4NSBA

Crystal structure of the complex of signaling glycoprotein, spb-40 and n-acetyl salicylic acid at 3.05 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of signaling glycoprotein, SPB-40 and N-acetyl salicylic acid at 3.05 A resolution
rcsb
molecule tags Signaling protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4nsbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4nsbA01
5E70A 3AJ7A 4XZBA 2BVTA 4IPNB 3VVGA 5IHRA 1B1YA 4U3CA 2GJRA 3AIVA 1C91A 5DF0A 3IANA 2NSXA 3ARUA 2V3GA 2YDRA 2WMGA 4PTWA 1WZKA 1OGBA 3BCDA 2E8YA 4W8BA 1BVNP 1HJUA 2XFRA 4QP0A 3RIKA 4PTVA 3SCRA 1UR1A 4GI6A 1WDRA 3A4XA 4M81A 3RJXA 1EO7A 2WBKA 3I3DA 2J62A 3VIFA 2ZXAA 2J8GA 3AICA 4PMQA 3N13A 5E0FA 1V6UA 4CCDA 2J75A 3D5HA 2BVDA 4W88A 5I2UA 1M03A 4W5UA 3DHUA 2GFTA 2VC9A 1BQCA 1XSIA 5HXMA 2VOTA 3WF0A 5C71A 3UG4A 4TVUA 4AZHA 4KWUA 4J3WA 5M17A 1JI2A 3SEPA 4LPCA 1GHSA 3CLWA 3U5YA 1JZ5A 4OBRA 4J3SA 1V0MA 1C92A 5LA2A 1C90A 2O9TA 2XPKA 4B15A 1W9PA 1OGGA 2PI6A 4YHEA 4BS0A 5JIPA 1TFVA 3CHDA 3CZGA 1HIZA 4PMXA 5ABGA 2VCCA 3WNPA 4X0NA 4AEFA 3K8LA 2Y8KA 3TOPA 1HX0A 3W38A 4OJYA 2VMFA 4HP5A 2E9BA 4UQDA 1KFWA 3AYRA 1JAKA 1Y7VA 2XM2A 1E4MM 4X9YA 1HVXA 1GQIA 2CCRA 2OYKA 4PMUA 3NSXA 3AIWA 1WO2A 1CXIA 1SR0A 2F8QA 1PPIA 3WH9A 1BYAA 4IPLA 2BHZA 3IJ7A 1QNOA 4Q7NA 5ABHA 2EPLX 2DH2A 1TCMA 3VNZA 1OWQA 1Q4NX 4JCLA 3ZMRA 2CERA 4AD0A 4V2XA 4AZGA 2XGIA 4EKJA 3EDJA 1WZAA 1ZBWA 3FXYA 1FP8A 4C7GA 4CD4A 5CQ1A 2E3ZA 2QPUA 3GXDA 2UWFA 2CNCA 1L0PA 2WKGA 4HOXA 2XYLA 1E9LA 4AD1A 4LYPA 4GKLA 5AC5A 1KBKA 1C93A 4HA4A 3PHAA 3DHPA 5FD0A 2UY2A 4W8LA 1KR1A 1V6XA 3WQ4A 2EPMX 1E0VA 1C3FA 3K1DA 2VL4A 4AZ6A 2VI0A 1DTUA 5A6BA 4IM4A 1KB3A 3W27A 3ZJ8A 1CXFA 3CZEA 4P8XA 1SYTA 1AQMA 1E6XM 1MWOA 3S6TA 1UA3A 3N1AA 5JUVA 3EDEA 4FK9A 3W6MA 5JBEA 3M07A 3A47A 3VIJA 3F4VA 3SUSA 2QMKA 1NARA 3U7VA 2E40A 4UZUA 5A2CA 1UH2A 4XUYA 1B9ZA 1UUQA 3AROA 1UKQA 3N18A 1CEOA 2ZOXA 3WNLA 3WENA 1JD9A 1WZMA 3ZJKA 4CVWA 3VU2A 1WAWA 1JGIA 1R8LA 3MV01 1G01A 4PRWA 3TTQA 3PZUA 3UERA 1J11A 2Z1SA 4B3KA 1FFQA 5EBAA 2DSWA 2WLZA 3MS8A 1MFUA 1EHNA 4DWSC 5IXEA 4JCMA 4OUEA 4D6DA 4CD6A 1K9TA 5D8ZA 3RO8A 2V5CA 4LX4A 1B31A 3POHA 3VGBA 3VIIA 5BRQA 2OSWA 1R7OA 2EBNA 1V3JA 2ZUUA 4UOJA 1LF1A 1GNXA 1XYZA 3LPPA 1KQYA 2Q8XA 1W2PA 3B9DA 2W4XA 2WWCA 4C7DA 1W91A 3UR8A 4URIA 3EDDA 4AZIA 3GH7A 2CYGA 1HVQA 4MPKA 6TAAA 2W92A 1Q6EA 4AYSA 1J0ZA 1BF2A 1JI1A 1UOKA 3IAQA 3CHFA 1BGAA 4DM2A 4RE3A 2DDXA 3TA9A 2J78A 4Z2LA 4ZE5A 3AIQA 5M3WA 3A4WA 4W7UA 1B3VA 3U57A 1CBGA 3O6AA 4D71A 2W91A 3OLIA 2WC3A 4JFTA 5CZKA 3NDZA 3WD0A 1WPCA 1IV8A 2FGLA 2DH3A 1E1EA 2Y8VA 2YBUA 4EANA 1GJUA 1MQQA 3PZTA 1H5VA 3VNYA 4XX6A 3RILA 2D0GA 2A3CA 5BXRA 2BHYA 2CBVA 1EO5A 1JDCA 2XWEA 3VPLA 3SCOA 2WCAA 4B9ZA 2O9PA 3IJ8A 2BXYA 2DSUA 1FHDA 3EMZA 2WHLA 2X8RA 1VB9A 1E71M 3UESA 4U3AA 1YQ2A 2VZOA 4FLOA 1VFMA 1ISXA 2D24A 1BHGA 3ECQA 2WC4A 4P8VA 2O92A 2UY5A 3CUGA 1U33A 3NSNA 1UA7A 3PZ9A 1I1XA 2OSXA 2YA2A 1SFSA 4TX6A 3BXWA 4S3JA 3CMGA 3RPMA 1CZ1A 3TONA 1V6WA 4ZXLA 3NYDA 4JKMA 3CHCA 3BLPX 2J7EA 4WSJA 5D4YA 1C8XA 4HZ6A 4NRRA 3O2LA 1EOMA 1UZ1A 2WYSA 1TMQA 4JHZA 1TVPA 2XHYA 3G6LA 4FMVA 5FIPA 4ZENA 2HISA 1TE1A 2PB1A 5DO8A 2A3AA 2EPNA 5F7UA 1QNSA 4PMNA 3QR3A 1DWGM 1JZ8A 2VCAA 4GQQA 4N0RA 3CHEA 1IT0A 1QI5A 1UQZA 2VR4A 3AYSA 2DPEA 4AC1X 2VX4A 4U31A 5BCAA 4UFMA 5C8BB 3VO0A 2XVGA 2WMIA 3QHMA 5A94A 1BGGA 3VDCA 1QPKA 4M24A 3ZOAA 1JDDA 3POCA 1XSJA 3AHZA 1H11A 1UD4A 1W32A 4H8VA 1XSKA 2WHKA 3VGDA 3AIUA 2PWEA 4RL3A 1JG9A 4RE2A 3HJEA 2OWCA 3MV11 1G1YA 1JZ2A 3PN8A 4PEEA 4P7NA 3THCA 3T08A 1MYRA 3BSHA 1GPFA 2NT0A 4Y7EA 1OD8A 1WB0A 2WW5A 2DT3A 1E70M 1CXKA 3AHTA 4PMVA 4GO9A 3ARVA 4TVDA 1VJZA 2CHOA 3TTOA 5IFTA 3VIGA 1US2A 2ZICA 4MJ2A 3VM5A 3PTMA 4UOQA 3ZO9A 3WD3A 1H09A 4PCSA 4Z2KA 4JFUA 4MB4A 1XCXA 1GHRA 1CPUA 2W66A 2DT2A 3LMYA 3LPFA 4NF7A 4ATWA 2A3HA 2X05A 4BZYA 4MAZA 5GNZA 1E3ZA 3THDA 4UFLA 1UG6A 2WMJA 1GCYA 5CSUA 1GONA 2Z1KA 3IJ9A 3MUIA 1PX8A 4U5IA 1HKIA 4D1JA 1UKTA 1J9YA 1MW0A 3WMBA 1W1TA 2PWFA 9CGTA 1QW9A 3EMQA 3DYMA 2JIEA 2YDSA 3I3BA 4AMCA 2W61A 1AVAA 1IZJA 2G3JA 3WDQA 4D6GA 2UY3A 1UR8A 2ZX7A 3HU7A 5AYBA 5CPQA 1XD1A 3MU7A 4W85A 1R85A 2VX5A 2WXDM 3PZGA 4MAVA 1JXKA 1W9BM 2XG9A 4GZJA 5FCZA 2DEPA 1VENA 1JF5A 2V38A 3KL0A 1OM0A 2J25A 3KL3A 3SUTA 1UH4A 3N04A 3SCNA 3WL1A 1AQHA 3BAWA 3WD1A 3OZPA 4PMYA 3AXHA 1KR0A 2XFYA 4YN5A 3CUFA 1UD6A 2V3DA 4J3TA 1GQJA 3CIVA 3T0AA 1K9EA 1V02A 2CKRA 1UZ4A 2EO7A 2ZUMA 3PZMA 1CGVA 1ZB5A 1GORA 4NSBA 2YLAA 3CMJA 3F5JA 4P8UA 2ZXDA 1UR4A 5M03A 1EOKA 2J77A 1CENA 1XRVA 2VUYA 3L4VA 5HPOA 4W86A 3WMCA 3CBWA 3AHYA 4C7FA 1HJXA 3CO4A 3VD3A 2EQDA 3QOKA 4J3VA 1G9HA 4JHOA 1B3WA 5GQBA 2NW0A 3N12A 4D6HA 1JFHA 3AQUA 1V0LA 5D8WA 3ARRA 1V3LA 1W3HA 4QCEA 2F2HA 3WDRA 2OWWA 3DYOA 2X1IA 3CUIA 1BYDA 1CTNA 5HDRA 2JE8A 5LYRA 4LQ1A 1BTCA 3VIMA 1H0GA 2WVVB 3PTKA 4CUCA 4Z2IA 3UG3A 3AS3A 2GUYA 2YDQA 1KXTA 1VFOA 4AIEA 3CTTA 3WH6A 4W93A 3L4XA 1E5JA 1W9DM 5I78A 2JEPA 2ZXBA 4GIAA 4CN1A 1GW1A 2VR5A 4CN4A 3ZQ9A 2D22A 2FHFA 3VD5A 3W26A 1YHTA 3UEQA 1J0YA 1VIWA 1F4AA 1E0XA 1UWTA 5CLWA 2DSKA 4DWSB 3WQVA 2JF6A 5AYIA 5KZ6A 5A8QA 3GM8A 2CBJA 2EJ1A 2FGZA 1XH0A 2WVVA 3CUJA 1JNEA 3W37A 5I5RA 3GXMA 1VAHA 4UOZA 4E2OA 1H0IA 3SCWA 1PX3A 3ARQA 4QLJA 1HT6A 3QOMA 2J7CA 4IISA 2Y2WA 1LJYA 2WAGA 1O6IA 1KBBA 3NIYA 3NUKA 3ARWA 3OIHA 5EFDA 1CGYA 4AZ5A 4PMRA 1JZ4A 4DWSA 5ABEA 2VVSA 1JFXA 3EYPA 5IDIA 2Y5EA 1DWFM 1KXVA 4WIWA 4M80A 3SCUA 3SIMA 1GOMA 3U5UA 2D3NA 2YL6A 3O9NA 1H41A 3WUGA 1FH7A 2XWDA 4GO8A 5FL0A 3PZVA 2GVYA 1QOXA 4WF7A 3VIPA 3SURA 1KGUA 3K8KA 1CLVA 5E6YA 5LA1A 1B3ZA 3AIRA 2CIPA 2OYLA 2EXOA 4M29A 3L2LA 4GZIA 4TXEA 3WUFA 2WC7A 1EA9C 4BQ3A 4M56A 1OBAA 3BSGA 1EQCA 1D2KA 1ZJAA 5A2AA 3WQ5A 4JFSA 3RJYA 4UZSA 4YPJA 6CGTA 4PMOA 5CXPA 4H04A 1HJWA 1X6LA 2ZUWA 3W81A 2XTKA 1HXJA 1LL4A 3VGEA 1E72M 1WKYA 4D6EA 1MW1A 2WKLA 3MMWA 2YIHA 4WJXA 1V02E 4CCCA 4MJ4A 1ISVA 1EH9A 4AZBA 4S3KA 2ZUNA 1UWSA 2XSAA 4QLLA 1UH3A 4WKAA 3L4TA 3RM9A 2VNCA 2XVLA 3VMOA 2G3IA 2Y24A 1B3XA 3WEZA 1QI0A 2BNJA 2E4TA 5DMYA 4TX8A 2V3EA 1JXJA 4MNKA 3W82A 1K9FA 1V3IA 1QI3A 1NQ6A 1VJSA 5HBFA 1DEDA 4AZCB 1C7SA 5A6LA 2VZUA 2FDMA 2JF7A 5FOOA 3K46A 2G3NA 3ZR5A 7CGTA 3VKKA 3UG5A 3MANA 2WZIA 4B3LA 4GI9A 3CPUA 1H49A 4V28A 3WDHA 1JD7A 2PWHA 4ATLA 1EHAA 1OINA 4ZFMA 1OIMA 3MSDA 2XFFA 1PX4A 3SCSA 3AIEA 4EAMA 3GBDA 5BYWA 1NWRA 5A6JA 1QVBA 1D3CA 4HPGA 1QBAA 3W24A 4ACZB 4NRSA 4UCFA 1CXEA 1LWJA 5I23A 1FH9A 1NP0A 1PZ3A 4CU7A 4AZCA 3VIHA 3ARSA 1MXDA 4B16A 3RM8A 2W63A 3VGGA 2VZVA 4V27A 3VD9A 2XIBA 1CXLA 1E6SM 1GUVA 1OGSA 1HNYA 1E43A 4J27A 1KWKA 4MDPA 1ZBCA 4PUEA 1BFNA 5BROA 3WFZA 4D72A 5D9OA 1DWAM 4CD5A 1G0CA 1RPKA 4AD5A 4ACZA 4BQ5A 3OLEA 3BMWA 1CDGA 1GQLA 2WSPA 3FN9A 1JYVA 2PBOA 4CVUA 3K4DA 4EE9A 3WF3A 3VDHA 2D3LA 1V08A 3WNNA 5I79A 2J79A 1PJ9A 4QAWA 3WDJA 3DC0A 2O9RA 3WN6A 4EK7A 4HPHA 1R7AA 1EDTA 1GVIA 1UR9A 2VCBA 1CYGA 1GOWA 1UWQA 3VINA 1G94A 1W2VA 1FFRA 1JZ3A 2WSKA 1W3LA 1JYXA 2RGMA 5A1AA 3MSGA 2YA0A 2YL8A 5HNNA 4J3UA 2CXGA 4PYSA 1J0HA 1J0IA 3ALFA 4H2CA 4BF7A 1XD0A 1NWUA 2W67A 4HTYA 4GZEA 3PZQA 4U2ZA 3E1F1 4QCFA 4UFHA 2J7GA 2YL5A 2WB5A 1NOFA 3BAJA 1PAMA 4W5ZA 5D9PA 1XC6A 2CETA 2BY0A 5FKYA 2WLYA 4WKFA 4AXNA 5C70A 2IXVA 2WMIB 3IAPA 4AIUA 1SMAA 3WKZA 1DWJM 4Z2GA 4KH2A 1FA2A 2XJ7A 1ODZA 5A6AA 3CZKA 5A6MA 3CZ8A 4JIEA 3F5KA 1RD6A 3WF1A 5E6ZA 2J7HA 3IK2A 3WDPP 1VFFA 3BH4A 5IFPA 1LQ0A 1J0KA 2E9MA 1DHKA 4GINA 5CJ5A 1FOBA 3MUAA 2YJQA 5A3HA 3WFLA 4UQ9A 5EB8A 4MADA 3W29A 3AHXA 3WH8A 1OSEA 4WLCA 2VURA 5I6SA 3BMVA 2ZUVA 5JIWA 4PTXA 1HKMA 1XV8A 1MXGA 2QHAA 3L4ZA 2X2YA 3KL5A 4HMDA 4P7OA 2XVKA 2JIWA 3J7HA 5GNXA 2ZX8A 1BYCA 3VIOA 2DIJA 3KZSA 3B9EA 3WIJA 3WD2A 1DWIM 1E73M 2A3EA 1QHOA 4F9JA 4PMZA 4Z2HA 4TTGA 2OWXA 1R86A 2DIEA 1XH1A 4AY1A 4CN6A 4F66A 1B2YA 5A2BA 3L4YA 3OBAA 3MUZ1 1E6QM 4PN2A 4MB1A 3ARPA 2WANA 3GXIA 5TD4A 4AEEA 5CGMA 3A4AA 2CKSA 5BWFA 1WZLA 1GOOA 4UQCA 1E5NA 2OLHA 4UNIA 1B3YA 1ESWA 3OGSA 2JALA 3AZTA 3RMEA 3WY1A 1CIUA 1UKSA 1H1NA 2OSYA 5M5DA 1US3A 1EQPA 3VGHA 1CWYA 3L2MA 4QDMA 5CG0A 2EEXA 1EXPA 2XVNA 1B0IA 3GNPA 4D1IA 2G4FA 3WUEA 1GOQA 3QGVA 4UQAA 1NWSA 2D20A 3AZSA 4W8AA 1W9XA 1HP5A 3N9KA 5DFAA 1W3JA 1JZ6A 2A3BA 2WK2A 2CBUA 3N15A 5ABFA 2VQUA 1BAGA 5A8MA 2J7FA 3VX0A 3T0DA 4AZ7A 4E8DA 2W5FA 2WHJA 1J0JA 3I3EA 1JDAA 5A8OA 5I0DA 1WDPA 1UYQA 2CHNA 1JYWA 2BY1A 6A3HA 1V03A 5A95A 3U7BA 3SCPA 4GXPA 3GTNA 3OLGA 3AMCA 4FLRA 3SUWA 2OYMA 4MTVA 3ALGA 2TAAA 4YHGA 1FP9A 4UR9A 1UKPA 4NI3A 1VBRA 1UD2A 5BXSA 3AIBA 4AIOA 4LGXA 1TZ7A 3BC9A 3OB8A 3T09A 3ZIZA 2DSVA 4U33A 2DT1A 5A6KA 3VMNA 1GQKA 1MW2A 1PIGA 3GYCA 2IXUA 4OOUA 1U30A 3AMKA 2ZX6A 1ISZA 1LL6A 2WCSA 4HZ8A 3VILA 5AC4A 3WSUA 5I77A 4PSRA 2VTFA 3SUVA 3GBEA 4J7RA 4R5EA 1E6ZA 1ECEA 1VEOA 1JIBA 3FNDA 3ZSTA 4PTMA 1GOIA 4H8UA 3T2QA 2F61A 1NWTA 1L8NA 1TVNA 2QF8A 3MO4A 4UFIA 3T0BA 1QNRA 3QHNA 1H2JA 4QFUA 4OZOA 3ZSSA 1EIBA 3VDAA 4WKHA 3APGA 2QMJA 4HZ7A 3BGAA 4OOZA 5A6BD 1ISWA 4OIFA 4PMDA 2CESA 2BVYA 2EPOA 1SMDA 3AMDA 2E8ZA 1UD3A 2V5DA 3AOFA 2EPKX 4TUFA 7TAAA 2WCGA 4AD3A 2D1ZA 4AD4A 1MFVA 1ODUA 2HVMA 2X09A 1D7FA 2CEQA 3GH4A 2J4GA 5E0CA 1W1YA 3WELA 4FLSA 1J18A 4CD8A 3UETA 4ZEPA 3K4AA 1KCLA 3SUUA 4ZE4A 4JL2A 3BLKA 3VIKA 3W28A 4FLQA 4J3XA 3MKKA 4HA1A 1W9UA 3WF4A 2ZXQA 4HU8A 4MB5A 3ZT5A 1Q6DA 2VO5A 3ARTA 1BLIA 4Q22A 1QW8A 1DP0A 1RH9A 2BY3A 1CGXA 3N11A 1QHZA 3WNMA 2VRKA 2XSBA 2RGLA 3CZJA 4HOZA 1ZBVA 1BVZA 1ZS2A 1M7XA 1E6PA 3LPOA 1NM9A 2QV4A 1CLXA 3WDIA 4K68A 4A4AA 1VEPA 3WBEA 4ZXOA 1KQZA 2C0HA 1RP9A 1KGWA 5DT7A 3WMSA 2DSZA 3OA5A 3MMUA 4J28A 1CGWA 1QI4A 1TR1A 4H7VA 4KMQA 4PSPA 4ML4A 1K9DA 4UFKA 5CPSA 5EMYA 1JF6A 1JZ7A 2WPGA 3T2OA 4E8CA 5I24A 1E55A 4IUGA 4JL1A 1WDSA 1PZ2A 1V3HA 3AMGA 4F9DA 1QNPA 1S46A 3FAXA 1M53A 3T2PA 1U2YA 2YL9A 3SCVA 4P7LA 2BHUA 1GJWA 4PCTA 5D9MA 1PIFA 1GOKA 3UR7A 5FL1A 4MB3A 4JKKA 1JAEA 4CKQA 1E56A 2PC8A 1QNQA 4N42A 3KWXA 8A3HA 1V0KA 4ATDA 5ECUA 3WNOA 3ARYA 4U5KA 2WVSA 1LG2A 1UHVA 4AD2A 3VDBA 4QLKA 1XGZA 2YA1A 1E3XA 1CGUA 3PZNA 4CU8A 5CLTA 1BG9A 2WZEA 1UD5A 4R27A 2CBIA 5CGTA 3AS2A 3ARZA 4M8UA 2V3FA 3WH7A 3BAYA 1E0WA 3CZLA 3VD4A 4KGJA 1MVYA 2WHMA 3HMCA 1RP8A 2B31A 1X1NA 4D6FA 2VX6A 5LA0A 5CPTA 1NP2A 2VZSA 2ZUSA 5A8PA 1J01A 4RE4A 3VOCA 3VX1A 4BQ2A 2O9OA 4UFJA 2PWDA 3OLDA 3BAKA 1LWHA 2WMFA 1KCKA 2FH8A 7A3HA 1DWHM 4GI8A 4JZ5A 5DT5A 2GK1B 5IHSA 4LYQA 4JAWA 1A3HA 5JH8A 2WMKA 1CXHA 1E15A 2E9LA 3W6LA 2WBGA 2ZIDA 4OKDA 2ZX9A 1HKJA 3WQ6A 1Z32X 3DECA 2X0YA 2G3MA 5A69A 3WEMA 8CGTA 1GZJA 1UWRA 1QBBA 3NSMA 5BXTA 1UKOA 4UTFA 3BAXA 2DQXA 4UQEA 3PTQA 1WE5A 3WD4A 2J74A 2VX7A 4A3YA 3ZR6A 3NJ3A 3RM4A 1HJSA 3W53A 5DEZA 2PBGA 1EDQA 2VVNA 1OB0A 1AMYA 1BYBA 2J8FA 4W89A 3WF2A 2WZHA 2GK1A 4DUVA 2IUZA 4WSKA 4L4OA 1K6AA 4MNMA 5CSYA 1QI2A 5JBFA 4KGLA 1MW3A 2YKKA 1O7AA 3SCTA 1KXQA 2FH6A 3GNRA 3AI0A 5HOSA 1FHLA 1BPLB 4H8HA 3G6MA 3AISA 3WUBA 3ARXA 2BS9A 3FHQA 1Q6GA 1N82A 1VRXA 3WL0A 2WWDA 2ZWYA 4BA0A 5JBDA 2ZWZA 3D3AA 2G41A 5E09A 4LYRA 2Y4SA 1CECA 3AXXA 1B30A 3BAIA 1HKKA 4E4PA 2WVUA 4X0VA 2AAAA 3L4WA 1E4LA 1VFUA 3WQWA 1LLOA 2VQTA 2GJXB 3II1A 1W9VA 1HJVA 1V0NA 2ZX5A 4M1RA 2WMHA 3OGRA 2ESCA 1C8YA 1PBGA 1XCWA 1J10A 1I1WA 4LXFA 4XB3A 3FY1A 2MANA 1F4HA 4HMCA 3GXFA 3PZOA 1VEMA 4HU0A 1CGTA 1P6WA 3A3HA 2WNWA 1NOUA 3ZM8A 1NH6A 2D0FA 4AWEA 1OT1A 1ZJBA 1G5AA 4L4PA 3GNOA 2GJXA 3VD7A 4U2YA 5GPRA 4Z2JA 1CNVA 3OG2A 3L4UA 3PZIA 3NDYA 4PBGA 2XM1A 1ISYA 3OZOA 2QPSA 2J7BA 3UCQA 4DUWA 4D6IA 2BY2A 3CGTA 4MDOA 4W87A 4MNLA 1OD0A 4H41A 2VRJA 1J12A 3OGVA 4BQ4A 1V3KA 3CUHA 1FH8A 3W0KA 3TTSA 1TA3B 2D2OA 4XV0A 3FW6A 1V3MA 1IZKA 3RCNA 1NOWA 1MQRA 4W84A 3TP4A 2VRQA 2VZTA 4W7VA 3EMCA 1C8QA 3A6OA 1MQPA 2XVPA 2JEQA 1R87A 1ITXA 3WBAA 1UD8A 3AZRA 1HJQA 3AFBA 3M7SA 4DUXA 3VUPA 1PEZA 2QLYA 5E9AA 4TTUA 2XUCA 2FHCA 3WEOA 2XIIA 3AHVA 5KEZA 1JL8A 1ZU8A 1Q6CA 1WP6A 3FHAA 1XYFA 1I75A 2GDUA 3TTYA 1VF8A 2AMGA 4JFWA 3N17A 1TA3A 4M82A 1W1VA 4DM1A 3AXIA 2GSJA 4HA3A 4ACYA 4B9YA 2DT0A 3JUGA 3B8SA 4TOQA 5EFFA 4JKLA 3MMDA 3WQ8A 4FF5A 5GNYA 1W1PA 1E4IA 2YOCA 5AY7A 3DYPA 1OCQA 2VJXA 4PUDA 1UQYA 1LL7A 4A3HA 3WH5A 1GVYA 4UQBA 5ABFB 1OT2A 2WVTA 3B9AA 1ITCA 1WNOA 2CPUA 2J47A 2WM0A 4XZWA 1V6YA 5BXPA 1HF6A 2BV9A 3RDKA 2AOSA 1V6VA 4F79A 1UR2A 1H3GA 3EDFA 3AS0A 4CCEA 3W4RA 2J7DA 5I3DA 3AS1A 2PWGA 1ZL1A 3VTRA 4HOWA 3AMLA 4CD7A 3ZJ7A 2PF0A 3VMPA 1TG7A 2X0HA 5D9NA 1E1FA 1KGXA 4NZCA 1ZBKA 2CITA 3M6DA 1A47A 2E0PA 3KEHA 1LG1A 1B90A 3PBGA 1HL9A 3BCFA 4JFVA 2JFEX 4BCEA 1E4NA 1EGZA 1BSIA 1HN1A 3K8MA 3GZAA 1W3KA 4OBSA 4W7WA 1M01A 1OIFA 1X6NA 4GQRA 2ZE0A 2ZUTA 1WCGA 1XHGA 3MUY1 1WDQA 4HMEA 2C7FA 3VGFA 2UY4A 5A6SA 3M46A 1VBUA 3HN3A 3NCOA 4AISA 3F5LA 3KE0A 2YLLA 2BFGA 4DWSD 4AW7A 1UWUA 4GPNA 1E6RA 3LPGA 4F8XA 1HP4A 4TVCA 1JNDA 4P7QA 5A8NA 4KRUA 3ZT7A 2D23A 3QHOA 2C8NA 3S2CA 5BRPA 3ZJ6A 3EBVA 1EDGA 2NT1A 3FAWA 1QHPA 1E6NA 4MNJA 1M04A 3GDBA 1KWGA 4D6JA 3CH9A 4CGTA 3VM7A 1BG4A 4CU6A 1HL8A 3EDKA 1JYNA 2G8ZA 4P8WA 1E40A 2VT0A 4KRTA 3WNKA 1XH2A 2FHBA 2YBTA 1UR0A 3GH5A 3ZT6A 2XGBA 1KXHA 2W62A 3W25A 2GDVA 2GJPA 5HPCA 1UWIA 1H4PA 2BXZA 4D6CA 4WK9A 1Q6FA 1C7TA 1TUXA 3SCQA 1AQ0A 4P7RA 2D0HA 2DGAA
chains in the Genus database with same CATH superfamily
3W76A 3AJ7A 2BVTA 2DORA 2RFGA 2ACSA 4IPNB 5IHRA 2Y1HA 3WH0A 3O5KA 2GJRA 3AIVA 3H4GA 1C91A 3LZ5A 3IANA 1BKSA 3LUOA 4H7ZA 3M0VA 3GKFA 3L67A 1TREA 4JFKA 7REQA 8XIMA 4W8BA 3H53A 1EJWC 4QP0A 3VNLA 1POKA 1EP3A 1TTQA 4C1LA 2HBXA 4JICA 1YX1A 1GVOA 2WBKA 3NQ2A 1XDJA 2J62A 1O1HA 1QJWA 1XIMA 2GOUA 4HNLA 5E0FA 2A7RA 4LB3A 3V5CA 3LUTA 1ROTA 4L6DA 5I2UA 2CLIA 4DLFA 3QW4B 1FWHC 4ZPTR 3KZPA 1D6OA 2OT0A 2Z7KA 3N2BA 4XO7A 3WF0A 4TVUA 2OFNA 2R6OA 2GYIA 1RJPA 4J3WA 2R1LA 2FMNA 4KWOA 3SEPA 1E9ZB 4ICNA 2HE5A 1RCQA 1GHSA 4IIGA 3U5YA 1JZ5A 3PUOA 1EJXC 5D09A 1XIFA 1AODA 4PUNA 2O9TA 2XPKA 3IUHA 4NJJA 1OGGA 4YHEA 4BS0A 4DO5A 5JIPA 1KLZA 3MCMA 4O12A 1TFVA 1XDLA 1KNWA 2PPPA 4PMXA 5ABGA 1XIHA 4K36A 2F7FA 3K8LA 3W1XA 3TOPA 5AZ0A 3CT2A 3NZQA 2X40A 1JAKA 2XM2A 4C6KA 1EIXA 5D2YA 1F05A 2ZC8A 1IHIA 3CAWA 3LHWA 1OG0A 1S5MA 4JQ3A 4HA0A 1CXIA 1SR0A 4LWWA 5B7ZA 3WH9A 1BYAA 1ZNNA 3LQLA 3PBUA 2V2CA 4O19A 2BHZA 3RRAA 5ABHA 2EPLX 2NQ9A 5DBUA 2HQAA 1TCMA 4WOQA 1OWQA 5C2GA 1A49A 2YDAA 1XBXA 4V2XA 2PDPA 1LRTA 2WJFA 5JH2A 1MI3A 1KKRA 1FP8A 4C7GA 4OWGA 2QPUA 1JUBA 3E74A 3WLTA 1QW7A 5C7VA 1D7HA 4WCJA 3QSTA 4LYPA 4HU4A 1RLDA 1KBKA 1C93A 4NKCA 3PHAA 1FXPA 2HVOA 3URBA 3TV8A 1KR1A 3TN5A 1JPDX 2EPMX 2Z25A 3K1DA 1FCUA 1PCWA 4XG1A 2O0TA 1PL9A 3PC0A 4JQ1A 1KB3A 4HHMA 4YNGA 3RO6A 3UJSA 1H1YA 1SYTA 3U3HA 1AQMA 1E6XM 1DV7A 3TJXA 3M5YA 4ZO9A 1DYSA 3W7LA 4F3HA 1WKDA 1DKWA 2Q6ZA 4RW3A 3F7JA 5JUVA 5AFDA 4FK9A 1GKPA 3U7VA 2E40A 3AALA 5A2CA 2E1WA 3W7HA 4J2MA 3WENA 1N8IA 4CVWA 3VU2A 4LAOA 1CLKA 3MW7A 1J2BA 2MNRA 3ITVA 1L6GA 2PDIA 4PRWA 4I5UA 3TTQA 4B3KA 1J11A 4XQ6A 2DSWA 3CHVA 4KT2A 3TXVA 5CPNA 1F2JA 5IXEA 4OUEA 2ZZ1A 1SZGA 3GC4A 1TPWA 4JTJA 2V5CA 4DQWA 1M1BA 1B31A 3POHA 1IEVA 3VCCA 1V3JA 3SFWA 3E02A 5T8GA 1TPFA 1GNXA 2W3ZA 3GB6A 4G1NA 3ABRA 3LPPA 3B7XA 2OOFA 3RLUA 4ITZA 1W2PA 1TQJA 3CMFA 1JNTA 4PH6A 4F0RA 1VD6A 2IKHA 4LY4A 4O1FA 4GYJA 2W92A 3TYZA 1JI1A 3CHFA 2ONEA 6ENLA 4DM2A 4RE3A 5J5RA 2DDXA 4FHAA 3TA9A 4ZE5A 4G2PA 3AIQA 3GHUA 1BRLA 1B3VA 1DJQA 4NP7A 3NQEA 3U57A 1CBGA 1W37A 3B9OA 3OLIA 2WC3A 4MJMA 3E49A 5DCDA 1O66A 2HPIA 5DQPA 3WD0A 4O13A 1KCXA 4H9TA 2P88A 3NL6A 4EANA 2ON3A 1TSIA 3VNYA 4FNPA 2QDHA 3QLDA 5FF7A 2HE8A 3VPLA 4F0KA 3SCOA 5E93A 4B9ZA 2DSUA 3EMZA 2ITKA 3L9CA 3WLQA 4C1NA 1D8WA 3V18A 3UESA 1YQ2A 2HK0A 2VZOA 1ZJHA 3O05A 2MLYA 5G1TA 4K3ZA 1R38A 3NL5A 3LB0A 1O95A 1TPB1 2UY5A 1U33A 3K30A 1KKOA 3NSNA 1B57A 3ITOA 1I1XA 1F73A 4BHYA 2PDWA 4TO8A 4P61A 2OSXA 3S42A 3BXWA 2X1RA 5CG7A 3C0LA 4I8YA 3TONA 1W1B1 1XC4A 3W9ZA 3NQBA 4IPPA 3TXZA 3THQA 4FAMA 2YW3A 1QR7A 3BLPX 3KXQA 5TNVA 4WSJA 2Y8UA 3WQPA 4QEEA 3U2ZA 1RHCA 3O2LA 1QOQA 4NX5A 4JHZA 4O16A 3UWUA 2XHYA 1KRBC 3QN3A 4FMVA 3A24A 5K3VA 4ZENA 4ZO7A 4ZGYA 2VWTA 2PB1A 5DMNA 2KX9A 2EPNA 5F7UA 1QNSA 4PMNA 4LUSB 3HGSA 4NI8A 2PTXA 1A0DA 1BXCA 1JZ8A 3RGTA 2VGIA 4IG2B 3CHEA 3SQMA 5HATA 5J6EA 3AYSA 4OFCA 2DPEA 2O56A 1HUVA 4QROA 3GC5A 4UFMA 4PUKA 2D2GA 2ZA3A 3QHMA 5A94A 3TAKA 1UMLA 1QPKA 4UTKA 4O1DA 4ZFCA 3GHRA 1ITQA 4PULA 4IIHA 3TW6A 1GG0A 4H8VA 2V5KA 3LXAA 2WHKA 3VGDA 1N55A 3UXAA 2GSHA 2A4AA 3TIMA 4HCDA 1RCXB 5C9RA 3MV11 1G1YA 4DZHA 1I8JA 2QCMA 1BVWA 2P10A 2F4EA 3T08A 3N2XA 3KS5A 1OD8A 1WB0A 2DT3A 4YTSA 2HV5A 3SQLA 5HQMA 1VJZA 3UA4A 4MJ2A 3GDMA 1OFRA 1OX4B 3ZO9A 5JQ9A 4DZ5A 4Z2KA 4JFUA 1XCXA 3ENLA 1OK6A 1GK8A 1IWPA 1F3WA 2OEJA 5CH9A 1DE6A 1ZZMA 2W66A 5TBOA 3LPFA 1EYEA 3FSTA 3XISA 2A3HA 3LBOA 4MAZA 3V35A 1RJQA 1KT0A 1UG6A 5DO2A 3KFTA 3MUIA 1EEXA 1KV5A 2XIQA 1UKTA 4PBFA 1PZ1A 5HUAA 4KFOA 3HG2A 4MIMA 4ADTA 1QW9A 3EMQA 1TPC1 3H23A 3LU2A 1IZJA 3GXPA 3BJSA 3T4CA 1UR8A 3N6JA 3HU7A 5CPQA 3MU7A 2W6RA 4LAYA 4W85A 5HINA 4MAVA 1JXKA 2FIQA 2OELA 2EKGA 3MKCA 4NY2A 1GVRA 3BCJA 1UB3A 3PK7A 3SJ3A 1SJAA 4ZOAA 3VOIA 3SUTA 3MI3A 3N04A 3WQGA 1AQHA 3PNZA 4AC7C 2WOQA 4PMYA 3CUFA 2V3DA 1GQJA 3T0AA 4FI4A 5HAOA 1W17A 3EB2A 1UZ4A 2ZUMA 2NX1A 3G1AA 3QZEA 1EJUC 3CMJA 2RDUA 1TIMA 4B5XA 3F5JA 1IWBA 3DDMA 5M03A 1CENA 3O7UA 4RV8A 4U86A 1A5NC 4W86A 3WMCA 4CQDA 3PWAA 4C7FA 5I7GA 2A5HA 3BG9A 1R3VA 4MFEA 4DO6A 4FOJA 1LRQA 1EL3A 2Z1XA 2KO7A 2P3ZA 1FRBA 2BZNA 4KFNA 3ARRA 4NZ3A 1PTAA 3BK0A 1W3HA 1YATA 3PAJA 1QT1A 3UFYA 2X1IA 3CUIA 3AUJA 3K4WA 1IXNA 5CBIA 2Z1WA 1FQ0A 3T4WA 1SFLA 4CUCA 4M19A 3UG3A 3AS3A 1TTJA 3THAA 1KXTA 3CTTA 3PSVA 3D3FA 5JH1A 4JIRA 4W93A 1GEHA 5AC6A 1B9BA 3E3HA 3BV7A 4YIWA 1GW1A 1W5MA 2FHFA 2NVCA 3VD5A 1R2RA 5CLWA 2PDMA 1XS2A 3OZYA 3CQKA 5KZ6A 2CBJA 2CLHA 3R58A 3TX9A 4XTIA 3SO7A 1XH0A 4RDZA 3UVAA 3IEBA 1JNEA 4QE5A 4GY0A 3IARA 4JN7A 1G4SA 3C8NA 4ZSTA 1FWIC 3CQ0A 4IISA 3W7CA 1O6IA 3CTLA 1KBBA 4Z08A 3T78A 3QQWA 2I16A 1AW2A 1CGYA 3B40A 3LHYA 2XZ7A 4PMRA 3DG6A 4DWSA 3DI1A 3PJTA 3NI6A 4AAJA 3BZGA 1EFZA 1TRDA 5HWMA 2A7NA 3SCUA 1MUWA 3VE7A 4A29A 3U5UA 3G1VA 2YL6A 4XIMA 2Y62A 3W1PA 1H41A 3CAVA 1FKFA 4OECA 2HS6A 3PZVA 2GVYA 2PV2A 1REQA 2QUUA 4QJ3B 3VIPA 1KRMA 3K8KA 3UJFA 3LLFA 3AIRA 2CIPA 3S8HA 1FKIA 4DROA 4M29A 5AZ1A 3WUFA 2F6UA 2WC7A 4AHPA 4DPQA 4L65A 3H55A 2Z27A 3UI6A 4OE7A 1I60A 1PKLA 4GUHA 4JFSA 3QC3A 5CXPA 4DIAA 2RUQA 4DX3A 1HJWA 1RPXA 1X6LA 4KWVA 4HJFA 3N4FA 1AW5A 3EA2A 3BSMA 4RJEA 3VGEA 3MZNA 2WKLA 1VCGA 3A9BA 3MMWA 4HKPA 2YIHA 4PODA 7XIMA 1S5NA 2Y5JA 2FQIA 1ISVA 2ZUNA 2XSAA 4QLLA 1UH3A 2BWGA 4WKAA 4ODNA 4OGZA 4AU0A 3T0CA 2G3IA 3ZVHB 1B3XA 3WBYA 3GW3A 4QIUA 1AA1B 1KRAC 1JXJA 2QUTA 3W82A 4LVGA 1K9FA 1QI3A 1VJSA 5HBFA 1DEDA 5A6LA 3C8FA 3P61A 3IJDA 3ZR5A 1VFLA 2O7SA 2ATMA 3VKJA 7CGTA 4IGMA 3UG5A 2WZIA 4GI9A 1UIPA 1DXIA 1OIMA 1Z69A 3B4YA 2BOEX 1SUXA 4DRHA 3SGZA 3WJWA 1H7PA 2FGBA 5DRIA 1B54A 3PWGA 4GG9A 4YL2A 4ACZB 3M43A 4YVPA 3QW3A 1O5XA 4O53A 2R82A 3N4EA 1KFLA 1IQ8A 4ZOBA 4ECLA 2DG4A 4AZCA 1W3NA 1KT1A 3LXCA 2W63A 4Y8FA 3P74A 2DW7A 5LNSA 3ISIX 3I7RA 1PUDA 3SECA 2D69A 5FJTA 4F0HA 1SU5A 4J27A 5DRCA 1BF6A 1D3HA 5D9OA 3SN0A 1RPKA 1BL4A 4RDVA 4AD5A 3AU6A 4L4MA 3WLSA 2XP8A 2DZSA 2LPVA 2PBOA 4CVUA 1NF7A 4QDWA 4Y2WA 1LTDA 3C4UA 2ZRWA 4K38A 1E0TA 1FKSA 2FVKA 1V08A 1PJ9A 3WDJA 3DC0A 3H7UA 3WN6A 4NNCA 5MKGA 1OJXA 2FZ8A 4JX6A 4DAFA 2ZA1A 1PKNA 4YCOA 3K1GA 1AJZA 3VINA 1W2VA 3GU1A 1JYXA 5A1AA 3MSGA 2YA0A 5I07A 2YL8A 3VOHA 4O17A 3OVRA 1UPMB 4PYSA 1PYFA 1YDNA 4B5NA 3LCHA 4QDPA 3UY8A 2W67A 1JCTA 2HWGA 3PZQA 4UTJA 4ZTXA 4QSFA 3E1F1 4GI4A 1FCBA 4J4KA 1VFSA 3MO7A 5D9PA 3R0DA 4PUJA 4HTBA 2IPWA 1RALA 4WKFA 3CNYA 3EWXA 5C70A 2IXVA 1HW6A 2X7WA 4US5D 3GDTA 2BODX 2LJ4A 1DIOA 1FA2A 4QISA 3S5NA 3CZ8A 1OFAA 1Q45A 3G1YA 4JYSA 3M5ZA 1SFTA 1RD6A 1GZ1A 5C9XA 3W73A 4ZQNA 4GJ1A 3M0ZA 5IFPA 2E9MA 1WAUA 4NAEB 4N4PA 4S3FA 1T5AA 5DCEA 4GINA 1FOBA 3TFCA 4DF1A 4HNNA 2HTMA 5EB8A 1VPXA 4EXBA 3TEVA 1OSEA 4XSMA 2VURA 5I6SA 3ITXA 5JIWA 4PTXA 3USZA 2Z0IA 4MWAA 1VJIA 2RHGA 3M0IA 3TLLA 5G2HA 4ZQOA 1PV8A 3WLPA 2X2YA 4HMDA 2J27A 3IJQA 3I68A 2JIWA 1UW9A 3J7HA 2VC5A 3B9EA 4HCLA 1PS9A 3KOZA 4F9JA 4Z2HA 1K3UA 2OWXA 3KS6A 1XH1A 3GFYA 3W75A 3EPMA 3OBAA 6XIMA 3KAOA 3H2AA 2ALRA 2NUWA 5JMUA 3P5YA 1WZLA 2XDFA 1OK4A 4I5XA 1XF0A 4CNNA 3OGSA 2XN0A 8XIAA 3MKVA 4YTUA 3WY1A 1JCHB 4WXYA 5M5DA 3EWZA 3L0NA 5CG0A 3EWCA 1BKFA 1ICSA 1ZAHA 1B0IA 2G4FA 3WUEA 1XLHA 4PCNA 4KKXA 2D20A 3KHDA 1EBGA 3SI9A 2RUSA 5HW7A 4LY8A 2ZQ0A 1W3JA 3LCFA 4R0XA 5ABFA 2CBUA 1KFEA 5A8MA 2J7FA 1R5YA 4N9EA 2QR6A 3I3EA 4RZ4A 3FSUA 1LWIA 3B8TA 2CHNA 4PTDA 2YFNA 1V03A 1ZHAA 4GACA 1CB7B 5FACA 4GXPA 1MNZA 4PTNA 4FLRA 3TN3A 4KR0B 1BEUA 3PR9A 3IHZA 2FZNA 1PZ0A 2NQLA 5BXSA 4LGXA 3LMZA 3OODA 2I17A 2UZ5A 4PGLA 2ZA2A 4I5RA 3T09A 3ZIZA 2PMQA 4RDYA 1MW2A 1LM1A 3SADA 3TQ0A 3GVVA 4PFHA 5ECVA 4F2UA 4LSBA 1KBIA 4HZ8A 1QPLA 1A5SA 4IFKA 3WSUA 4PSRA 1TPDA 3SUVA 4R5EA 3R6IA 3KAIA 1DOSA 5AHLA 2HXTA 3FNDA 3ZSTA 2TYSA 3T2QA 3BWWA 1L8NA 3P5ZA 4JQ2A 1TVNA 2C19A 1V5XA 2FLIA 3W1QA 3O8AA 2ADAA 3ZSSA 4NZ4A 3S5ZA 2ZCGA 4LBSA 1XUZA 1TV8A 3EXSA 3TZFA 1ISWA 4XBKA 2H9AA 3UQAA 1Q65A 3A5VA 2IKJA 4EXAA 3SRFA 2E8ZA 3GIPA 4C6DA 4N9DA 4WVXA 2EG7A 1J5SA 4AD4A 4AF0B 5D02A 1D7FA 3GH4A 4N9BA 2J4GA 2VDIA 4Z1AA 4QAIA 3WELA 1Y8BA 1J18A 4CD8A 1TV2A 2MLZA 4ZEPA 1KCLA 3QPZA 5GPGA 2QUNA 2ZVIA 3VIKA 3W28A 4FLQA 3QSRA 4WJEA 3MKKA 3GQYA 2IS7A 1UJQA 2Z28A 1Q3NA 3F1QA 2RGLA 1PTDA 5DCBA 2UZ9A 1ZBVA 1KD0A 4IOTA 1ZS2A 3RPDA 1E6PA 3LPOA 3U4AA 3WDIA 5CBBA 4Q4KA 1TTIA 3EOOA 2FZMA 2QXWA 1QZ2A 1XYBA 1VEPA 2V6AA 1KQZA 4LC6A 3ME3A 4YTRA 3KBJA 4I90A 1HO1A 3CM4A 2DSZA 2QCFA 1UR3M 4R34A 1CGWA 1TR1A 4TYOA 4H7VA 4PSPA 4ML4A 1K9DA 5FEZA 1RD5A 3EOUA 4L64A 2MUCA 5CPSA 5EMYA 1JF6A 5EYWA 3EXTA 2WPGA 4E38A 3QGAC 3E9AA 1Q6HA 1QFEA 1ADDA 3DZ1A 4PA8A 1TJPA 4RNJA 5F1VA 1OF6A 5H8PA 3ZLGA 3W7PA 1QNPA 3FAXA 3T2PA 1M53A 1K8YA 1Z8AA 1RBOB 2YL9A 3TH6A 4P7LA 2BHUA 3UI4A 1RQBA 4BFAA 5T9CE 1B3OA 2PC4A 1NJJA 1F76A 2V0TA 3PVFA 1JAEA 1MXSA 2WO5A 3W83A 3KWSA 5KMYA 3ICJA 8A3HA 4ATDA 1OFQA 2G3FA 3E2QA 3UJRA 3TWAA 3EB4A 2W27A 1WOAA 2FDSA 1UHVA 4AD2A 1POJA 1XGZA 1E3XA 4O52A 3PZNA 2VFIA 2V9DA 2W79A 1VLIA 2C15A 3BGJA 1JCYA 3AS2A 3E2RA 1ELSA 2V3FA 1L6YA 2RAGA 1Q6IA 4L1WA 3W7GA 1U1JA 4RNFA 4KGJA 3KZ7A 3KTCA 1DQWA 2WHMA 5D32A 1RP8A 2B31A 2YR1A 1TWDA 1X1NA 2KAUC 3CUXA 3TUUA 1EZWA 1J01A 1N8FA 3GR7A 1KM5A 1VZWA 4IJBA 4UFJA 3H4WA 2ATSA 2WMFA 1KCKA 7A3HA 4GI8A 3NAVA 4GIRA 1A3HA 5JH8A 4C6LA 2KE0A 1J93A 1Y5WA 3QBUA 3UWVA 3SZ8A 1NDWA 3GPKA 2ZIDA 2ZX9A 3QH2A 3QZAA 3W74A 1Z32X 2QF7A 2P50A 5LIUX 3WEMA 1UWRA 1GTEA 3CEPA 3BLLA 1UKOA 4UTFA 1DQXA 5E1QA 3PP7A 2DQXA 3PTQA 4GVHA 3NOYA 4A3YA 1YE4A 3DGRA 3RM4A 5AHEA 2BOFX 5DEZA 3M0JA 3U6WA 5C9ZA 1HG3A 2ZTJA 3REQB 4ORIA 4WSKA 3S5OA 3AU2A 4MNMA 2IKGA 2A2IA 3DG7A 2VXNA 2WJEA 3SCTA 5LXEA 3WYZA 3AI0A 1F6PA 5D30A 3BLFA 3V0UA 4LRSA 3C2FA 1SVDA 4H8HA 4IGHA 4HN8A 4QR6A 2WWDA 2R8WA 3LRKA 4J35A 4JYDA 2FPTA 2ZWZA 3UQIA 3D3AA 2G41A 4H2HA 3AXXA 4UMBA 3MYPA 3L0KA 4AH7A 2AAAA 3CS2A 3L4WA 4GVFA 3S2MA 2XPAA 1J5TA 1LLOA 3T40A 2GJXB 3II1A 2PP0A 1VKFA 3IS4A 1FWCC 2ESCA 1Z9AA 1J10A 1I1WA 3LGEA 3DCPA 2Q3OA 2ZZ6A 5FAGA 3SBFA 4CNTA 1F4HA 3ITCA 3M0MA 3FX4A 2EPHA 3N25A 2I1OA 4UBPC 2V5JA 1NH6A 5FEWA 3C3NA 3S83A 4E2DA 2Q8ZA 2F84A 2UV8G 3P0WA 4BI6A 1YDOA 3GNOA 4O11A 3QMTA 1XRFA 3ZLHA 4OQVA 3DERA 4WHBA 2GJLA 2IQ0A 4WD0A 4YYFA 4XIAA 5AYXA 3NDYA 2X2GA 1ISYA 2J7BA 3CGTA 4W87A 2VRJA 3FOKA 3DKLA 2D2OA 5EMLA 3FW6A 3GG8A 3ATYA 5C2XA 3URAA 2BGSA 3BG5A 4W7VA 3KCEA 1LUCB 2XVPA 3UNTA 1R87A 1IIGA 5CBJA 3TROA 3WBAA 3LA4A 2GGEA 2VGGA 3VUPA 4QS6A 3EX3A 2XUCA 1GRJA 5KEZA 5CPLA 5KETA 3RLHA 2Z4GA 3TOYA 2OZTA 3EX4A 1I75A 3TTYA 2WSQA 3LCIA 1VF8A 5HWNA 4JFWA 4FB7A 4DY1A 1V51A 1B6CA 5MHBA 3U4FA 1XG3A 4C6PA 4N9CA 5MF5A 3WQ8A 4JKLA 3MMDA 4FF5A 4B5TA 1P0EA 3MSRA 1OCQA 1V6TA 4PUDA 4N4QA 1UQYA 3PWIA 4Q4OA 4A3HA 4UTLA 5ABFB 5HUOA 2GVLA 4ODRA 2Y7DA 1XDMA 2WVTA 2QAFA 1ITCA 1J4IA 4RPPA 1V6YA 1R3QA 2E5DA 3QMRA 4GABA 4NAFA 3RDKA 1IZCA 5XIMA 1K8ZA 2ABAA 3HTWA 2GGGA 5I3DA 3P0XA 3AMLA 4EWJA 1FWWA 4ZL1A 1A5AA 3M16A 4HK7A 3LX9A 1SW0A 2XISA 3I6EA 4H9XA 2GQ3A 3S2NA 3UF9A 3LRMA 4HPJA 1NEYA 4YTTA 2JGYA 1KGXA 3B9NA 2CZEA 2DVTA 4JN8A 3MHGA 1A47A 5HA7A 3UWQA 2ZYFA 1I0BA 4H6RA 1LG1A 3A12A 3PBGA 1HL9A 3BCFA 4BCEA 4AEOA 4W7WA 3QYQA 3TQKA 2A0NA 3U2CA 1OIFA 1X6NA 2PUZA 3OQ8A 4IJCA 1MDRA 2ZE0A 2ZUTA 3SRDA 5D2WA 3FKRA 3DX5A 2C7FA 2GQ8A 4BWLA 5IBXA 3C86A 3HN3A 4OUIA 3OBKA 2C1IA 5I98A 1OFEA 1K4HA 4GPNA 4JN6A 4US5A 3GC2A 4F8XA 4L72B 1JNDA 4P7QA 4KRUA 3ZT7A 2D23A 5FSDC 1JGMA 3ZJ6A 1EJVC 2NT1A 3WJSA 1SJBA 2NXGA 4DBUA 4D6JA 3CH9A 3QY8A 2RQSA 1JCMP 4JIHA 4EPKA 4Z17A 2V2DA 1JYNA 1E40A 1ZALA 5GVJA 2J13A 5AHIA 1RJRA 3TTEA 2QJJA 2Y0FA 4PB4A 2PGFA 2C0AA 5EGRA 2E25A 4D6CA 1M41A 4H9MA 3AJXA 1JEZA 4WK9A 1FKGA 2NLIA 1AQ0A 4P7RA 4NXKA 1EUAA 4ODPA 2FYMA 2QYGA 5CEWA 3GLCA 1LLZA 4CNOA 3W1UA 4U3CA 1PXGA 1GVEA 3GUWA 4LALA 1E0UA 3OYZA 2HXUA 3PG9A 1BWKA 1S5TA 1BVNP 2I5IA 2DIKA 5DX7A 4HSOA 5F2GA 1Y65A 5DLCA 3BGGA 4GI6A 4M81A 1EO7A 3I3DA 3VIFA 2ZXAA 3TQVA 2J8GA 1NDYA 2QV5A 3AICA 1ZP3A 2YZ5A 4BI7A 3N13A 1V6UA 3TLQA 3MI6A 3VNMA 4W88A 3KOFA 1M03A 3TSDA 3U2EA 3DHUA 3ONCA 1H60A 2I9EA 1XSIA 3THUA 2QVNA 5C71A 3N29A 3UG4A 2AGTA 2QUVA 3W07A 4YTQA 2O4MA 5DITA 1DTNA 2ZDRA 4MY9A 4K7YA 4KQZA 1EWEA 4OBRA 1CI1A 4DBSA 1C92A 4CEUC 2PD9A 3A64A 4JFLA 4B15A 3BURA 4EOUA 1UPPA 4YCPA 3CHDA 3CZGA 1HIZA 2HRWA 4ZQRA 4GKTA 3UU0A 2VCCA 3N2MA 3W2NA 1DIEA 2Y8KA 4CLMA 4NVTA 2QS8A 1HX0A 3V0SA 4B2DD 4OJYA 3ZLFA 2E9BA 4UQDA 1KFWA 3O6DA 2Y7EA 1HVXA 2OYKA 2Y5SA 2GVEA 2I7GA 1WO2A 3AIWA 2F8QA 1F8IA 2ISWA 3VNZA 3LNPA 4PL1A 2OMAA 4JCLA 2PP3A 4AD0A 4X2RA 5CAHA 3FXYA 1V93A 5CQ1A 1K1DA 4JXCA 2UWFA 1L0PA 3KOXA 4HOXA 1YLVA 1E9LA 2XZ9A 1M7JA 4LOCA 4NJGA 2PLKA 4HA4A 1QMLA 2UY2A 4W8LA 4XWUA 4JOMA 3LXBA 4IZGA 4F0LA 3WQ4A 1E0VA 2Z1BA 2VL4A 3TYBA 2VI0A 3WQCA 4S3DA 1DTUA 3H7VA 4IM4A 4B5UA 3P80A 3W27A 1SJDA 2H90A 3GR4A 3U8GA 1CXFA 2ZR6A 3CZEA 4P8XA 3D0CA 1KO0A 3S1XA 2VOMA 3D47A 1MWOA 3MHFA 1UMYA 1D3GA 3O16A 5C6MA 4IFOA 3SUSA 2QMKA 3P82A 4QJ5B 3UZJA 2LGOA 1C9DA 1N1AA 3AROA 1UUQA 2NZLA 1UKQA 1CEOA 3WNLA 4US6A 3KLKA 3WLLA 3ITLA 3HQOA 1R8LA 1G01A 2Z1SA 3VZYA 2ASHA 2WLZA 4OBTA 1EHNA 4IXXA 2RDXA 4XKYA 4JCMA 4TU1A 5FJPA 4CD6A 4ALDA 4QX4A 1PYMA 1A4LA 1FWAC 4B91A 3VIIA 5BRQA 2OSWA 1YNQA 2ZUUA 1LF1A 4XKMA 4PE8A 2YCJA 4N6EA 1KQYA 2Q8XA 3B9DA 2W4XA 3UR8A 4NG3A 2GGHA 4U85A 3EDDA 4AZIA 1AQFA 4DWDA 2CYGA 4L1GA 3PBMA 3TA6A 3P14A 1BF2A 3DBNA 3B4UA 1BGAA 2UBPC 1S5VA 1HO4A 1SO5A 3UWEA 3L21A 2OT1A 5F1UA 3EA1A 1OX6A 3NGJA 4D71A 2W91A 2DG9A 3NDZA 1WPCA 1DXFA 2P0OA 2HNEA 1TX2A 3W1AA 2WNZA 1A5OC 1JRCA 1KLYA 1GKQA 3IJLA 3I7SA 1WUFA 5BXRA 1F9CA 2BHYA 2HPMA 3KOWA 2CBVA 5FF4A 3W7JA 1EO5A 3H2MA 1OC5A 4DJEA 1XIEA 2WCAA 2DG3A 2O9PA 1FHDA 1VFHA 1I0DA 1E71M 1X98A 3QPYA 4FLOA 3AAMA 2D24A 3MHUA 1BHGA 3KCJA 1FY6A 2O92A 1FHUA 3CUGA 5HK4A 3EWUA 2ZZ2A 1LROA 1UA7A 1QATA 3QV6A 2YA2A 3EAUA 4TX6A 2QDEA 4D8AA 3FA5A 1J8VA 1ROUA 4FNSA 4ZXLA 1ZRQA 3VCRA 3VNDA 3DU0A 3DEQA 3AUOA 3KAGA 2XH2A 4XD4A 4HZ6A 3SIZA 1KBJA 1L2QA 2WYSA 1TMQA 3GR8A 3G5EA 3TMLA 4LYKA 5ENLA 5AYYA 3I10A 3WLKX 3CO8A 4MVAA 1A80A 1LRNA 5FJOA 2VCAA 4GQQA 2PODA 1IT0A 1BWLA 5H1WA 4NNAA 1QI5A 1G4TA 4ODOA 3CIWA 3AYTA 4H19A 2VX4A 4ORMA 3RCMA 5DY3A 5L9FA 2YB1A 5C8BB 3DAQA 1A3WA 3AC0A 1KM3A 1BGGA 1I2OA 3VDCA 4DJEC 4M24A 1F74A 1VR6A 3ZOAA 1JDDA 3BG3A 1VBJA 2Z26A 2PP1A 4AHOA 4DEFA 5GJNA 2VDHA 2D2JA 1OCBA 4NZJA 2PWEA 4OV9A 3F2DA 4H6QA 4RL3A 2RDWA 5CZTA 3ITTA 1M5WA 4GQBA 3A13A 3VDGA 2OWCA 4P7NA 4LBRA 3AYVA 1ZCOA 3BSHA 2BGQA 2WW5A 1YXCA 4GO9A 5CC5A 3P3BA 5IFTA 3KDNA 4HYWA 4DH0A 3PTMA 4UOQA 3WD3A 1A0EA 3CEUA 1EX1A 1ENUA 4MB4A 1SSGA 1M7OA 1I6NA 1S1PA 3A3WA 1TPUA 1CPUA 4ATWA 3G0XA 4GNKB 4B4FA 3T8QA 2VN1A 3NQVA 3LSCA 4L4LA 5GNZA 4PB3A 3THDA 3LNMA 1PTGA 1PDZA 3PFRA 1Q6UA 4X61A 5FEPA 2Z1KA 4L61A 4NHVA 4GISA 3SGGA 3P93A 1RQHA 3QKEA 3C2OA 3EZ4A 2DZWA 3SY5A 1RQEA 3DYMA 2JIEA 5K9CA 4Q7BA 1AVAA 4A21A 4ZA0A 3U0HA 2RJGA 3FGCA 3MCNA 3DFPA 5DXYA 4EX4A 3PZGA 1W9BM 2C13A 4UCGA 4JIIX 2DEPA 1VENA 1XYMA 3A9IA 1W26A 3TR9A 4G8TA 4XZNX 3N2OA 2J25A 3AXKA 5G1YA 3STFA 1JVNA 3WD1A 4ZMGA 3OZPA 3AXHA 4J3TA 4XZIA 3VC6A 1G4EA 3CIVA 5DIUA 3W72A 4DJDC 4GH1A 3W7OA 4LV4A 3Q2DA 3F2CA 3QM3A 1ZB5A 4A22A 2QT3A 4QXIA 4S3EA 1T40A 4LVBA 3SQSA 4QHRA 2ZDSA 3L4VA 5HPOA 5DIVA 1HJXA 3CO4A 2EQDA 3QOKA 5I02A 3S9IA 4GHRA 3RAOA 1B3WA 1NSGA 2NW0A 3W7NA 4RCXA 3N12A 3AQUA 4C6IA 1V3LA 1YADA 1JUEA 2EULA 4QCEA 2PGWA 5D2TA 1LQAA 2FZ9A 2F2HA 2I56A 2OWWA 1TCOC 1L6FA 1FHVA 2EF9A 5HDRA 2I57A 4NXSA 3C3UA 3IGUA 4AFYA 1PE1A 4A2RA 2JE8A 5LYRA 2DJLA 2WVVB 3SM0A 3C56A 2YDQA 2PBCA 4GQ0A 1E5JA 5I78A 3M0YA 5HNRA 3VC5A 1SFJA 2ZXBA 3JYMA 4L5ZA 5AHNA 1YHTA 1VIWA 1F4AA 1E0XA 3VKCA 2DSKA 3WQVA 3GM8A 4LH8A 2EJ1A 1QRQA 3LM3A 2KFWA 4N02A 3W37A 1M6JA 5I5RA 4ZOEA 4UOZA 4PC8A 1H0IA 3SCWA 1PX3A 3NZRA 3BDKA 4AYGA 7ENLA 4QLJA 3KRUA 3QOMA 4CQCA 3CB3A 2L5HA 2ZR4A 4MGVA 1NFBA 4MPQA 1YDYA 3IIVA 2NUXA 3KBVA 3M0KA 3B0XA 1P43A 1FVPA 4DAIA 3OIHA 3O0KA 1DJZA 4AZ5A 2QCDB 2G96A 1JZ4A 3L7RA 3QVQA 5ABEA 2WSYA 2BASA 5IDIA 4QE4A 2Y5EA 1X1ZA 3SIMA 3FJNA 3TC3A 1F07A 4H9YA 3S5YA 2GWGA 1XI3A 3WUGA 4FXSA 3T81A 4WF7A 2Y70A 3M41A 1CLVA 1UZHA 1TZZA 4UTUA 2A6NA 2OYLA 1YXYA 4TXEA 1EA9C 1LCOA 3BSGA 2B5UB 4DYEA 5I3GA 1D2KA 1ZJAA 5A2AA 3WQ5A 2WQDA 4UZSA 1XLFA 2EG8A 2QAPA 3TC6A 4PMOA 4H04A 2P76A 4NX0A 1TTPA 1FXQA 1P0DA 4RUBA 1HXJA 4DYKA 4GZ7A 3LDVA 2R1KA 4M51A 2RKXA 1WKYA 2AQOA 1MW1A 4PCFA 5LZLA 5BNKA 1OYBA 3FJ6A 4K1WA 5EPDA 4CCCA 2GUBA 1EH9A 3ES7A 4AZBA 3H9RB 2XVLA 4Z1DA 4WGHA 3A4JA 5U4NA 1WDDA 3WEZA 4S3GA 2BMBA 2CZVA 2V3EA 1DJIA 1PWMA 3KCLA 4MNKA 3S2JA 1V3IA 1EC7A 2E09A 3KP1A 4Y9OA 1C7SA 2FTYA 2FDMA 2BLEA 1MEHA 2F2KA 3K46A 5D2XA 2G3NA 3L5LA 3S9ZA 3VKKA 1JR1A 4B3LA 3CPUA 1H49A 3O5FA 1EHAA 4UUIA 4ZFMA 3USBA 3AIEA 3GXNA 2X0SA 3GBDA 3TK7A 3W2UA 5BYWA 2C16A 2XP7A 2ZKMX 2G50A 1QBAA 2RUCA 2DZUA 1H7XA 1ZGDA 1LBLA 2OGYA 1CXEA 4JFJA 2VFGA 1NP0A 4OU1A 1R3SA 4PMJA 4HGXA 4MKVA 4YVVA 5I3KA 4BY3A 4EP8C 2WV8A 1ZP4A 3ARSA 1MXDA 3F4CA 3KM8A 3VGGA 2VZVA 4DJDD 3VD9A 3O15A 3NXLA 4NIRA 3O5JA 1PKMA 1OGSA 3NQCA 4B5VA 3EY6A 3V1HA 3WFZA 3U48A 4IIEA 2Z29A 2XP5A 2Q5AA 1S2CA 4C6BA 4CD5A 1G0CA 4IICA 3RNDA 2WZMA 5AHFA 3GVQA 1U5HA 4BQ5A 3OLEA 3BMWA 3W1NA 1CDGA 1QO5A 4HJWA 3MCOA 1J4EA 3K4DA 5DELA 5FSEC 2D3LA 3BQ5A 4EK7A 4HPHA 1R7AA 1GVIA 1UR9A 4PB5A 1UWQA 5CJNA 5CGQA 1JZ3A 2OQYA 2WSKA 2EJAA 1EUNA 3EOLA 5BOFA 3EXRA 2RGMA 1W56A 2G4JA 3DENA 2INZA 4L7ZA 1XLCA 1NTHA 3GU0A 1UWAA 2CXGA 3HQ1A 3JR2A 1NDVA 1J0HA 3ALFA 4BF7A 4ZSUA 1GT8A 1NWUA 3UYIA 5BU9A 1TCDA 1FTXA 4GZEA 4I7WA 3R43A 3A21A 3I4KA 1FKBA 3ZXWA 2FVMA 3SSJA 1R0MA 2YL5A 3AWNA 3BAJA 2HNHA 4W5ZA 2DZXA 1XC6A 2CETA 3KAHA 1UUMA 4JYFA 4IIBA 1DWJM 2XJ7A 4LBUA 4JDYA 3CZKA 2OZ3A 4MF4A 4JIEA 3GIQA 4CEXC 3NDOA 4WZHA 3WF1A 4ILSA 3DIPA 2J7HA 2DFAA 3EWWA 1VFFA 2XH4A 3B3DA 3BH4A 1J0KA 1VQTA 2Z24A 3R1ZA 3ZYZA 1PWLA 5TAOA 5JVLA 4O10A 3WFAA 4DELA 1UCWA 1XLDA 3HGOA 1OC6A 3GU9A 4XAZA 1X38A 3G18A 4I9JA 3BANA 1HKMA 4FIRA 1FWSA 5LHEA 3V5OA 2J6XA 4O8AA 3KL5A 1EP1A 3NQAA 2XVKA 5EMUA 1EF3A 3R5EA 5GNXA 1BYCA 3VIOA 2X1TA 1QHOA 5CSRA 3FVMA 5M2FX 1R86A 4L9YA 1SW7A 1Z7AA 3L4YA 4S39A 3MUZ1 5LIYX 4GYFA 1JNSA 4JYEA 1ZCCA 2WANA 1C8VA 1V4YA 1XQLA 5CGMA 1UASA 1GOOA 4ZO8A 2PD5A 1EA0A 4ZPWR 4UNIA 2RURA 1XLBA 2EAWA 3AZTA 3DI0A 3Q37A 2TRSA 4R9XA 4QQ3A 3QZ6A 3K5XA 1CIUA 2OSYA 1H1NA 4FPSA 4H6KA 1US3A 1CWYA 3L2MA 4D9PA 4QDMA 3EOEA 3GNPA 4FALA 4XD5A 3LERA 3SDOA 4HHPA 3QGVA 5CKSA 3T6CA 1NWSA 2PRHA 2Q8LA 4V1YA 3VZZA 1W9XA 4RKAA 5DMMA 3UD6A 1JZ6A 2A3BA 3IK8A 4QT3A 3R0UA 1SR9A 3N15A 1ZAJA 4ZPVR 3VX0A 4AXKA 3ZZ1A 1G67A 5A8OA 4O1EA 5I0DA 1WDPA 3EPOA 1UYQA 5HW6A 6A3HA 4K8EA 3R0KA 2RDTA 3OLGA 3AMCA 2OYMA 3SAZA 1FKHA 3T05A 4YHGA 3W1TA 4LAMA 4UR9A 4NI3A 1VBRA 1UD2A 4KQNA 2VDGA 1YPIA 3PUDA 4ZB0A 1WBJA 4U33A 2DT1A 4UMCA 1GQKA 3MSYA 4HIBA 4HYVA 1K77A 1U30A 5JXQA 3AMKA 4S3CA 1ISZA 7ODCA 3B8VA 5AC4A 1WV2A 4XAPA 4DJFC 2BGNE 4HNVA 1RCOB 4Q8WA 1OADA 3P8JA 1FKWA 3MP4A 5D75A 4PTMA 1Q63A 2A6LA 1E1CA 4Z0JA 3U2OA 2F61A 1NWTA 4DNHA 5FF3A 4UFIA 1QNRA 4QFUA 2DUAA 3APGA 2QMJA 3LN3A 4Y96A 3BGAA 3R94A 1R6WA 1EX5A 4IWWA 3KHJA 4PMDA 4OIFA 5A6BD 2QJGA 2BVYA 2X16A 3PAOA 3AMDA 4L6OA 2V5DA 2EPKX 3NM3A 1ICQA 4TUFA 4EF9A 4O1AA 2BTMA 4AD3A 1TIWA 4G50A 3NPUA 2X09A 3EWDA 5CPOA 5DMLA 3MMTA 1W1YA 4LEQA 4Q7IA 3O63A 2CU0A 1JDFA 4O2TA 1IF2A 4GXWA 4ZE4A 3BLKA 3EWYA 1FWGC 3DFSA 4KEZA 1MZRA 2PFHA 4J3XA 2B7NA 3MVIA 2XFWA 3RLGA 3L5MA 4MWAE 5CC7A 3WF4A 4NZ5A 2BX7A 4HU8A 1Q6DA 1VPQA 1C29A 1Z42A 3RGCA 1XP3A 2MNTA 4Q22A 1TJ1A 2BY3A 5I3JA 1FWRA 1QHZA 3C6CA 2XSBA 3CZJA 4NZ1A 3WLRA 3DG3A 2LKNA 3FAPA 1M7XA 1NM9A 1CLXA 1QASA 5EMKA 1QWGA 2H8XA 2J9YA 4A2SA 4GVIA 3RN6A 1RZMA 2PF8A 2OO0A 2Q71A 2YYTA 3VOFA 1GVFA 2C0HA 1JQXA 2QUMA 3QYSA 1Y5XA 1O5RA 3WMSA 3E5PA 2EG6A 4REQB 3QXBA 2VGBA 4KMQA 4JTFA 2YCLA 3O5EA 5LIKX 4UFKA 1P0BA 3LLXA 3PA7A 1VP5A 1H7OA 5I24A 1E55A 5HQEA 3IPWA 1WDSA 3KDOA 2OQLA 2DQWA 4DYJA 4O54A 2QJIA 1S46A 3WLOA 3M0HA 2G97A 3NPWA 4HD5A 3SCVA 1EWDA 1GJWA 3PJWA 4PCTA 1PIFA 5D9MA 3UF8A 1XYAA 5FL1A 1H51A 4L56A 1EYMA 3LCLA 3P84A 3BVJA 3KWXA 2IPGA 5ECUA 4HB7A 3WNOA 4S3AA 2WVSA 3QJAA 1CGUA 4S38A 1HKWA 3ANYA 3MI2A 2CBIA 5CGTA 3PPGA 2OKOA 3BAYA 1E0WA 5IOBA 3CZLA 1IR2A 3VD4A 1MVYA 3HMCA 3NEVA 3RXZA 4NNBA 4B90A 1P6BA 5A8PA 4RE4A 3UNDA 4UTWA 4O4VA 1NFPA 1PHQA 4RK8A 4BQ2A 3NQDA 4FX7A 3I7QA 2HBVA 2FH8A 4JZ5A 3H2NA 4JAWA 5K4XA 3N6QA 3CB8A 1AK5A 5LIWX 2WMKA 4ODQA 1CXHA 3UBPC 1TZ9A 1E15A 1NIUA 5I3IA 2MLXA 4CNUA 4OKDA 1HKJA 4FXFA 3DECA 4Q4RA 1CW2A 2G3MA 4FNTA 8CGTA 4Y6GA 3MVTA 4C90A 1W8SA 5HJYA 2VX7A 2VC6A 3FYOA 4MJZA 4NILA 3FLUA 3WK2A 3UJ2A 4GGQA 3UI5A 3W53A 4QITA 3FKKA 3ZWTA 2PBGA 3G1DA 2XSXA 2VVNA 4Z0SA 2QW5A 4MZ8A 1XLKA 2PDLA 3H8AA 3WF2A 4JNYA 2GK1A 4DUVA 4L4OA 1K6AA 2FTPA 3A22A 4D2JA 5CSYA 3ABZA 3O5RA 2GJNA 1AG1O 5HTGA 4ZO6A 4OT7A 5BXJA 1UROA 4UTHA 2OGJA 1B4EA 2TMDA 2YZRA 3KADA 4YXGA 3GDKA 1XJBA 3NQMA 1PSCA 3F4DA 5D03A 3AISA 2BS9A 1M5YA 1Q6GA 1N82A 4YYCA 3QFWA 2ZWYA 3UPMA 1YNYA 3V4BA 3NZPA 2VR2A 1QUMA 5HNUA 3GUGA 1CECA 4JTAA 1P5BA 3UZ5A 1PBKA 2Y89A 5HJLA 3I65A 3NEHA 1W3IA 3M1ZA 2VQTA 4JNZA 4GGHA 1W9VA 4DPPA 4LCRA 1HJVA 1V0NA 3DFOA 1C8YA 2OLSA 3P60A 1R9HA 4AX6A 2KZHA 3FY1A 1K7EA 2OG9A 2I9UA 4KPLA 1M3UA 1LYXA 3GXFA 2BSLA 1VEMA 3M4HA 3NOEA 3RLVA 1CGTA 3EA3A 2GUUA 1NOUA 1N7KA 3H4XA 1G7UA 2E5BA 1W5NA 1G5AA 4ZODA 4L4PA 5K4ZA 3DGBA 1IEQA 3W3OA 3GG0A 3ABXA 3VD7A 1DJXA 4U2YA 3OO2A 4Z2JA 4UTMA 2KR7A 4Y9MA 2OB3A 3DFHA 1JCJA 3PZIA 1MUMA 1S2UA 2PPGA 2ISDA 1YTDA 4DUWA 3WO8A 1WKFA 3WCZA 4MNLA 3MTWA 1J12A 3HQPA 3BUVA 1TUFA 4BQ4A 3HQNA 3CUHA 3W0KA 2POTA 5M1TA 1U1HA 4MOZA 4XV0A 1V3MA 1IZKA 3RCNA 1WDWA 4GA8A 1TKKA 4W84A 3KABA 2VRQA 3CPGA 5HNTA 1W6TA 1C8QA 3EEGA 5REQB 1GJPA 2ZTKA 1ITXA 1UD8A 3AFBA 3IIOA 4LF1A 1T41A 5E9AA 2VUNA 1P1XA 4TTUA 3H26A 3A23A 2AL2B 1R3TA 2ICSA 1WP6A 3T7VA 4HVXA 3WZ0E 1TA3A 4M82A 3TCZA 3SRKA 1LP6A 4HA3A 4O1CA 4RXFA 4HARA 4B9YA 2DT0A 3INPA 3JUGA 3PBYA 3B8SA 4TOQA 4QG6A 1W1PA 1E4IA 5AY7A 4Q8OA 1EEPA 4KCWA 2AQWA 1TWIA 1GVYA 4UQBA 2CLFA 3WJYA 3TNOA 4G56A 1YBQB 3LD5A 1K70A 1WNOA 3NPXA 2WM0A 5LNUA 1XRSA 5BXPA 1F3XA 2BV9A 3N4AA 3KAFA 1V6VA 1UR2A 1H3GA 3EDFA 2QNEA 3AWOA 1NVMA 3R8GA 2PWGA 1ZL1A 3VTRA 4F0SA 4CD7A 3W2LA 4JR5A 3ZJ7A 1IIHA 5T26A 4JTCA 1X6UA 2X0HA 3VK5A 1E1FA 1ZBKA 2CITA 3S2LA 5EU9A 1RLCL 2IW0A 3QY6A 4FEZA 3QTPA 3HBLA 3LS9A 1BSIA 3K8MA 2VC7A 1M01A 2VFEA 5FF2A 1T6MA 4G7EB 1WCGA 1E1CB 1T8QA 3GNXA 4JTUA 3MUY1 3W7RA 4BF8A 4EPDC 1I2NA 2UY4A 3M46A 2P5NA 3V5FA 1XLIA 2QCGA 2PLJA 3NL2A 2BFGA 4MYAA 7TIMA 1XM3A 4JEQA 2VP8A 4NQ1A 4HNUA 1HP4A 3ITYA 4QZVB 3LTPA 3S2CA 3DHFA 5BRPA 3EBVA 1EDGA 4XAYA 3BLEA 1QCWA 4MHBA 1E6NA 4MNJA 3W7IA 5H91A 4KW2A 3O3RA 1KWGA 1D9EA 1YNPA 5BW6A 3W86A 4CGTA 4GH3A 4FR1A 3VM7A 3MBDA 3G0UA 1BG4A 2C14A 1HL8A 7REQB 5AOUA 1GQNA 2G8ZA 5K9XA 2V2HA 3GH5A 3HGRA 1R9XA 1UR0A 3ZT6A 3C2VA 3VNKA 4C6CA 4HSNA 2PPOA 2GJPA 5HPCA 3LSBA 3CJPA 1PINA 1C7TA 2PDNA 3SCQA 1UBPC 3OTRA 1XLJA 2OEMA 3ABOA 5KITA 4RW5A 5E70A 3HPAA 1VPYA 2E77A 2I14A 2TODA 3BPWA 4GX9A 3VVGA 4KWSA 4J4NA 3BO9A 2NSXA 2YDRA 2WMGA 5AYZA 4GK8A 1WZKA 3GY1A 4B92A 4A3QA 1OGBA 4MY1A 3BCDA 2E8YA 3NNTA 4PTVA 3SCRA 4EF8A 1UR1A 1S3TC 1WDRA 3A4XA 1H62A 3C2YA 1YDVA 3S1UA 2XH7A 3MWAA 3R25A 2V5LA 4JTQA 4S1FA 4PMQA 4H83A 5J04A 2YYUA 3QV9A 4CCDA 2J75A 3O5LA 3M6YA 3M9YA 4Q8MA 2NQZA 2ISVA 1EGVA 2VC9A 2A3LA 4V1XA 1BQCA 2VOTA 4K8HA 3CL6A 4AZHA 4KWUA 3UR5A 4D8LA 1EJ7L 4NT0A 5M17A 1JI2A 1SO6A 2XP4A 4LPCA 1TMHA 3CLWA 1UJPA 4J3SA 1V0MA 3GFXA 5CSSA 1C90A 2OLAA 3UXIA 4FAPA 4QSHA 1TV4A 1EP2A 4FS9A 3NTPA 3WNPA 1H7WA 3OIXA 2OO6A 3KRZA 2Z7GA 3H2FA 3W38A 1K7XA 1K8CA 4M6QA 1NY1A 4IX2A 1QTWA 2YSWA 1E4MM 4ZR8A 2PDCA 2CCRA 4PMUA 4BF5A 3IVUA 3LGGA 4G2DA 2JZVA 4E4FA 4YS1A 5B8IC 4IPLA 3NZGA 4WDWA 3IJ7A 1QNOA 2DH2A 3S1VA 1XR2A 3PUGA 4GUGA 2FB2A 4H6EA 2XGIA 2VEFA 1LT8A 5H8UA 5F4SA 3NRKA 4G1KA 2D2HA 4O0QA 3GXDA 2CNCA 2WKGA 3E12A 2BP1A 2NV2A 2NVAA 1ALDA 1ML1A 4GKLA 4KFPA 3KBWA 2CLEA 3DHPA 5FD0A 1ICPA 4IP4A 1SZFA 3QFEA 1JUKA 2VEKA 1DJNA 1IXPA 5A6BA 2PDQA 4WUIA 3EEZA 4YMZA 3UGVA 2B4GA 4QRNA 2DVUA 1NF0A 4LVFA 1TWZA 3UWYA 1E9YB 3M64A 3UXLA 1JCXA 4DBWA 4UR7A 3TCEA 2OOGA 1W3TA 1FDZA 3EIPA 3IRSA 3N1AA 1BXBA 1NAL1 3EDEA 3NG3A 1WXYA 5JBEA 2NLYA 4KEUA 3M07A 1A3XA 1JJKA 3F4VA 2ZFAA 1NARA 1F3EA 1QK2A 4PUMA 4UZUA 4XUYA 3G8RA 2KGJA 1IXQA 2WQPA 1XLMA 3P6LA 9XIMA 2ZOXA 1TO3A 5HWJA 2QGHA 1JD9A 1WZMA 1WAWA 1JGIA 5C5YA 1TV5A 2Y78A 2VKZG 3MV01 3T1GA 3MWCA 3MQTA 4HMNA 1FFQA 5EBAA 1MFUA 4DWSC 1CCWB 1ZTVA 2HCVA 2F6KA 1BRLB 4FSAA 1QWKA 1K9TA 3UCCA 5D8ZA 3RO8A 4LX4A 3GS6A 1QDSA 3VGBA 1VFTA 4B4HA 2EBNA 1IE7C 4UOJA 1F8AB 1NU5A 1P0NA 1SW3A 1JCNA 4MSSA 1P5QA 1AJ0A 2WWCA 4OV4A 5BMWA 1WBHA 1W91A 4HBOA 3NO3A 4MKSA 1KTNA 3R7MA 4BEUA 3TDBA 6TAAA 4AYSA 5D33A 1UOKA 3JZUA 5G2IA 4CQ9A 2PLMA 4O57A 3BTNA 4H9ZA 1XX1A 2J78A 4NYYA 4C1NB 3W88A 4W9OA 4W7UA 3EOSA 4UWMA 3O5PA 2WM1A 5K2ZA 4QEHA 1K02A 5AB3A 4JFTA 1U22A 5CAKA 3R8RA 4ERAA 3G3MA 2DH3A 5HQLA 3O6CA 1E1EA 1GJUA 1H5VA 2ZRZA 2P0IA 3RILA 3VE9A 3V7PA 2A3CA 4LV9A 2QDDA 2P53A 4IL0A 4RLIA 2XWEA 5G2WA 3O5GA 1TRIA 2ZRUA 2BXYA 1EJTC 3CK5A 3QLLA 2WHLA 3PRAA 6TIMA 1ISXA 3TNBA 3BICA 2FJKA 2WC4A 3STCA 2ABBA 3OOQA 4V15A 4RV3A 2RSEA 4V33A 3CUZA 4RZ6A 2V81A 8TIMA 3BW2A 3G1XA 1JVWA 1V6WA 3IWPA 3BLDA 3NYDA 1RAKA 3P81A 1G4PA 3PS7A 5D4YA 5I09A 1YPXA 1C8XA 4NRRA 2PLCA 1EOMA 1UZ1A 2QKFA 4LFYA 4KCTA 1PCKA 1Q13A 2REQA 3G6LA 3PB0A 4QG8A 2HISA 3OBEA 5DO8A 2A3AA 4HK6A 3QR3A 3L0GA 5E0KA 1WXZA 4C6QA 4EXQA 4A6GA 3NQ6A 1ZUAX 3HM7A 5HMDA 2V67A 3L12A 1W0MA 4JDBA 4U31A 3S3GA 4M6UA 5BCAA 3OVGA 1SQ7A 3VO0A 5LIXX 4DI9A 4FXJA 2XVGA 3HMJG 1KW1A 4LAKA 4IQJA 3FEMA 2AAMA 5AC7A 3G24A 1XSJA 3AHZA 4TX9A 1H11A 1W32A 4N6FA 3ONBA 5IRPA 4PR4A 3BMBA 3R11A 2CHRA 3AIUA 2F23A 1SGJA 1UZDA 2ETNA 2ZRXA 4RE2A 3HJEA 1TJ2A 1LT7A 4IG2A 4ZQCA 1JZ2A 4PEEA 1GPFA 2NT0A 4Y7EA 1T8XA 5LGXA 4R53A 3W2MA 1CXKA 1R9YA 3ARVA 4WEVX 2CHOA 3TTOA 3VIGA 4ZTYA 2LLEA 1XBYA 4PCSA 3SGUA 1GVQA 2PAJA 5CCZA 4C6OA 2CWNA 3JU2A 2YCKX 3LMYA 4NF7A 6XIAA 3NURA 4BZYA 1U1UA 4KIRA 3W1LA 3GKAA 1A0CA 2WMJA 4YVXA 1GCYA 3TQPA 4QNWA 1PX8A 1HKIA 4D1JA 1J9YA 2HK1A 2IKIA 2NQ5A 2QCCA 1MW0A 3WMBA 1O4UA 2PWFA 2OEKA 2L2SA 1OX4A 1WKEA 3I3BA 3QR0A 3NPVA 4AWUA 3GHTA 4AMCA 3UY7A 2G3JA 2FFCA 1PB0A 1F5ZA 2PDHA 1TYGA 5AYBA 4YJ5A 3GFZA 4MWAC 3OOBA 1R85A 2OX1A 2WXDM 4HQVA 1QXLA 3DUGA 1R2SA 4R7OA 1XKYA 4GZJA 3W7KA 1Y0OA 2PSNA 4MM1A 1DIKA 5FCZA 3QR1A 1JF5A 2A79A 1FWEC 3KL3A 3HG5A 1UH4A 3OP2A 3WL1A 3STEA 3W7MA 4UB9A 2VFFA 3BAWA 4UC5A 2PDFA 5H2ZA 4QQUA 4YN5A 1UD6A 1NELA 3C2RA 1EBHA 1CX9A 1UC5A 1V02A 2CKRA 3OA3A 4GJIA 2EO7A 4DZ2A 1CGVA 4LEFA 4K8GA 1GORA 2QCEA 2D73A 4GMEA 4P8UA 1UR4A 1VGAA 3V36A 2J77A 4HCHA 1H63A 3GK0A 2VUYA 1EXBA 1J4HA 3CBWA 3WJXA 1EC9A 3V0TA 3EKLA 2VD8A 3VD3A 4AVFA 2VWSA 4J3VA 4QIBA 4JHOA 3UWWA 4GIEA 3ANUA 2GPTA 3W84A 1JFHA 1V0LA 1QOPA 4KRZA 1TE6A 3WDRA 6PTDA 5AVNA 3DYOA 4PCPA 5XINA 4A8RA 1BYDA 1CTNA 4GGBA 1W5QA 4HHLA 5EY5A 4R3UA 5FI8A 4IL2A 4LQ1A 4GNVA 4O0KA 3PTKA 3RYSA 1OYAA 1UC4A 2GUYA 1VFOA 2GSEA 2OKTA 4GBDA 3FYPA 3CXOA 4O50A 3ORWA 5D2VA 3L4XA 1W9DM 2PURA 2GQ9A 3NO5A 4YU1A 2JEPA 4GIAA 4CN1A 2XN1A 3EB3A 4CN4A 2D22A 4WQ6A 1XLEA 1EB3A 3CGNA 1P0KA 5IM51 1UWTA 4ZBCA 1AH0A 2J9XA 2Z2BA 4DWSB 2Y7FA 2JF6A 5AYIA 2DZBA 5A8QA 1XYLA 4ODKA 3CASA 3QKZA 2FGZA 1LOLA 2PDJA 3M0LA 1A5MC 1EPXA 3LYEA 3GXMA 1XCFA 1VAHA 3QEZA 1VBGA 4XZ9A 4I9MA 1REQB 2OX4A 2PU1A 1FWNA 3G1RA 4C91A 3W1MA 5J5DA 1LJYA 2XP6A 3IUIA 1OVDA 1R3YA 3WQOA 3OG3A 1ZK6A 2EHHA 3CLMA 4ZCWA 2G37A 5C9WA 1J2WA 4S3BA 1S2AA 1GZGA 2VVSA 3HG4A 4WGXA 4GCXA 3RRXA 3EYPA 1P6CA 3RF9A 1DWFM 3QY7A 1FKDA 2I5GA 5HJXA 1OZQA 1GOMA 3HV9A 3QV7A 2XWDA 4GO8A 5FL0A 1QOXA 2X30A 3VOGA 3Q94A 1O12A 3O5OA 1FDYA 2F6XA 3SURA 5LA1A 1RVGA 4NASA 3NTYA 3TYEA 3OVQA 3UCDA 2EXOA 4GZIA 4JFIA 3M0XA 1Q6RA 4BQ3A 2HJPA 1FKRA 1HZYA 3PM6A 4RNHA 3RCYA 3RJYA 4DRIA 2NQJA 4X3ZA 4M1BA 6CGTA 3G2GA 5E5CA 4KF1A 3W81A 2XTKA 5FEXA 2Y7GA 1LL4A 4XZMX 5JU6A 4D6EA 4U84A 3WQFA 2J8TA 1GYLA 3NM1A 3W22A 3LHTA 4WJXA 2BXVA 3HF3A 4MJ4A 4C6JA 2BDQA<