN2A 1PDZA 3RR4A 1UP3A 1EJWC 3S5SA 1BEUA 1YE4A 4JKMA 3VOIA 3E2QA 5JBDA 1KB3A 1XL9A 4LYQA 3W1RA 3N73A 5HXMA 2RKXA 2QS8A 4H9MA 4E2DA 1M1BA 1S2CA 3F5JA 3W2KA 4CQCA 1EPVA 1BAGA 1L6YA 4Q4RA 4GC3A 3URNA 2VFGA 4HZ7A 4MIMA 3H26A 3QW4B 4HHPA 1DWJM 4ATLA 3S1WA 2V63A 3GHRA 3QV8A 5AHEA 1DTUA 1E70M 1B5TA 1HKJA 2A7RA 3SZ8A 2J25A 3MB9A 1IE7C 1XR2A 2GSEA 4Z08A 1ISZA 4AIBA 1CGYA 3ELFA 1UWSA 2BZNA 2KX9A 4ZOBA 4LRSA 3B8VA 2W0UA 1YPFA 2FTWA 3II1A 5HPOA 4QM1A 1A3HA 1V3IA 1ML1A 1EIBA 4G50A 2YLAA 4QAIA 1J12A 4US5D 1P43A 1ME8A 1ZK6A 4FK9A 1W17A 3ZLGA 3UI5A 2Y24A 5HW8A 1YATA 2GFTA 5JMUA 3O7UA 1GJWA 1CYGA 1AQMA 1QNRA 1T0OA 1VAHA 2VL4A 2QUVA 3S1GA 5EMMA 1O5XA 3LLFA 5D05A 1AH0A 2CLEA 1FKJA 3L4TA 3OW1A 1H63A 1OEPA 4GZJA 1XINA 3BAKA 2O4QA 4H04A 4PMYA 4EWJA 1XV8A 3CV1A 1CLXA 4DWDA 2EJ1A 5REQB 2VQTA 3CT2A 3C0SA 2DIEA 1J0HA 1AK5A 3H7UA 3P6LA 1CXHA 3BK0A 1A5BA 2Y7FA 2NT0A 5AZ1A 4D72A 4W8LA 4MWAA 4MNJA 3P8JA 3LXCA 2WJFA 4IFKB 1NU5A 3A6OA 3F2DA 3SM0A 4FIRA 4Q8WA 1NWRA 2GGHA 4XIAA 2YFOA 2CLFA 4P61A 4Q8NA 1BYCA 1KXQA 4XZ9A 5FACA 4RJEA 2DORA 3JRKA 4IMDA 4M5PA 2QGYA 3BOLA 1YQ2A 4DVOA 1IT8A 2ZX8A 3U5YA 2IS7A 5HANA 1FCVA 3FJ6A 3TE9A 2QCMA 3KZSA 1E4NA 5HR6A 1TQXA 2QT3A 2EPOA 3MSDA 1HT6A 3EDFA 3RX2A 2FGZA 1M53A 3AJ7A 4X22A 3FA4A 2B5UB 2RFGA 4UFIA 4ZO8A 2J79A 1FKBA 4L6OA 1UWAA 1ZALA 4D8ZA 3KTCA 1UC5A 4ZQPA 3VMPA 2BVDA 1ZAIA 3S42A 1Q6CA 2Y2WA 3O5FA 1WDQA 3AHVA 3OBKA 2NUYA 1E0UA 1C7SA 1TYGA 4HK7A 3PJTA 1UP2A 1TJPA 4GGBA 1QU4A 4DJDC 3EX4A 3REQA 4GQ0A 2X2YA 3OIXA 1LBFA 1BPLB 1P4CA 3QQ1A 3M9YA 3S46A 4NSBA 3LRMA 1WAWA 2JGQA 1NQ6A 3U9IA 4IWWA 1X6NA 3FFSA 5IHSA 1K8CA 2OOFA 3W1UA 3GDLA 2X16A 2OSYA 1OCQA 3O8AA 2D0HA 4LBRA 2V3FA 3BLLA 1TV3A 3EBVA 4IG2A 3LRKA 4KF1A 3LV6A 4RDVA 3QC0A 4O50A 3I6CA 4PEKA 4HBKA 3FAWA 3VDGA 2ZCGA 1L8PA 3WH7A 1N8IA 4GYJA 3E6EA 1HGWA 1HL9A 2PV3A 1QK0A 2PTWA 3KAIA 4KR0B 3K46A 3THCA 4XVEA 1TB3A 3WLHA 2WLYA 4KW2A 1M7OA 3N34A 4W7UA 2D3LA 2KFWA 3UJEA 1I9CB 4GINA 5G4WA 1V02E 4MSSA 4PC8A 2PLCA 4D1IA 1ISVA 4JKLA 3TP4A 4D6DA 3L4WA 5TAOA 4H9UA 5K9XA 5ABEA 5CC3A 4EPEC 3VFLA 4IUOA 4V33A 3TSMA 1KFCA 4NX5A 3UWWA 5BRBA 3LCWA 2XGZA 3AISA 3D47A 1VB9A 2V68A 4INFA 4LNYA 1CBGA 2VGIA 3XINA 3EB4A 4TIMA 1CGVA 2R82A 1V03A 2DSZA 3EWZA 5D2VA 4F0MA 3AOFA 2UY2A 3RPMA 1TWZA 1VFFA 2DZBA 1LL4A 1LG2A 6ENLA 1GG1A 3PFMA 1RQHA 3HBLA 1XLHA 4CCDA 4O54A 3NWRA 1I1WA 1ITXA 3K2GA 1AVAA 4ZQMA 3NI6A 2NVDA 2YCKX 3E12A 3SY8A 4UOZA 1HF6A 3PUEA 3G1XA 1DJZA 2PWUA 1YTKA 3T78A 3VZXA 2G50A 2QJIA 5FJPA 2WPBA 4R85A 1H0IA 1WXYA 2D9FA 2PB1A 4UFLA 3DHDA 1FKHA 4Q4PA 1DWHM 4AXKA 1ESWA 2LKNA 1TJRA 1JULA 3ARVA 3LHVA 1R9HA 2VYOA 4TX0A 4MYAA 2GVEA 3TONA 3CV2A 2E8YA 3GTIA 1JNEA 1ZCOA 1TIMA 2YX0A 4H7VA 3QR1A 3KBVA 3K30A 1HQTA 2PPGA 4ZVJA 1J6OA 3TAOA 4LAUA 2WSKA 1OINA 1LYXA 3B8TA 2EPKX 4K37A 6XIAA 1UYQA 2J9YA 4C1KA 3APGA 1LORA 1TX0A 3HJZA 2C19A 1C93A 4TXEA 4DNHA 5HINA 4DJDD 2JALA 3N4AA 4PUNA 1F6KA 3GBEA 2VI0A 3GG1A 3B4YA 3R79A 4ZL1A 3R7MA 5C7VA 4O16A 2BTMA 4GI4A 4S3AA 4IJCA 5AHNA 1XC6A 5LIXX 4UNLA 3N3MA 2Y5JA 3AMDA 4JDBA 3M0LA 1B3OA 2OB3A 1RA5A 2ZZ4A 4NVTA 4ZA0A 2NW0A 2OEKA 1S5TA 2PWFA 4JICA 1BTCA 2HCVA 1T5AA 5EMLA 4S23A 3G3MA 3GUGA 2Q8XA 2CCRA 1QW7A 1E1FA 3LBCA 2PA6A 4O1FA 4QNWA 1SJDA 1UJQA 3VFCA 3QSRA 4W93A 3U4AA 4XK2A 3TZFA 3BJFA 2VFDA 4M1RA 1E3ZA 1VCGA 2NQ5A 4EIVA 5U4NA 1B3ZA 2P3EA 1WDDA 3WH5A 4YTTA 3SCTA 5KEZA 1CEOA 4DRQA 1U83A 3FV9A 4GNJA 3LI0A 1IYXA 3MUAA 2ACQA 1J10A 1FFQA 4D6JA 4LAYA 1F40A 4HPHA 2X42A 2F6KA 3GTXA 3NQCA 5BXRA 4CN4A 1OSEA 3MP3A 5U7SA 3H4XA 4LYKA 3B8UA 3C61A 3SJNA 1EX5A 4JL2A 2WVVA 2ZADA 1VEOA 2PRMA 3GTYX 3W37A 3MSRA 3CWHA 4XTDA 5JIWA 3LLXA 3WBEA 1YKWA 4K2SA 3EB2A 5IOBA 3GW0A 1FWSA 2VOMA 4DRIA 4QJ5B 1S3HA 2C1HA 6REQA 3ECQA 4IHCA 4Q7IA 2MNTA 1ZSXA 1AD1A 2J62A 5G1YA 3KOWA 1F3EA 3M0ZA 4A2SA 4DBSA 5H8PA 3L0KA 3N18A 2E25A 2XP6A 4S3KA 2J6VA 1A3XA 4Q8MA 1JNTA 4GGHA 3PPGA 2QCFA 1EOMA 1QNQA 2E9LA 1EGVA 4Q33A 1JDAA 3ZLHA 1KD0A 3KOZA 2Y61A 2H6RA 3KM8A 3VKCA 3RX4A 3ANUA 1YHTA 1KT1A 3AO0A 3TN6A 3EOLA 4IGMA 2PODA 4Q4SA 1GQLA 4FX6M 1UKQA 2XFFA 4Z2GA 4JNYA 2CC0A 3TTQA 2V5BA 5D38A 3W6LA 4HA4A 3H2EA 2UBPC 3TYAA 3WNMA 2P50A 3LI1A 3KP1A 2YBVA 1P0NA 2ZRVA 3DEQA 3OVRA 2DSWA 4XAYA 3VCCA 1NH6A 2CLHA 1LBLA 4A4AA 4I5RA 4W86A 1JR1A 1J6YA 1FCUA 1V08A 1UWTA 3I6TA 3SO7A 2C91A 1UMYA 4A05A 4KRTA 2ZR6A 1UB3A 3WEZA 1NMVA 2GUUA 4BI7A 2ZUNA 1R86A 2WHMA 4MMWA 1JZ5A 1WYIA 3B9EA 5LXEA 2G97A 4YPJA 4PTVA 1W1B1 2QUUA 4BZYA 4GIEA 1XLBA 4MZYA 3PBUA 4XBSA 4YWSA 4I7VA 5EMYA 1UQZA 1SYTA 2REQB 1VLIA 1XUZA 2A6LA 2PUZA 4GUHA 2DH3A 4U2ZA 4PA8A 4C60A 4DYJA 4NRRA 3GFXA 3MP5A 1E4IA 1WZLA 4J3TA 1U1JA 2NSXA 2HMCA 2WV8A 1YDNA 4XIMA 3PBMA 3L2MA 4QIBA 5A69A 1FXPA 3OBAA 1DE6A 1YW1A 1DJYA 1UW9A 2XH0A 4UTIA 4IQLA 3O5PA 2BGQA 1CPUA 3UGVA 3OA3A 1S46A 4J3XA 4S1FA 3FVDA 3N4FA 2H3DA 3K5XA 1DQXA 1HJQA 3SR7A 4AHOA 3TA9A 2HS6A 3IKDA 3NQ7A 4HTBA 3LCFA 1S3TC 1VBJA 4R9XA 3VGBA 3PPHA 3H2FA 3GVVA 5AVNA 2KGJA 1RP8A 3TQPA 3WH0A 5GVJA 1F74A 2I57A 3VZZA 1GVEA 2YL9A 4GUGA 1MRQA 2Z2BA 4IJBA 3TYZA 5C6MA 4HNUA 2PZNA 4IGHA 3NQMA 3IJ6A 2DVTA 4QT3A 3GH5A 3VM5A 3W7NA 3RR1A 3G1AA 1CGWA 5E9XA 1RXOB 3ZYZA 4FO4A 3FVMA 3IARA 5KETA 2YBUA 3IWPA 4WXZA 3T0CA 3PY2A 4Q3MA 4HB7A 1F61A 2PDHA 1W5QA 1YTDA 4IJRA 3GBDA 4AZ6A 4DN1A 3EKGA 3BXWA 2HE5A 1XGZA 3M0YA 1XS2A 3AZTA 2AL2A 3ARWA 2VC7A 1W1PA 4KERA 3STPA 3DDMA 1V6TA 4PE8A 4GVFA 3QR3A 1CGTA 4AFYA 3QOMA 4B9ZA 4L9XA 1QCWA 2BY1A 1JPMA 4R7WA 5I06A 5CPNA 1BSLA 3SRHA 3EEZA 1YNQA 3ITOA 1XP3A 1FP8A 2QR6A 4GABA 3Q58A 1A5OC 4M82A 4BQ3A 3FEMA 1NWSA 9RUBA 1ZZMA 4MY9A 4C5YA 1VFOA 1CCWB 1HKMA 2VTFA 2A79A 2QV4A 2CERA 4L65A 4FAPA 3WZ0E 1UP0A 1JQXA 1UZHA 2Q6ZA 4DUVA 2O7QA 1FKDA 3W70A 5BMWA 3SAZA 4I6KA 2CU0A 4DXXA 3S83A 4E2VA 4MKSA 4O0QA 5FSEC 4J3UA 4QG8A 4DZ3A 1Q6RA 4CGTA 3RITA 4KEMA 1H1ZA 3E0LA 3N3TA 3G1HA 3VI2A 2BY2A 4ODMA 5E1QA 5DRCA 2VCCA 3DN5A 4HK6A 5G1MA 1EJXC 2VCBA 1P1XA 2HK0A 4CLMA 4B3LA 4RE0A 4S2BA 3I3EA 5B80A 3JR2A 3KWXA 4WGXA 3R8GA 1GOKA 3W7DA 4JTAA 2BGSA 2DEPA 4GUJA 5F2LA 2NXIA 3EOUA 3KL5A 1W9BM 4YLWA 3FCPA 3S4TA 4CEXC 2DDXA 1WE5A 4OIFA 4C91A 1B9BA 3GW3A 5CCZA 3WLMA 3PTKA 4JTSA 1JZ3A 2GJXA 1GVIA 2OYKA 4O12A 4HBOA 2DU2A 3IGXA 4HYRA 2PLKA 4JL1A 1UH3A 4A8LA 1JZ8A 3WJSA 3F5LA 4QTGA 2OSXA 3DU0A 4E8CA 2A0NA 2IPFA 2HK1A 3HF3A 3MWAA 3MDUA 2F7FA 3KHDA 3CMFA 4KT2A 2DZPA 4DRSA 2C7FA 3PBYA 2XN1A 2WZTA 2WKGA 1OYCA 2Z27A 1FD9A 2BASA 3TKFA 3T0DA 1B0IA 1XLFA 3W4RA 3BG9A 3G6LA 4NI3A 3OLIA 2HBVA 3UGRA 1R9ZA 4IT6A 4G56A 4IT4A 4RCXA 4WY0B 2F2KA 3ALGA 3K13A 4MKNA 3VNZA 1Q6QA 4GJIA 4UMAA 2O9PA 1UIPA 4GYPA 3M4HA 3GZAA 1XDMA 3A4XA 5FL0A 7REQB 4A22A 3AUOA 3UNDA 2HXUA 1XLEA 2QLYA 1F6YA 2MANA 4NYUA 1Z7AA 3QW3A 2Q01A 1WCGA 4CD6A 3GAYA 1RBOB 3U8GA 1EWDA 3LRLA 4HSOA 5HQMA 4CNTA 2BDQA 1D7JA 1Q6HA 1PTAA 3VNLA 4ERAA 1OGBA 2VEPA 4H8NA 4LS2A 4HZ6A 5A2BA 4BY3A 2E5CA 2YBTA 3UR8A 1MWOA 1TV7A 3LN3A 3A12A 2KR7A 1SPQA 3S5NA 2Y8KA 1OFDA 4NAFA 3FS2A 2IKIA 4F0HA 3EA3A 1EB3A 2FHBA 3O1NA 4QQUA 1X7FA 2DT3A 1JXKA 1RZMA 4AD2A 5EYWA 4AY7A 2OT0A 1ZQ5A 3IIXA 1FP9A 1M65A 3LX9A 1VS1A 4FI4A 5D2WA 3A5FA 5LNUA 1JG9A 4H9ZA 3WBAA 5A2CA 3B7XA 1GOMA 1ZP3A 2BLEA 1S5VA 4Y6GA 1OK6A 3TLLA 3O07A 3RM8A 2FTPA 4G7EB 4IQ2A 4N4QA 5T9BG 4PUUA 5DXXA 2X41A 2ZUTA 1KBBA 2PZ0A 3BCJA 4AD1A 2XIOA 4J7RA 1T8XA 1IXNA 5GNYA 1TTIA 2NX3A 5A95A 1H5YA 2QQ6A 3GU2A 4XX6A 3VKJA 9CGTA 2VEMA 1B9ZA 3EYPA 4OBSA 1PSCA 2FFIA 3LHTA 2QULA 4FP1A 5KINA 3WLQA 1HO1A 2ZBTA 1TTPA 2XH2A 3DECA 3ARZA 1XDJA 3DUGA 4E38A 3PRAA 1K4GA 3WFLA 2WJZA 4F8XA 5ECVA 3POCA 1Y5VA 2XP8A 2YA0A 4DJFC 5LXXA 4WCJA 3GB6A 3GE7A 3IIPA 1NJJA 3S3GA 3NQEA 4YIWA 1EEPA 2AKMA 4ZBCA 4Z2KA 3WJXA 3T9PA 3NZ1A 5CJ5A 2ZRUA 4OQVA 5FIPA 2A4AA 1XRTA 1Y0EA 2HPIA 2J66A 2VEIA 1KO0A 1MXGA 1B31A 2AWGA 3QV9A 1IGWA 1OJXA 3I7QA 2WZEA 1W1VA 2QCGA 2DZXA 2J13A 3VUSA 3OYXA 3TWAA 2O9TA 2M2AA 3I3BA 5AHFA 3O5OA 1UH2A 3ARUA 3OGSA 3WJZA 3KX6A 2GK1B 3DFHA 3GYCA 4JTGA 4M6UA 3OA5A 2I17A 2OO0A 3TAKA 2VHLA 4EP8C 4AX6A 4QHRA 1ZRQA 3GHUA 3H55A 5I79A 3ZOAA 4PULA 3MY9A 1V0MA 3L5MA 1XUUA 4DZ2A 1XRSA 3THUA 1Q3NA 1E6ZA 1PINA 5G2HA 3V0TA 5L9FA 3CUGA 5I3JA 3W7HA 1RV8A 4DLMA 3QGAC 2WHLA 4L6DA 3NQVA 2FGLA 3HGJA 3LM7A 1XYBA 2Q09A 1K70A 3LQGA 4QDMA 3MVIA 4C6CA 1AZ2A 1TCMA 4JFIA 1CLKA 4JTRA 3H6OA 3NEVA 1BKSA 2ZRWA 2IPJA 3MYPA 1CXKA 4B92A 2QW5A 3L21A 4GIVA 3M1ZA 3WMLA 2A3BA 2EPHA 1MYRA 2RH9A 3JYJA 3IUDA 2CIPA 3CS2A 3WMSA 4CD8A 2TPSA 1GOXA 4LANA 4BQ4A 1QI5A 1D7FA 2ZDRA 5BRQA 1LOQA 2RUSA 3OIHA 3HA1A 2V67A 4N9CA 4FB7A 2NVCA 1XGDA 3W2UA 1KNWA 1WBHA 3GQYA 4H7CA 4UQ9A 1EJSC 3W2NA 2Q02A 2J8FA 3FYOA 3WQVA 1IHIA 2PCQA 3CB8A 4XO7A 1TJ1A 4UTLA 3CNYA 2E7FA 4NZ1A 3ITVA 3EWWA 3TU9A 3NYZA 4HHLA 2WANA 1H7OA 3C2RA 4XZWA 3HN3A 4X9YA 2MUCA 2QJMA 3UR7A 4GCAA 3EPNA 1SZNA 1O6IA 2NWSA 4XAKA 1E9ZB 1ZAJA 1TVNA 1BYAA 1I2RA 4UR7A 3MMTA 1GVSA 1WA3A 8A3HA 4C7FA 2XSXA 1IWPA 4JBRA 4FPSA 3RXZA 3F2CA 4KGLA 3BGGA 3CO4A 3ARYA 5FAJA 4PTMA 1W5PA 1JL8A 3KOYA 3AXHA 3FGCB 1WB0A 2HSAA 3HV9A 1A3WA 2W62A 1XIBA 2ZA2A 1LF1A 3CTLA 3P3BA 5BNKA 2ACRA 3PM6A 4OOZA 3VX0A 4E2BA 3MW7A 1VD6A 5D4YA 3CASA 3MBDA 5BXPA 1WPCA 1MW0A 4DWSB 1I6NA 3AMKA 4CD4A 3VO0A 4S3GA 4DJFD 3RJYA 4P7LA 1YPIA 2J7FA 4UOJA 3EKZA 3ENLA 1DJHA 3F1QA 5CC6A 4ITZA 1IZKA 5D33A 1QBAA 2QXWA 2ETNA 1KXTA 3BMBA 1AJ0A 2EXOA 1O1ZA 1GKQA 4HIBA 4RE2A 2PS2A 4GPNA 2F38A 4QDPA 1LCOA 4F9DA 4LVBA 3MI2A 3O2LA 1F8AB 3TA6A 2PE4A 1IWAA 3HQOA 4DLFA 1WOAA 3LOTA 1W9XA 5CPOA 1VEMA 5A3HA 5M5DA 1DWAM 2P53A 4ASTA 2Z7KA 1UR4A 3VIIA 1KM5A 1R2TA 3UY8A 4Q8TA 2DGAA 2X8RA 5EL1A 3O6YX 3W1QA 4CEUC 3S0CA 2CXGA 1EA9C 3NOEA 4JIQA 4ZOAA 2ZX6A 2IQ0A 1PYFA 2UV8G 4JCLA 1K4HA 1PWMA 2OG9A 4ACZA 1NDZA 3R0KA 4JY8A 2Z0IA 4ZODA 3PPCA 4PN2A 1VJSA 2GJNA 3O0FA 1G1YA 2J78A 4GVHA 2BFGA 1FHUA 1SFLA 5CGTA 4FOKA 1RCXB 1VYPX 1CXFA 2IXUA 2V82A 4B2DA 2QDEA 3RO6A 1K9EA 1OF8A 2W27A 3BV7A 4C02B 1POKA 3S2LA 1GK8A 3SCOA 1E0TA 4FF5A 5HMSA 2QJGA 2Y70A 2BY3A 3AFBA 2Y1HA 3DESA 3QH2A 4DX3A 1F8IA 4BHYA 1M6JA 3PJUA 4REQB 3EOSA 4B3ZA 1DEDA 3IIOA 4PMNA 2J7GA 2PF8A 3TUUA 2ISFA 4FNTA 3CBWA 2OWWA 3HM7A 1DIDA 5IDIA 2ZE3A 4S3BA 4MSPA 4O10A 3WNLA 3QPYA 2I1OA 1W3IA 3QY7A 4M3PA 1XIEA 3CJPA 2J8TA 2PGFA 2D2HA 4GI8A 4ACYA 1B2YA 2YFNA 1HJUA 2PGRA 2GDQA 4S3CA 3VD5A 2HVMA 4FXFA 1JNDA 4W9TA 5E0KA 4PODA 2VCAA 5BMXA 5A1AA 3HG2A 2Y78A 1KV5A 4AB4A 1OFRA 4EK7A 4D8LA 3B0YA 3MUCA 2WNWA 5HUAA 3P80A 2AKZA 3LV5A 4HYVA 1QO5A 1PL9A 3KBNA 3W7CA 3LCHA 5DIVA 4S38A 3BLDA 5FJOA 4OBTA 5IFTA 2OWCA 4HSNA 1H60A 4P7QA 1PBGA 3EEGA 2ZTJA 3VIMA 1UZDA 3QFWA 1IIGA 5AHMA 1JDDA 3FSUA 5D2XA 4ROPA 1PTDA 5JH2A 1ZJAA 5MF5A 3CH9A 5JU6A 1EHAA 1BVZA 1VKFA 5I02A 1XFBA 2FKPA 2BGNE 5FL1A 2YLLA 5B8IC 1XJBA 2AOSA 3VZYA 2OVLA 4JYFA 2OFNA 4OECA 1YW5A 4O18A 3BARA 4LAMA 4O53A 1IGSA 1VIZA 3CQJA 3CUHA 3V0UA 4NAEA 3TTOA 2TSYA 1A49A 3ONCA 3F4WA 4J27A 4ZTYA 2PBOA 5K7JA 4M24A 4J4OA 1GW9A 1XIFA 3Q4DA 1QK2A 2WWDA 2ZXQA 4U31A 3W02A 4Y9MA 2ZRXA 1LWIA 4IMCA 3V5FA 5FJJA 5C9RA 4NZ5A 1EYEA 2MNRA 1X8FA 1UUMA 2I7GA 4BWLC 4MB1A 1C8VA 1FFRA 4PUWA 3E0WA 2GJLA 4FZIA 5E5CA 1I0BA 2C8NA 4AEFA 4D2JA 1H7PA 4DIAA 1KRAC 4HOZA 2X1RA 4IP4A 3QLDA 5EKYA 2VGBA 2CZEA 3FNDA 2QGHA 3WDJA 3CV6A 5CZJA 4WSHA 2GQ8A 2HJPA 2HQAA 4D6IA 4ZOEA 5FEXA 1US2A 3W1MA 1PEZA 1ZJHA 1ZL1A 4GKLA 3HG5A 1POJA 5C70A 1UR0A 3CZLA 1IEIA 3SIMA 1X7IA 1K8YA 1NWUA 1H7NA 4MM1A 5DMYA 3E5PA 3O9NA 4LUTA 4MOZA 4R33A 5E09A 1QT1A 2Q5AA 3BTNA 1O12A 1B3XA 1QPFA 1OC5A 2CYGA 1FWTA 1RHCA 1KFLA 3FYYA 3PK7A 1OX4A 1LG1A 1LL7A 2W6RA 4TYOA 3BQ6A 1QVBA 4MFDA 2B7PA 3PA7A 4MZ8A 1JJKA 3WYZA 3D3AA 3GXPA 3H4WA 4WDWA 5E93A 3O05A 4AYGA 2PDIA 1JD7A 3WFAA 2KZHA 1FWEC 3CIVA 4S3FA 3TWBA 3W82A 4B3KA 4PRTA 3ARSA 1E71M 3W6YA 3B05A 2YL8A 4CNUA 7PTDA 4J9JA 4KCVA 3LS9A 3VGDA 3OZMA 4UTTC 3CC1A 4K8EA 3W2LA 3GG0A 2WKJA 2WPGA 2JGYA 5I2UA 2WWCA 3V3WA 1EC9A 4AY8A 3IVTA 1W6TA 4DQWA 4JFMA 2NQHA 2J7DA 4QITA 2PDBA 3TCSA 3T0TA 1BG9A 3R2GA 3S2JA 1N2VA 4LTSA 1DBTA 3U57A 2JIEA 5C2XA 2OQYA 1UZ1A 5D9NA 2R24A 1O1HA 5LA1A 1PS9A 3V36A 3HFYA 3NQAA 4JTCA 1UWIA 1NDYA 1Q6EA 3EXRA 4O0KA 4GY1A 2E4TA 4UTJA 1ZGDA 2DVUA 2BS9A 1LTDA 3WD1A 1EC7A 3UA3A 4A2RA 2OT1A 3UXKA 4IMEA 4DZAA 4NILA 3SN4A 1PKLA 3POHA 3YPIA 3TC5A 2ALRA 2FKEA 1UWRA 3ARTA 2ZUVA 3QY6A 3KCLA 1TPH1 4CD7A 2DT0A 3UG3A 5CAHA 1R3SA 1PX3A 3AWNA 3W1LA 3LCXA 4GJJA 5H1WA 4QEEA 5HPCA 2AQWA 4TW8A 1EFZA 3N2XA 1NFBA 3WH9A 4JQ1A 1TA3A 4ENLA 5BWFA 2A2IA 4L6HA 3IKGA 4X0NA 3THQA 2QPUA 1EKOA 1FDYA 1BQGA 3ARRA 3A4JA 4DO4A 3M43A 3K1GA 1WKDA 1G7VA 2Z1KA 4NJGA 1UH4A 1Q6FA 3VC5A 2YCLB 5EBUA 1RK5A 4A3RA 4NQ1A 4WOQA 2GPTA 4IQDA 3AXKA 2VWSA 3QHNA 1A0CA 4M51A 1XD1A 3S9ZA 1OZQA 5CQ1A 5XINA 2IKGA 4QJ4B 4AZIA 2QVNA 4PTWA 5C71A 4UTWA 3OGVA 1R30A 3T4WA 1L9WA 3ZSTA 3G0UA 3NFUA 3RFAA 1AL7A 1UIOA 2C79A 4NZ3A 4TO8A 2Y62A 4GO8A 1J5TA 5CJMA 4IPXA 2GOUA 3EA2A 3PWIA 3ISIX 1A4MA 3JUGA 6CGTA 3W2JA 4WIWA 3TOPA 5HJLA 1WDWA 3W1TA 4ZPVR 1H7XA 3ARPA 5HQLA 3EX2A 1XIIA 1ZP4A 2C71A 4GVIA 3RN6A 2DFAA 2OZ3A 2GLKA 4O4WA 1MEHA 3P0WA 3RHGA 4HPGA 3T0AA 2JIWA 4IQEA 1G6CA 1KM6A 2PP0A 5HDRA 3UPBA 4K7VA 4AMAA 1DOSA 3RPTA 4LWWA 4HJFA 3CAWA 5HW7A 2LGOA 1D7IA 2WW5A 1TVLA 4TVCA 4HVXA 1D8CA 4ZB5A 1UPPA 1UMLA 3W7IA 4EXAA 1KFJA 2GOKA 1ZHAA 1Z32X 3ODKA 3T44A 1AQ0A 4D9PA 5FF4A 4LPCA 2WVTA 1HUVA 1XLAA 3TJIA 1KCXA 3NZGA 1UG6A 5I77A 3HQPA 2VOTA 1XSJA 3QLLA 4ZB0A 2GGEA 3SEPA 3W72A 2XP7A 2YYTA 3V1PA 4FOJA 4RPQA 3N2MA 2RJHA 3S47A 3BUVA 3IUIA 1EYMA 3C56A 3QOKA 3VOGA 1Q65A 2QJNA 1Z69A 3L4UA 2PEVA 2O9RA 5AC5A 4DJDA 2BBFA 5M03A 3TYEA 4WDXA 1MXSA 4CNOA 2E5DA 4WGHA 4NNRA 3UWEA 3EMZA 2OEMA 1Q63A 2WXDM 1SZEA 3VU2A 5FCZA 3W7GA 1AJZA 3IJLA 3RCMA 4NASA 1V3KA 3LGDA 3MI6A 2R1LA 4F4RA 2X09A 3GXNA 4LCQA 2E6DA 5XIMA 1BWLA 3A3XA 2ZVRA 5F4WA 4GRSA 2JKEA 2Y8UA 3LEPA 4E4FA 4G7FA 3QV7A 4Q4OA 3KAOA 3H8AA 1RSCA 3PAOA 2ZQSA 1TRDA 3L4XA 3PTDA 3W27A 1H62A 4FLQA 4AIEA 4L4MA 5BXTA 2VC5A 1IZCA 1ICPA 2AAMA 1BGGA 3VCNA 4JYSA 1TR9A 3NPXA 2BB0A 1GOQA 3BE7A 5EGRA 4O1CA 2Y63A 1NY1A 1E43A 3OP2A 1G4EA 5J04A 9XIAA 5EFFA 5TD4A 3UQNA 3CB3A 3O6DA 4RK8A 4O17A 4UQEA 3S2MA 4R0XA 2ICSA 3KRSA 4J3ZA 1ZBWA 3BW2A 3QRHA 1PO9A 3J7HA 4Y2WA 1JCYA 1JCHB 3UP8A 1B30A 2OEJA 1JUKA 3WG6A 3B8SA 4D8AA 4DRMA 1BFNA 1W37A 3W83A 4QE1A 3WBYA 3Q65A 3ZM8A 5HNUA 3M47A 4RUBA 3GDRA 3C6CA 5D32A 3W1NA 3IJQA 1QPRA 1BVWA 1JAEA 2R94A 4QQ3A 4B5XA 1W3NA 1B3VA 4ZMGA 3W2MA 8CGTA 4JFKA 1E6QM 1Y5WA 3CTTA 3OOBA 4GNKB 4KQNA 3M5ZA 1CIUA 1M3UA 3N19B 3GH4A 1G4SA 1MEWA 4TTGA 3ITGA 1XLDA 1CXEA 4DZ5A 2QAFA 4UNKA 4XSMA 1V7YA 1X6UA 3A3HA 2VD8A 3DFOA 4GFSA 4B4HA 1HW6A 1NSJA 3GXMA 3R4IA 3W87A 2J27A 3BL3A 4Z1YA 1E5JA 2QMKA 3CWOX 1UKPA 2V5JA 4IMAA 5D75A 1DXIA 5KTLA 4W89A 3R6IA 4I5UA 1X1NA 4KBXA 3U2EA 1AW5A 4I8DA 2BVWA 1GVOA 1HZYA 3I4EA 5FF3A 3PUGA 1XICA 1C8XA 1QOXA 3GDTA 3R12A 3GC4A 3P62A 3UT0A 1F73A 1ONWA 3AHXA 3MYOA 1F7BA 2OX4A 4W84A 3TSBA 1UD8A 3CL8A 4UB9A 3WD4A 3GD6A 3W3OA 2PV2A 1TPFA 2BY0A 5AC6A 3KAHA 3MVTA 1A5CA 4IX2A 1J0YA 5JBFA 3W7QA 2VP8A 5A8MA 1SM9A 5REQA 2F84A 3QGVA 4FLOA 1CENA 1TPVA 2BODX 2EPNA 1JUEA 1A0DA 3M6DA 3VIPA 3WUGA 4MJMA 1EZWA 1R3TA 3ZQ9A 2YOCA 4IFKA 3RG6A 1SO6A 1T40A 3KRZA 2WYSA 3WX7A 1EEXA 1FQ0A 4W9QA 1J4EA 1L6SA 5KITA 3HMCA 3W1XA 3LCLA 5D02A 1S2TA 4NJHA 3W85A 3VKKA 1MUMA 1MNSA 3RF9A 2XN0A 1V6VA 2XIIA 2EG7A 5HJYA 5BOOA 1X6LA 2CPUA 4HBEA 2YA2A 2NLIA 3VGEA 3W81A 5AYXA 3VKBA 2QYGA 3UZWA 5BYWA 1KT0A 4DXKA 1EF2A 3UG4A 3SGUA 2DT2A 3GC5A 5ABFB 3LZ5A 1XCFA 2P76A 3O15A 3T2QA 1L1PA 5KMYA 2GVJA 4CNPA 3AXXA 1V3MA 2PDCA 3N25A 4QE5A 4HA1A 7ODCA 2NXGA 2XIJA 1ZU8A 1WQ5A 4FMVA 4TX9A 5TF0A 7CGTA 2QDGA 2C0HA 2FZ9A 3HPXA 4Q7BA 1T7LA 4FALA 4I9JA 3CO8A 2QDDA 4PFHA 4UXDA 1K02A 1VCFA 1Z44A 1VY