4NSBA

Crystal structure of the complex of signaling glycoprotein, spb-40 and n-acetyl salicylic acid at 3.05 a resolution
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
361
structure length
361
Chain Sequence
b'YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of the complex of signaling glycoprotein, SPB-40 and N-acetyl salicylic acid at 3.05 A resolution
rcsb
molecule tags Signaling protein
total genus 120
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4nsbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4nsbA01
4KMQA 2AMGA 1V0KA 4Z2LA 4U2ZA 4UOJA 5DF0A 2EBNA 3MV11 2CIPA 1CXFA 4KRTA 2VL4A 5JUVA 1VB9A 3T2OA 1JFXA 4AIOA 4WIWA 1WAWA 1FFRA 5JBDA 1CTNA 4N0RA 4H8HA 1KXTA 2YDRA 1W2VA 1C7SA 3IJ8A 3NJ3A 4OJYA 3DECA 3CO4A 5BXRA 1K9EA 4WSKA 4BQ5A 4HTYA 3MUZ1 2VQTA 1W1VA 1WZLA 1VBRA 3BC9A 1E0XA 2J8FA 3LPGA 1BQCA 1HXJA 2XVLA 2EPNA 3NSXA 4CN4A 1LLOA 1C3FA 3AZRA 3VDBA 4MDOA 1WZKA 2YA2A 1HKIA 1HP5A 5I0DA 3ARUA 1JDDA 4M29A 2XUCA 5AYBA 1VAHA 3SCRA 1BYCA 3N12A 1WZAA 4E2OA 3W24A 5IXEA 4JL1A 1UR4A 3OBAA 1E4NA 4J3SA 4TVDA 3L4TA 3AXHA 3BMVA 1PX8A 5HDRA 2CCRA 3THCA 2YL6A 5DFAA 5E6ZA 1PIFA 3WL1A 1OINA 1WPCA 1JZ8A 2GK1B 1LQ0A 2EPLX 1HL8A 3WNMA 3PTQA 3ALFA 1NOUA 1VFMA 4KGJA 3TP4A 3WDHA 1HKMA 1HP4A 2X0HA 2VOTA 3KL0A 2VR4A 3AIUA 1LG2A 3WD4A 3W6LA 3I3DA 1MFUA 1V3HA 1ISWA 2YA1A 4JHZA 3ZM8A 4Q7NA 1UYQA 3CZKA 2V3FA 7CGTA 2CBJA 4UZSA 5AC5A 1KR1A 1E6ZA 2G3NA 4S3KA 2J7DA 5I6SA 5A6BA 1X1NA 3CIVA 2VJXA 2GVYA 1WP6A 2WANA 2X05A 3K1DA 1H11A 3SIMA 3K8LA 1RD6A 4Q22A 1JD9A 1E4IA 3VIFA 1VRXA 4PN2A 1O7AA 5BCAA 3L4YA 3CMJA 1IZKA 3F5JA 5A95A 4CD6A 2PBGA 1K9DA 1HJWA 1VFFA 2GJPA 4W93A 4LQ1A 3VIOA 4D72A 3GNRA 1OSEA 1KCKA 1KXHA 4J27A 3ARYA 2WC4A 5KEZA 2A3CA 5CPSA 4S3JA 1UKOA 2CHNA 4J3VA 3VKKA 1OGGA 4UQCA 3VGHA 2D0GA 5C71A 1MXDA 2W91A 4DUXA 3ZMRA 3W6MA 5E0CA 3N17A 4CCDA 5E9AA 1VF8A 1US3A 4U31A 4AZHA 4JCLA 4U3AA 4PBGA 1EGZA 5A8NA 1QNOA 2OSWA 5CXPA 3NDYA 1BAGA 1HJQA 1UD2A 4AD1A 1UZ4A 1CENA 5M3WA 3DHUA 1IZJA 1QPKA 2VT0A 3QOMA 3ZIZA 4M24A 4AZ7A 2OYMA 5M5DA 4F9DA 4F8XA 4H2CA 3UERA 4BS0A 1VBUA 1V3MA 2E8ZA 5M03A 5I79A 3HJEA 4URIA 2DDXA 5LA2A 3S2CA 3VX0A 1CXLA 3UG3A 3I3BA 4P8UA 5DT5A 3FY1A 4JKLA 2FGLA 5C8BB 1G0CA 4JHOA 1B2YA 1V6XA 3OG2A 2E9LA 4D1JA 3EDEA 4H8VA 2QHAA 3B8SA 5ABHA 3W37A 1GNXA 4P8VA 1DHKA 2UY4A 1RP9A 3UR7A 1XSKA 4GI9A 5A8PA 1DWAM 1E40A 3M6DA 2CHOA 4AMCA 4ZENA 5EFDA 2IXUA 3WMCA 1QHOA 1L0PA 3CUIA 1KGUA 3II1A 3CGTA 2BVTA 2NT0A 1OIFA 1W2PA 4P7QA 3RIKA 4RE2A 1UA7A 1CLXA 4PMYA 5A6BD 1UUQA 1OIMA 4DM2A 3CZJA 4HU0A 3SCWA 2ZX9A 4FLRA 2JIEA 3AMDA 4QLJA 1B3XA 4AISA 1DEDA 4LYQA 3AYRA 2DSVA 1H2JA 3IAQA 3AIEA 1CPUA 2WHMA 4EKJA 1FH7A 3KL5A 1BGAA 4WKAA 3AMGA 1HJVA 2FDMA 3GNPA 2WM0A 2D2OA 2RGMA 5BWFA 2J62A 4DM1A 3GH4A 2ZUTA 2V3EA 4CCEA 4PMXA 9CGTA 2C7FA 2A3EA 1BYAA 2ZUMA 3AISA 4GZIA 4P7LA 3A6OA 2J79A 4J28A 4AIEA 1XCWA 5EFFA 2CERA 1EOKA 1A3HA 1B3ZA 1MQPA 3NSMA 3PZMA 1B3WA 1W3JA 1V6WA 3AIQA 1Q6DA 3SCOA 1GOOA 3T0DA 1W91A 2XM2A 3EDFA 1B1YA 2Y5EA 1JD7A 2VRJA 4ZXLA 4Y7EA 4AXNA 2DT1A 2G3MA 2CYGA 3OGSA 3AMLA 2ZE0A 2WWDA 4ATDA 1V0MA 4PMRA 1HKJA 3LMYA 1X6LA 1QOXA 1AQHA 1OCQA 1LG1A 1J12A 1ZS2A 1UKTA 3RCNA 2J7EA 1P6WA 2YDQA 2W62A 4LX4A 4C7DA 1JZ6A 4MJ2A 4E8CA 4LXFA 1B90A 3VINA 1VJZA 1TVPA 3TTYA 3DYPA 4JFSA 2G3IA 2JIWA 1HX0A 5I2UA 3ARTA 4LGXA 3BLKA 1WDQA 2F2HA 1V03A 2ZUNA 1UWRA 1NARA 3FHAA 1K9TA 3JUGA 1EHAA 4W87A 1HJUA 4OOUA 2G4FA 4GI6A 4UFJA 4WKFA 1F4HA 5A6AA 3CZEA 3CMGA 5CGTA 4ATLA 2WMHA 3WENA 1PJ9A 4FLQA 5F7UA 1WDRA 2Y2WA 2XVNA 3RDKA 4D6CA 6A3HA 1KB3A 3THDA 2WC3A 3DYOA 2W5FA 3PBGA 2EXOA 1QNPA 3PZOA 4XZWA 3WQ5A 2AAAA 3L4ZA 3WUBA 4JFTA 3VTRA 3MV01 3AI0A 1FHDA 3AROA 2EQDA 2XVGA 4H8UA 1TZ7A 1U30A 3WH8A 1UWUA 4J3XA 3GNOA 3SUSA 1J18A 3PZNA 1WZMA 4WF7A 2VQUA 1H1NA 4PTVA 3AQUA 4D6IA 2XIBA 4UTFA 2A3HA 1GJWA 3A4WA 1W32A 1CGYA 1D3CA 4ZFMA 4FLSA 4AEFA 1QNQA 1GOIA 1XYZA 5LYRA 1H0IA 3T2QA 4KWUA 2DIEA 2WXDM 1JYNA 4W8BA 2NSXA 1O6IA 4P7OA 1GVIA 2ZIDA 3TONA 1SR0A 4AYSA 3PN8A 1VJSA 4J3TA 1KGWA 4UFHA 3SCSA 1N82A 4JCMA 4RE4A 3SUVA 2J7CA 1ZJAA 3BSHA 4AD0A 2ZUWA 2QLYA 3ZSSA 1FFQA 3VGEA 2ZXQA 1GJUA 1MW0A 4LYRA 4FMVA 4L4PA 1E6QM 5A6MA 2WZIA 3QHMA 2WSKA 1WCGA 1MYRA 3WQ4A 3AMKA 2VZSA 1JG9A 3SUTA 4M56A 4TVCA 1E4MM 4MB3A 4CD5A 2O92A 3RILA 3WNLA 1D2KA 5GNXA 1LL7A 1FHLA 1H4PA 5I78A 1KBBA 5ABFA 2FHFA 2WMIA 4HZ8A 1WE5A 4JFVA 1B9ZA 3ZOAA 3W27A 3APGA 1TG7A 2JF7A 3VM5A 3WFZA 2VZUA 2XIIA 1B0IA 2DT0A 1MWOA 4HMEA 3VIGA 4AD5A 5IDIA 1EDQA 1BG4A 4FLOA 5FKYA 1TCMA 3WH7A 2W67A 2VR5A 3MUY1 4PUDA 5D9PA 4AWEA 1R86A 2WVUA 3K4AA 1EO5A 1JFHA 2TAAA 4RL3A 1HIZA 4ATWA 4PMUA 1KWKA 3RM4A 3CHFA 2XGIA 3SCVA 3WDRA 5BYWA 1ECEA 4H41A 2BY2A 4NRSA 3WEMA 4ACZA 4UFLA 5BXSA 5CG0A 3WDIA 3L4WA 2C0HA 3MKKA 2D3NA 3PZTA 1AQ0A 3MANA 1LL6A 2CPUA 1X6NA 3GXDA 3MU7A 3VIHA 4PMDA 1W3HA 1E43A 4B3KA 2D20A 4WSJA 5A1AA 4HOZA 2YBTA 2UY2A 1WNOA 4H7VA 2CBIA 4QFUA 2XJ7A 2J8GA 1UR8A 2YL9A 1KXQA 3BCFA 3QOKA 1JXKA 4MAZA 3SUUA 3AZTA 1TA3B 2Z1SA 4HPHA 4GO8A 1E0WA 1MW3A 3O6AA 5A2CA 1J10A 1GOWA 3GH5A 2QPUA 3MUAA 2D23A 4WK9A 1MW2A 1E72M 1GOKA 3U5YA 5LA1A 2GSJA 1SFSA 2D0FA 1CGVA 3AHVA 1U2YA 3IK2A 4L4OA 4H04A 2XGBA 1MVYA 2YA0A 4B9ZA 4IUGA 2VUYA 4ML4A 1WO2A 1BHGA 1CECA 4W89A 5D9MA 3K46A 3AIVA 2EPOA 2VZOA 3GH7A 3U57A 2QMKA 1CXIA 3BH4A 4AZCA 2E3ZA 1JI2A 2FGZA 2OWXA 3VD4A 1B3YA 1UKPA 1E6RA 4AZ5A 5C70A 3AS2A 1QI5A 3K4DA 4TUFA 3WD1A 3E1F1 3AS0A 4PMQA 5DT7A 1UD8A 3GBDA 1QW8A 3BAWA 2JFEX 3WUFA 1UWIA 4BCEA 2W4XA 1JDAA 3BMWA 4DWSA 3PZQA 3RO8A 3VD3A 4JAWA 2DH3A 4PSRA 1LL4A 1RPKA 3EMQA 1Q6FA 2V3DA 1J11A 2BNJA 4QCEA 3WF1A 1OGSA 4W84A 1E5JA 1JGIA 1UD5A 2CNCA 3DYMA 1ODUA 2J74A 4J7RA 3QHNA 4C7FA 2DT2A 1KWGA 1KR0A 5GNYA 2ZX5A 1TE1A 1H09A 3SCPA 5A69A 3FW6A 8CGTA 1JF5A 1CDGA 1J0HA 2BHZA 2ZX7A 3WN6A 3EDJA 1G9HA 4W86A 3IANA 1HT6A 2YJQA 4GZJA 5CPQA 5BRQA 3SURA 2WW5A 4QCFA 3MO4A 1EQPA 1PZ2A 3WY1A 3BXWA 3WMSA 3KWXA 3B9AA 1E55A 3PHAA 4D6EA 2DSUA 1CBGA 1DWGM 4NRRA 2ZXBA 2VTFA 1JZ3A 4AW7A 1JI1A 2WC7A 4HP5A 4UQAA 4MB5A 1UKSA 2QF8A 1JNEA 2OSXA 1H49A 3W4RA 1GQKA 3CUGA 1NOWA 4MJ4A 1V3LA 3WQ6A 2W92A 3WL0A 4MDPA 2BV9A 3EYPA 3WNOA 2FHBA 3VIIA 4PMZA 4HMDA 3CTTA 4B16A 2CBUA 1TUXA 1QNRA 1M01A 2ZX6A 4V28A 4QP0A 4OOZA 1NP2A 2UWFA 2Y8KA 3F5KA 2WMGA 2XVPA 5AC4A 1C90A 3GDBA 1M04A 1XH0A 2VVSA 4J3UA 2WCAA 3FNDA 5JIPA 1UQZA 3ARRA 1VFOA 1BVZA 3WD0A 1BF2A 2GUYA 1FP8A 4M8UA 4AIUA 4LYPA 2FH6A 4QLLA 1FH8A 5EB8A 1UH2A 3L4XA 3W26A 1OT2A 5FL0A 4PYSA 1ZBCA 4OIFA 3N15A 1US2A 2G3JA 2W63A 1BTCA 2J77A 4GO9A 1AVAA 4TX6A 4UOQA 3VNYA 3VIMA 1HKKA 1C8QA 2VMFA 3CBWA 4UQEA 2EPMX 5GNZA 1JL8A 4MNMA 2WBGA 2J75A 1E6SM 1CGWA 3W28A 1MXGA 4DWSD 4UZUA 1V3JA 1NWRA 1C91A 3OLDA 1ZL1A 1Q4NX 2WLZA 1I75A 2DSZA 2W61A 4CU6A 1CXEA 2ZUSA 1XH1A 1JAEA 3PTKA 3WKZA 1DP0A 3N9KA 1SYTA 4W5UA 2WB5A 1EXPA 3N13A 1W1TA 1J0YA 3RJYA 1HJSA 4NZCA 2WZEA 4X0NA 2X09A 3CPUA 4NF7A 2DGAA 3VIKA 4BQ2A 1CXKA 1LF1A 4W7UA 2Z1KA 1G01A 2D1ZA 4GINA 1W3LA 3WD3A 3ZJ8A 4E4PA 2EO7A 1WDSA 4KRUA 1UD6A 1WKYA 4AZCB 3FAWA 1XSJA 3ALGA 2ZWYA 3ARQA 5HPOA 3ZT5A 5IHRA 1UD4A 5AYIA 2X8RA 4LPCA 4UFIA 4AC1X 1XH2A 5E09A 2CBVA 1HJXA 1TVNA 2GJXA 4AZ6A 1J0ZA 3UCQA 4ZXOA 4MTVA 4IM4A 1JF6A 2VRQA 5HBFA 4AY1A 2ZUVA 5FD0A 3KEHA 1PX4A 1E1EA 3VU2A 2VC9A 4CCCA 1H3GA 5ABGA 3BGAA 3WDQA 1E3XA 3T08A 3RMEA 4PTMA 1EHNA 1CLVA 3BAJA 3POHA 1D7FA 1BVNP 1G5AA 1NP0A 3PZGA 3SCTA 1RH9A 4ZE5A 2VX6A 3GYCA 4CU7A 1GORA 3WH9A 4HOXA 5JBEA 1GOMA 2JF6A 2DQXA 3CZLA 3WBEA 1PBGA 3VILA 1GUVA 3ZR5A 1NQ6A 1OM0A 3EDDA 4OZOA 5CLTA 5A3HA 5A2BA 5CSUA 2CKRA 2WHJA 1E70M 3NIYA 2EJ1A 1ODZA 4GZEA 4TOQA 2C8NA 3OZPA 1CEOA 4Z2HA 2BY3A 2D0HA 1UZ1A 3W53A 4N42A 2WVVA 2J4GA 1W9BM 1ITXA 1QI4A 1UHVA 4UOZA 5CZKA 3DC0A 5JBFA 1NWUA 2EEXA 1FA2A 3AHXA 4UFMA 1V6UA 1J0KA 1JXJA 2XWDA 3GBEA 3ARWA 2CKSA 6CGTA 1AMYA 1EA9C 4Z2GA 3NCOA 3GXMA 5D8WA 1QHZA 6TAAA 5BROA 3K8MA 1GHSA 3N18A 3NYDA 2WLYA 4WKHA 1H5VA 2RGLA 1VEOA 1H41A 1KBKA 4IISA 1V3KA 3AFBA 2D3LA 4D6FA 5JH8A 2GK1A 3VIPA 2YLLA 4AZBA 2O9RA 2BY0A 5E70A 2VNCA 1BSIA 1QI3A 3VOCA 2V5CA 1HL9A 2V3GA 4U33A 3DHPA 4NI3A 3KZSA 3VDHA 2WHLA 1KGXA 4JL2A 4CD8A 1E1FA 2E9BA 5ECUA 1EQCA 1UR9A 2YOCA 2WHKA 2VX7A 2BS9A 3OA5A 1XD1A 4GIAA 2FHCA 4XUYA 4B9YA 1UKQA 2XG9A 3AZSA 5FIPA 2E4TA 2PC8A 5GPRA 3EMZA 3LPPA 2VVNA 1E71M 1R8LA 1ISXA 3WNNA 4CGTA 3MS8A 2OLHA 5A6LA 4XX6A 5I77A 2IUZA 3CUHA 4MAVA 1JZ2A 1VEPA 3MSDA 3VD7A 2DSKA 3VD9A 1JYXA 1XCXA 1E56A 3RM9A 4X0VA 1PX3A 1E73M 4TTGA 3OLIA 2ZX8A 1QHPA 2OYKA 2VCBA 3M07A 4PMVA 4V2XA 3L2MA 1E6NA 1Q6GA 2DIJA 5M17A 1UWSA 3B9EA 5BXTA 4PUEA 2B31A 4MB1A 2WZHA 4UQ9A 1CWYA 2ZUUA 1JYWA 2PI6A 3W25A 1UWQA 1OBAA 5A6JA 5D9NA 3W81A 3TOPA 4JFWA 3T0AA 3BAKA 4R27A 1I1XA 4KH2A 3AXXA 2BXZA 4W7VA 4BA0A 2UY5A 2VCAA 5D9OA 1M7XA 4JKMA 4MB4A 4W5ZA 4QDMA 2YIHA 1PZ3A 4PEEA 3ARVA 3MSGA 4CUCA 2QMJA 4GPNA 5DO8A 1C7TA 3PZIA 3VDAA 1RP8A 2VZVA 2XHYA 4D1IA 1TR1A 3N04A 1QVBA 4M1RA 1E15A 4A3HA 4TXEA 2YLAA 4MPKA 1QW9A 5DEZA 1CIUA 3QHOA 2JALA 3VGFA 1CZ1A 3MMWA 3TA9A 1HN1A 1J0IA 1F4AA 3D3AA 2PB1A 1OT1A 2J7GA 3WEZA 2XTKA 2XFFA 3VMNA 1DTUA 1U33A 2YDSA 1LWJA 4PCTA 4DUVA 1W9XA 2Y4SA 1B31A 2ZXDA 3WUEA 4BZYA 2XSAA 1MQRA 2GFTA 3AIBA 3CHDA 2BHUA 1CXHA 2ESCA 4OKDA 4OBRA 3W38A 2WMFA 4PTWA 4XB3A 3FHQA 3ZJ6A 4HA4A 2NW0A 2G41A 3O9NA 2WVVB 1CGXA 3OIHA 1K6AA 4MNJA 4UFKA 1E0VA 2WNWA 3F5LA 2PF0A 5E0FA 3WNKA 1KQYA 4JZ5A 5A6SA 1XV8A 4GQRA 4K68A 2EPKX 1DWIM 2OWWA 3L2LA 4P7NA 3VGDA 1BGGA 4CVUA 3OLEA 4D71A 1E3ZA 1BFNA 4UCFA 3VIJA 3VO0A 1B30A 3TTQA 5I23A 1HNYA 3G6MA 3GXIA 5I24A 1B3VA 4J3WA 4OUEA 1Z32X 3QGVA 1PIGA 3RM8A 2YBUA 3SUWA 3CUJA 4XZBA 3AIWA 1FP9A 3GZAA 2E0PA 1ZB5A 2J78A 3FAXA 3I3EA 4JKKA 5FCZA 1GPFA 3FXYA 4A4AA 3AIRA 1E5NA 2PWEA 3W29A 2V5DA 5IHSA 2Y24A 3SCUA 3WSUA 1W9UA 3QR3A 4UNIA 1V08A 4W85A 1JZ7A 3IJ7A 2VI0A 3UESA 3BAXA 3LPFA 3HN3A 2YKKA 1ZJBA 4EAMA 2PWHA 2XSBA 4HZ6A 3AHYA 1FH9A 1IT0A 3GM8A 5JIWA 3CHEA 1EDTA 3S6TA 1NM9A 5CSYA 1UQYA 3VPLA 3WF2A 3AS1A 4ACYA 2A3BA 2E8YA 3WUGA 1A47A 4WLCA 3UETA 1M53A 4AD2A 2ZOXA 4FF5A 4M82A 5FOOA 2XFRA 3CLWA 4OBSA 2A3AA 1XGZA 1HVQA 3WELA 1JYVA 4YPJA 3WH6A 2WKGA 2JEPA 5HNNA 4HPGA 4GI8A 3VM7A 5ABFB 4TTUA 2WMIB 4B15A 1S46A 1XSIA 5CQ1A 1MQQA 2O9OA 2GJRA 4HU8A 1E9LA 3AS3A 1UR0A 3KL3A 3UEQA 7TAAA 4C7GA 5A8MA 3BAIA 3VD5A 2W66A 4AZIA 1H0GA 2HISA 1E6PA 1QBAA 4P8XA 1BYDA 3GXFA 2WVSA 2ZICA 3F4VA 3WQVA 3PZUA 2E9MA 4EK7A 1GQJA 1R85A 4F9JA 1NWTA 1SMDA 3MUIA 5I5RA 2XWEA 4U5KA 1V6VA 3OGVA 1UA3A 2J47A 1XC6A 3MMDA 4V27A 2XM1A 2G8ZA 4D6JA 4D6HA 1CGUA 2XYLA 3POCA 5BXPA 4M80A 4ACZB 4PMNA 3ARXA 2WKLA 3UG5A 4B3LA 3OGRA 1CGTA 2ZXAA 5EBAA 3ZJKA 2BY1A 3OZOA 4U3CA 4WJXA 3ARSA 1SMAA 3WF3A 3IAPA 3WDJA 3U7VA 1UR2A 4YHEA 3ZSTA 3A4AA 4HOWA 2DH2A 5CGMA 3FN9A 1JIBA 2ZWZA 5CLWA 1YQ2A 3GTNA 4JIEA 4M81A 3EDKA 4MADA 3EBVA 3WQWA 3WEOA 4AEEA 4D6GA 3CH9A 4HZ7A 1Q6EA 2D24A 1BG9A 5CPTA 3ZQ9A 1W9DM 3WF4A 4BF7A 2WMJA 2WSPA 4PMOA 1C93A 3VVGA 3M46A 1Y7VA 2WK2A 5D4YA 3T0BA 1BLIA 1XYFA 4ZEPA 2X1IA 1DWHM 2WPGA 3W82A 1C8XA 2E40A 1VIWA 2CXGA 4AD3A 3L4VA 1VEMA 3RPMA 3AICA 4YN5A 3AXIA 1NOFA 1XRVA 4EE9A 5D8ZA 4PTXA 2VX5A 2BFGA 3ZT6A 1ISVA 1EOMA 1KQZA 2MANA 1J01A 1J0JA 1XD0A 1JZ4A 1M03A 2GDVA 5CJ5A 4BQ4A 3L4UA 1E6XM 2JEQA 2VRKA 3AMCA 1JAKA 1GZJA 4W88A 3ZO9A 2VZTA 1W1PA 3AJ7A 1PPIA 2OWCA 4E8DA 5LA0A 3T2PA 2J7BA 5A94A 3ZJ7A 3AHZA 4DWSB 1V6YA 2BHYA 1KFWA 4PCSA 3J7HA 2BXYA 1JZ5A 2DPEA 1V0NA 4F66A 3NUKA 4CVWA 1LWHA 1OD0A 1OWQA 1TFVA 3HMCA 3MMUA 3ZR6A 1GQLA 2J7HA 4U2YA 2V38A 1OGBA 2WVTA 1GONA 3TTOA 4W7WA 5GQBA 5A2AA 3AHTA 5I3DA 1AQMA 3K8KA 3WH5A 2CESA 4BQ3A 3BAYA 2DEPA 4GXPA 1JNDA 1UH3A 3U7BA 5DMYA 1CYGA 2D22A 3UG4A 1XHGA 3LPOA 2WBKA 5HXMA 5HOSA 3VGGA 1NH6A 1KXVA 4QAWA 1MFVA 1G1YA 4QLKA 1C8YA 3BCDA 3CZ8A 3ARPA 1FOBA 1W9PA 1C92A 1QI0A 2QPSA 3VMOA 1ZU8A 1GQIA 3WQ8A 4CN6A 4JFUA 1ISZA 7A3HA 2PWFA 2X0YA 4UQBA 1OD8A 2DT3A 3VUPA 2VURA 1R7OA 2DSWA 5A6KA 1WDPA 3CZGA 2VX4A 3W0KA 2XPKA 1L8NA 4XV0A 2GDUA 1ISYA 5BRPA 1ZBVA 1QI2A 5HPCA 2WCSA 3PZVA 1PAMA 3KE0A 1BPLB 3BLPX 4TX8A 3WNPA 1TA3A 3PTMA 4CD4A 1W1YA 1CNVA 1JDCA 1V3IA 2XFYA 5A8OA 1R87A 4W8LA 2VO5A 3IJ9A 2WMKA 1OB0A 4TVUA 2AOSA 1VFUA 3VNZA 1LJYA 2VCCA 3SEPA 2J7FA 1QNSA 2O9PA 4D6DA 1EIBA 2JE8A 3SCNA 4UQDA 3B9DA 4DWSC 1GW1A 2HVMA 2YL5A 3N1AA 1V02E 2O9TA 3VMPA 3NSNA 4ZE4A 1UR1A 1ZBWA 1ITCA 5EMYA 3ZT7A 1W9VA 3VDCA 1KCLA 1V0LA 1WB0A 2IXVA 4AD4A 1V02A 3CHCA 3VX1A 5ABEA 4EANA 3ARZA 2UY3A 3OB8A 3BSGA 3PZ9A 3D5HA 4R5EA 4P7RA 3G6LA 1GOQA 2BVYA 3M7SA 1UH4A 1Q6CA 4Z2JA 3NDZA 2WWCA 3A4XA 5AY7A 2CITA 4YHGA 4CKQA 4UR9A 1UG6A 1ESWA 4FK9A 1W3KA 3WIJA 2OSYA 3WF0A 3O2LA 3WD2A 2BVDA 2WCGA 4CU8A 3TTSA 4W8AA 4PSPA 2CEQA 3EMCA 4F79A 2OYLA 3AYSA 2J25A 3A47A 2F61A 1HVXA 1NWSA 1GCYA 3WFLA 4CN1A 1I1WA 2NT1A 2X2YA 4X9YA 3HU7A 2Q8XA 3U5UA 3WMBA 2QV4A 2CETA 4IPNB 1QBBA 5FL1A 5A8QA 3RJXA 5IFTA 1DWJM 2XVKA 5E6YA 1K9FA 1J9YA 1UWTA 4HA1A 1UOKA 1ZBKA 1G94A 3WDPP 1E4LA 3AOFA 3UR8A 4IPLA 2Y8VA 1EDGA 2PWGA 5IFPA 2WYSA 4HA3A 4GKLA 2PBOA 1HF6A 1UD3A 3N11A 4CD7A 1GVYA 3VGBA 3CUFA 4NSBA 4AZGA 3A3HA 4U5IA 1TMQA 3ECQA 5KZ6A 1EO7A 2F8QA 2WAGA 3T09A 3WBAA 1MW1A 1VENA 4P8WA 1PEZA 4A3YA 4DUWA 2GJXB 4MNLA 8A3HA 1GHRA 1IV8A 2FH8A 1YHTA 1R7AA 4MNKA 5TD4A 3SCQA 4HMCA 1EH9A 2YL8A 3OLGA 1BYBA 4PRWA 4RE3A 2PWDA 4KGLA 1DWFM 4Z2KA 4GQQA 4Z2IA
chains in the Genus database with same CATH superfamily
1V0KA 1D8WA 4Z2LA 2X2GA 5DF0A 1AG1O 3KBWA 3B8VA 4CNOA 4XKYA 2CIPA 3NQCA 2OR2A 1CXFA 4KKXA 4MLRA 3YPIA 1VB9A 1JFXA 1XLCA 3PBMA 1PXGA 1REQA 1P6BA 1UC4A 2EG6A 3KLKA 4DJDA 1NFBA 1C7SA 3HV9A 3IJ8A 3LLFA 3NJ3A 3MUXA 5C9UA 3CO4A 1HL2A 1PDYA 1SVDA 4BQ5A 3EKLA 2VQTA 3NURA 5CKSA 5H2ZA 2ZR4A 2O55A 4ADUA 3W3OA 1O5QA 3LPGA 1VYSX 3OVPA 3R58A 1C3FA 4JFMA 3DOPA 1MRAA 3DI0A 3UJRA 1HKIA 4MJMA 2PLKA 5I0DA 4XAGA 2PURA 1JDDA 4ZA0A 4GY0A 4AWTA 1ZCOA 1VAHA 3HPFA 3SCRA 3KOXA 4XD5A 4E2OA 3GFZA 4E5TA 1E4NA 3BMVA 3IVSA 3TC6A 1E1CB 5HDRA 4A8LA 3HTWA 2CCRA 2FKPA 3O06A 1LORA 2YL6A 5REQA 1EKOA 3NL2A 5C5YA 3DFYA 1ECQA 1OINA 1WPCA 2XIOA 2FPYA 1HL8A 1K02A 1ZALA 3C2VA 2QAFA 3QGAC 4JNMA 2C6QA 1DJXA 3LRMA 4I8DA 4N02A 3CYVA 5B7ZA 2KO7A 3KAOA 4PUKA 1B6CA 3AIUA 1IT8A 1DYSA 3WD4A 1MFUA 1V3HA 4O8AA 4Q7NA 3NQBA 5AC5A 4U86A 2Z1XA 1E6ZA 3HGOA 3OQ8A 4DPQA 3E5BA 2ZQUA 3SQSA 2GVYA 1WP6A 3ONBA 3OHIA 3KRZA 1AL7A 2HROA 3T05A 1DORA 1RD6A 4E4FA 3VIFA 1VRXA 4K38A 5BCAA 1WXYA 3CMJA 1IZKA 1DJYA 1MUWA 5A95A 4RPQA 5EGRA 1HJWA 1VFFA 4W93A 4MZ8A 1V8EA 2IQ0A 4YWSA 4QRNA 3ES8A 1Q2RA 4NAFB 4GY7A 4RPPA 3L9CA 3TYUA 4DAFA 1OSEA 1KCKA 3LG3A 3EX4A 4AIBA 1OYBA 3LA4A 1YLVA 2YCIX 2PDQA 3VKKA 4KCWA 2CC0A 3GTYX 3TWBA 1B4KA 3G18A 4JY9A 1Q6RA 1L6FA 3BMXA 5K4XA 1MXDA 1Q6OA 1T8QA 2W91A 4DUXA 4LRSA 3ZMRA 3W6MA 4O14A 4DYKA 1EF2A 3SQLA 3V1HA 4DZHA 2OOGA 3H21A 1VF8A 4QM1A 3B8UA 3PJXA 4PBGA 1EGZA 3W9ZA 1J4RA 4LAYA 3NPVA 1BAGA 4AD1A 2KZHA 3R25A 3TW7A 3DHUA 1IZJA 1F76A 3QOMA 1YE6A 3ZIZA 3GX9A 2OYMA 4F8XA 4M0XA 1H7WA 3SRHA 5FJJA 1XUZA 3FGCB 5M03A 4XKYB 3UWVA 5I79A 1KM0A 5HJLA 2I5IA 4AFYA 3OG3A 1B3OA 3ICJA 5LA2A 3S2CA 3VX0A 1MNZA 1F3WA 1M65A 3IGXA 1FKTA 4JKLA 2OZ3A 4CQAA 2FGLA 4UMAA 4DYJA 5C8BB 1B2YA 2ZYFA 4D1JA 2IQTA 2QHAA 3B8SA 3AYVA 1DHKA 1RP9A 3JU2A 4GIVA 5A8PA 2CLOA 1GVFA 5FF2A 2J8TA 3O6CA 1IWPA 3WMCA 1L0PA 1KGUA 4GLEA 3II1A 5J5RA 1RJQA 4IQEA 2NT0A 1F3EA 1OIFA 3U9IA 5H91A 5HAOA 5I09A 1W2PA 3RIKA 4NAEA 4RE2A 4DELA 1CLXA 2VGFA 1G4TA 4YWIA 2BTMA 4HK7A 3A24A 2HBVA 3IIZA 2ZX9A 1VFSA 3UI6A 1RAKA 4GC3A 5D33A 1V51A 1NY1A 4J9JA 1OADA 1A5MC 1TTQA 3HQ1A 2MUCA 3RK8A 3TDBA 3RCMA 4FAPA 4EKJA 1BGAA 4WKAA 3TN5A 1I6NA 3AU2A 1TZZA 5C9RA 4GISA 3GNPA 2WM0A 2RGMA 3CJPA 1LP6A 3GUWA 3UGVA 1AH4A 5CPNA 1SO3A 4CCEA 4PMXA 3ZWTA 4IQDA 2VN1A 3GAYA 1UIPA 3NPUA 4H3DA 4P7LA 3A6OA 2J79A 4J28A 3KLLA 1CT5A 3NDOA 5XIMA 2B5UB 1B3ZA 2KGJA 4C5YA 2FZ8A 5DIUA 4HKPA 1QPNA 3WK2A 3AIQA 4IFRA 3T0DA 4BY3A 2DU2A 3EDFA 1B1YA 2Y5EA 4E8GA 3QPEA 3OOQA 3WQOA 4AXNA 2G3MA 4QT2A 2CYGA 3OGSA 2ZE0A 3AMLA 4ATDA 2ABBA 4PMRA 1HKJA 1NF7A 3EEZA 3GD6A 3PRBA 1OCQA 4Y8EA 4QS6A 4O0ZA 1LG1A 3RCNA 1P0NA 1P6WA 1PKNA 4RR4A 4C7DA 4TYOA 3BJSA 4IJRA 4LXFA 2Z6JA 3V16A 1BQGA 5E0KA 3TTYA 2D2JA 2OQLA 1F61A 1HX0A 3MQTA 2MPHA 1QWGA 3BG5A 2ZUNA 1QJWA 1NARA 3FHAA 1NFGA 4O15A 3O0FA 4YNGA 2GDQA 4L1XA 3FA4A 2G4FA 3C61A 4WKFA 1F4HA 4O4VA 1R3SA 4ERAA 2PDUA 5D37A 4EPKA 1TWWA 4FLQA 1DJZA 2HPIA 2GOKA 2GQ3A 6A3HA 3O07A 2WC3A 4HNLA 3S1WA 1AODA 3QW4B 3WQ5A 3L4ZA 1Y0EA 4HNCA 1UP2A 3NQDA 3QTPA 3MV01 1FHDA 3AROA 4YMZA 1YXCA 1AW5A 3U4AA 4H8UA 3ZFHA 1TZ7A 1AL8A 3TSMA 3SUSA 1YEYA 3GG7A 3GNOA 3QR0A 4GACA 3TJXA 1JUEA 4D8LA 4S3GA 1KRMA 2CLEA 2PP1A 3ZLHA 4AEOA 3DG6A 2DFAA 1CGYA 1D3CA 4ZFMA 3A23A 1AUSL 5LYRA 4I9TA 1H0IA 4WVXA 3T0TA 4IXXA 2DIEA 3THUA 4LT9A 1TX0A 1XKJA 4MZYA 3VXGA 4RUBA 1XLAA 3V0TA 1FKIA 2DW7A 3APYA 1Z7AA 3ZSSA 5CG7A 3VGEA 4OT7A 2UZ9A 4TU1A 3NQ2A 4HTBA 5A6MA 1EYEA 4MSPA 3CWHA 2HWGA 1DPMA 3SRDA 4B4HA 1JG9A 4M56A 2DVXA 4TVCA 4MMWA 1IT7A 1E4MM 4MB3A 2H3BA 1B57A 1K7FA 1FXPA 1Z41A 1C9DA 5GNXA 1FHLA 2I1OA 5ABFA 2FHFA 4HZ8A 4G8TA 3SY8A 1TG7A 2JF7A 3OBEA 3VM5A 3ITTA 2VZUA 3KAHA 4LAKA 4P5UA 2F9RA 1MWOA 4HHHA 1EGVA 5AC8A 1EDQA 3PBYA 2Q8ZA 3LXAA 1TCMA 5K2ZA 4UXDA 1OX4A 5DY2A 3K4WA 2W67A 2BOEX 4PUDA 1XIIA 4AWEA 3K4AA 2F2KA 4DHGA 1W5MA 4I8YA 1NU5A 2TAAA 2ASHA 3TN4A 1KWKA 3W2UA 3TYEA 2JGYA 3RM4A 3G3MA 4DBSA 5F4WA 1HGWA 2XGIA 2GJLA 7PTDA 4MOZA 3QQ1A 2BY2A 4NRSA 3WEMA 3W74A 4AF0A 5CG0A 3L4WA 2D3NA 4L56A 2Z6IA 3BANA 3RCYA 1UB3A 1Q7ZA 1AQ0A 3VKBA 1EX1A 5G4EA 3EB4A 4GUGA 3MU7A 3KW3A 4HK5A 2RSEA 1E43A 4WSJA 1VYRA 1L6YA 2YBTA 2UY2A 3NGJA 2XJ7A 1Y0OA 1UWAA 3W1MA 2PCEA 2HS6A 4RDYA 4MAZA 2C0AA 3S2LA 4GO8A 2J6VA 3SN0A 1MW3A 1J10A 1GOWA 1UC5A 1SFSA 3RRAA 2D0FA 3PAOA 4K36A 2PDPA 3F1QA 3FX4A 4HIBA 2Q71A 3VNMA 1P0EA 1A4MA 3SGUA 2ZQTA 1WO2A 3W7LA 2A5HA 5K7JA 4C6FA 3NZQA 4B3ZA 3QKZA 1FHVA 3AIVA 1DE5A 2EPOA 3GH7A 1PUDA 2NVCA 4JYFA 3C2EA 1ELSA 4HBKA 5HWMA 2GPTA 4IGSA 3O5GA 1XLLA 4N9DA 2E3ZA 2FGZA 3PG8A 2VXNA 4JFIA 2ALDA 3AS2A 2OO6A 2VEGA 3G0SA 3K4DA 4CEXC 4TUFA 3IJ6A 4EF9A 4AY7A 5DT7A 2JFEX 1UWIA 4JIIX 2W4XA 3OYZA 2REQB 2ACQA 1SFTA 1WXZA 2WZMA 3VKCA 4GG9A 3PZQA 1FCQA 1J5TA 2DH3A 5CSSA 3I4KA 5H1WA 4JQ4A 3W88A 4G7EA 2B4GA 2ZKMX 1Q6FA 1M68A 1J11A 2BNJA 1E5JA 1NFPA 3DYMA 4IJCA 4MIMA 4J7RA 3CO8A 1XI3A 1JQXA 1KWGA 3UXIA 5GNYA 3EX1A 3SCPA 3FW6A 1JF5A 5LZLA 1CDGA 2BHZA 4JEJA 3IANA 1HT6A 3I65A 4D8ZA 1IYXA 3B0YA 4GZJA 2Y7GA 2WW5A 4QCFA 3BXWA 1YNQA 3CB3A 1YIXA 3NEHA 2ZZ6A 1DIEA 4NZJA 1TR9A 1E55A 3VAVA 4AG0A 2DSUA 1EQ3A 1DWGM 3ELFA 3L5AA 4ZQNA 3V35A 4JN8A 4M3PA 4TQTA 2VTFA 4AW7A 1TCOC 1JI1A 3R2GA 1M9HA 4KFNA 4UQAA 5I00A 2DJXA 3O5IA 4MB5A 3RAOA 1A53A 4O11A 1YW5A 3TTEA 2OSXA 1ZAIA 1VBJA 3W4RA 1GQKA 1JPDX 1NOWA 4Y6GA 1FWFC 1TQJA 3VI2A 2W92A 3WL0A 2VFEA 3C86A 4QE1A 4HNOA 4PMZA 3Q58A 2EKGA 3M5VA 2Q5AA 1HQTA 3TCEA 2CBUA 5H8UA 3Q2DA 1FWRA 2ZX6A 3USBA 5HR7A 4Q6XA 2XPBA 2PDCA 2UWFA 2Y8KA 3F5KA 4QT3A 2WMGA 3DBNA 3SAZA 3WX7A 1M04A 3TN6A 4ZSUA 3ZLGA 1XH0A 1VFTA 3MI3A 4JFKA 1UQZA 4ZO7A 2GUYA 2ZDRA 1FP8A 4M8UA 4AIUA 1IQ8A 1VZWA 4LYPA 1JNTA 2XH7A 5EB8A 1KFBA 1S3HA 3L4XA 5FL0A 2NUYA 3EIPA 2R94A 3GVRA 4UTIA 3GU1A 2V30A 1XIEA 4NIRA 4JIRA 4O53A 2J77A 3IUHA 1HKKA 1C8QA 4Q8VA 2OQHA 4FN2A 3HOJA 1A5SA 1CGWA 5AZ0A 4DWSD 4GQ0A 3S9YA 2PN0A 2QDGA 1C91A 1GVSA 2W61A 2DSZA 1NQKA 3Q4DA 3VC6A 1CXEA 4F0MA 4HPXA 3P67A 3WKZA 2AWGA 4FZIA 2E5CA 3OEXA 2WB5A 1EXPA 3PS7A 3FEQA 3WBXA 3W7GA 1QDSA 1J0YA 3TUUA 3SY5A 4DWDA 3H2FA 1IE7C 3QFEA 4PR4A 1EJWC 2PEVA 1X8FA 2D1ZA 1W3LA 3WD3A 3APTA 4QISA 4NYYA 3A4JA 3LLXA 3WJYA 1UD6A 3A12A 4OHQA 4ZSTA 1H7PA 3HQPA 1JGMA 3GIQA 1XSJA 3ALGA 3RU6A 3UZWA 1P4CA 3W02A 4LUSA 3ZT5A 3UXAA 1UD4A 5AYIA 4F48A 1VR6A 2X8RA 4DX3A 1XH2A 4GYKA 5E09A 1TVNA 4B90A 2N87A 3O8AA 1QU4A 2I5GA 1TPWA 1Z9AA 3O5DA 1X97A 4G7EB 2VRQA 1IWBA 3I6CA 4AMAA 4L1GA 4AY1A 3QPZA 3MWCA 3MKCA 1XKYA 4UTKA 1PX4A 2VC9A 1A3XA 3RPDA 1H60A 4RNIA 3BGAA 1XM3A 1QW7A 1S3TC 3UXLA 3WDQA 3T08A 4DF2A 1JPHA 4Q4SA 1EHNA 3JZEA 4MKSA 1FKLA 3POHA 1D7FA 1MEWA 1BVNP 1WDWA 3AUJA 4DRMA 3KM8A 2VX6A 4F2BA 4ZZ9A 1ZJIA 3OQEA 1GOMA 2JF6A 3CZLA 2H8ZA 1GUVA 3ZR5A 4DUOA 2L5HA 5CLTA 3WLNA 3UYCA 3EWWA 5A2BA 2YXOA 2FZNA 1RK6A 1XDJA 4L9XA 5HW6A 2FZDA 4DO4A 3CV1A 4XVEA 4N42A 2OKOA 1EC7A 2J4GA 3V0SA 5HT1A 3G1DA 3LN3A 3HO8A 4IJBA 3E0IA 3QY7A 4PB4A 4NXKA 4DJFD 3DC0A 5JBFA 3PRAA 1FA2A 1TMLA 3BMBA 2PTWA 3LBMA 3ITCA 3GTIA 1VCVA 1OJXA 2VDGA 2YBVA 3ARWA 1AMYA 2XP3A 1H61A 2DZPA 1EP2A 3P8IA 1V77A 1QHZA 3K8MA 1TWIA 3OOBA 1PE1A 3N18A 2WLYA 3QLLA 4WKHA 3Q67A 1ROUA 3M0KA 5FJRA 2WJDA 1E0UA 4O1EA 1M1BA 2AGTA 3AFBA 1BKSA 3HQOA 2GK1A 1PIIA 2YLLA 4KFPA 1QI3A 3VOCA 4U33A 5FAGA 4JL2A 2IPFA 3BZJA 2E9BA 3S6OA 1EQCA 2PPGA 5AYZA 4LC6A 2VX7A 2WM1A 2BDQA 2BS9A 2QJIA 3OA5A 3CMFA 4KBXA 4XUYA 1IR2A 5B7YA 5FIPA 2E4TA 1E71M 1AJ0A 1F74A 2XFWA 4YJ5A 1R8LA 3WNNA 4C6QA 3MS8A 1GKPA 2QYGA 5A6LA 4XX6A 5I77A 2ZVRA 1LUCA 4ZOEA 5T8GA 4MAVA 1VKFA 2PV3A 3UJEA 4LAZA 2XP9A 5LNSA 1QHPA 3M07A 3RLGA 3GB6A 4N6EA 4QS5A 4N9CA 4C6IA 4ODNA 3H2MA 4G1KA 4EP8C 2D2GA 4N6FA 1E6NA 5M17A 2E68A 3Q94A 3KVJA 2B31A 2V63A 2E6YA 1K1DA 2ZUUA 1GRJA 4QIUA 4HYWA 4Q4QA 3VNLA 1OBAA 5G2WA 1POJA 5A6JA 5D9NA 4JDBA 3G1VA 3S0CA 1TE6A 3W1UA 4R27A 1UCWA 2QV5A 1I1XA 2V81A 2YGYA 3NI6A 2UY5A 4MB4A 4AWUA 3NZGA 4PEEA 3ARVA 3MSGA 1RHCA 4CUCA 2QMJA 3CYJA 3NQ6A 3UWUA 4GPNA 2Z4GA 2BLEA 3VDAA 1A0CA 1Z6KA 1ZFJA 3TE9A 3G1HA 1GG0A 4D1IA 3N04A 1TX2A 1MDLA 3WLIA 4WY0F 4DBUA 3RRXA 4TXEA 2YLAA 4JQAA 3TMQA 4QXIA 1QW9A 5DEZA 3BGGA 2JALA 3HBLA 1JULA 2V6AA 3MZNA 2NUWA 4EAYA 1DOSA 4GRSA 2PA6A 3WEZA 3DKJA 1J6PA 4NX5A 3M1ZA 3M0JA 4MF4A 1VS1A 1R9YA 3PG9A 4DUVA 2Y4SA 1B31A 3G1FA 4S23A 4EVZA 1MQRA 5JH2A 3CHDA 3KABA 4OBRA 2GL5A 3SR7A 5HUOA 3F2CA 1JPIA 2NW0A 3FKRA 3DZ1A 3B0VC 1QMLA 2GUBA 3OIHA 1WDDA 1EPVA 4F2TA 3S1XA 1K70A 4UFKA 3ABOA 3FFSA 2WNWA 2RDUA 3TYAA 4HYRA 3F5LA 2PZNA 4H9TA 2IF4A 4DPPA 5A6SA 4GQRA 3N4EA 1G67A 3RFAA 2XN1A 1DWIM 4YL2A 3L2LA 3VGDA 1BGGA 4CVUA 3UXKA 5F1VA 1W5QA 1BFNA 3VIJA 2R1PA 4FNRA 1B30A 4G1NA 4YTQA 1TTJA 4IMDA 1FKRA 1H50A 4D8AA 2PDXA 2O7SA 3QC3A 4M51A 2ISVA 3MW7A 2MLZA 3TXVA 1JCMP 2G3FA 1PIGA 5EMLA 4HCHA 2RJHA 1ZB5A 2J78A 3FAXA 4JGDA 2R1MA 4Y9NA 2BG5A 3JYMA 1GPFA 4XAZA 3QY6A 1KO0A 1DJGA 3W29A 4E38A 5IHSA 4O50A 2PPOA 4UNIA 4R0XA 1W1B1 1TCDA 3CUXA 1JZ7A 2DZSA 1ZP3A 2DZXA 4KWOA 2VI0A 1OFBA 4PA8A 4H1ZA 2YFNA 1W0MA 1XFCA 4HSNA 2FJKA 2YKKA 4A6GA 1D3HA 4XBSA 4ZQPA 2CLIA 1H7OA 2PWHA 1LUCB 3NZPA 1QZ2A 1Q65A 3WK3A 3S6TA 3T6CA 5KZMA 3S6DA 4GXWA 4GA8A 4GD0A 1OCNA 2HVOA 5D38A 4XD6A 3UETA 1M53A 4AD2A 3N2XA 3R8RA 4OBSA 1XGZA 2WNNA 1IIHA 2FIQA 4OQVA 3WH6A 4LCRA 3W1QA 1X8CA 4GI8A 5HKGA 1RA5A 4O1AA 1RUSA 4B15A 4N2YA 3NVTA 3H4GA 4IMEA 1J5SA 5CC5A 4GX9A 1YTKA 4HU8A 1E9LA 3W00A 1SZFA 1UPPA 1QBAA 2DG4A 2XP5A 4J4NA 1BYDA 2GQ8A 4IGMA 3WQVA 3TQKA 4C6KA 4RNHA 3B97A 1GQJA 1R85A 5I5RA 1Q7MA 2XWEA 5ECVA 3M47A 3OGVA 2TRSA 3R8GA 2CZVA 3MMDA 2XM1A 2G8ZA 4M7TA 2XYLA 4EOUA 2VFHA 1DE6A 3ARXA 2ZXAA 3PUEA 1ADDA 4KF1A 3T42A 1NAL1 4GIRA 1X38A 3UCCA 3S5YA 2YCKX 1UR2A 9RUBA 3R7MA 4FAMA 2DH2A 3L0NA 1Z69A 5CLWA 5DXYA 3QGKC 1YQ2A 5AN7A 4AX7A 3EDKA 3CB8A 3N3MA 4MADA 3Q45A 3AUOA 3WEOA 3TFXA 3R10A 1N8WA 1XIBA 1Q6EA 2RUDA 2DUAA 5BMWA 4B5XA 4JQ2A 1W9DM 4HJWA 2WMJA 4KEZA 4ALDA 2VELA 3M46A 5ENLA 3T0BA 2WPGA 4NZFA 3LV6A 3W82A 3IUIA 3AICA 3L0GA 1NOFA 3QMSA 1AFSA 3WLHA 1ISVA 1HO1A 1EOMA 5DCDA 1J0JA 4DF0A 1JZ4A 1T99A 4NY2A 1O12A 3O63A 4KEMA 3WJZA 5JH1A 2P0IA 4GY1A 4Q33A 4BQ4A 3TH6A 1T8XA 1OF6A 3BLLA 5AYXA 1JAKA 2HTMA 3ZO9A 1LRTA 2VZTA 3AJ7A 1PPIA 1Z3NA 1A50A 1BEUA 3LEPA 1O95A 4GNVA 3ZJ7A 3AHZA 4R9OA 4DWSB 4ONVA 4Y2WA 3RLUA 2DPEA 4F66A 3V5OA 3NUKA 1TFVA 3EXRA 4S3CA 1EGMA 2INZA 3KRBA 3ZS4A 1L2UA 1E44A 2PBCA 4NZ4A 3T8QA 3S83A 2YZRA 3ABXA 5GQBA 1IIGA 5I3DA 3WH5A 2CESA 4GFIA 2GVLA 5F2IA 3BAYA 1OK4A 5D09A 1YXDA 2A2IA 3O7UA 3M64A 2D22A 4XO6A 3LPOA 5HQEA 3VGGA 1NH6A 4QAWA 3D6NA 4MFDA 1C29A 1O4UA 1C8YA 1B5TA 3CZ8A 1Q13A 1LOSA 4DI9A 1QI0A 1OHLA 4LV9A 3NL5A 5AFDA 2QPSA 1EP1A 3JS3A 1NDZA 2OO0A 4LFYA 4UQBA 1T40A 1OD8A 4LVFA 1Q6QA 4Z0JA 2VURA 3KTXA 1WDPA 3GG8A 1L8NA 1ISYA 1J93A 3LHUA 4Z17A 5HJYA 3M44A 3LHWA 5FJTA 4RZ4A 2ZFAA 3EGJA 3PZVA 3U2OA 1TA3A 3PTMA 4I5UA 2J9ZA 5CBBA 4OVXA 1TREA 1XR2A 1V3IA 1R87A 4CNUA 3BVJA 3I68A 2WMKA 5DMLA 4XUGA 3B7XA 1DJHA 1EB3A 1VFUA 5DQPA 3SEPA 1EUNA 2Z25A 2G37A 2NQ5A 4UNKA 3SCNA 2V9DA 3OVGA 3H7RA 4DWSC 4RXFA 1V02E 3DKLA 2GQAA 2I14A 2A3LA 2A4AA 4ZE4A 1UR1A 3O5FA 1TUFA 4M6PA 2CU0A 2F21A 3W76A 4JTLA 4K1WA 1KCLA 4AD4A 2ISDA 1V02A 2UY3A 3OB8A 1QATA 2YXGA 1MSSA 3D5HA 3M4HA 3GG0A 3GXNA 3CV6A 3S4TA 1GOQA 2DZUA 3GNXA 2WQPA 4H9XA 3M7SA 2GVJA 4RCXA 4R7JA 5DCBA 4Z2JA 2WWCA 4CLMA 3DGBA 4YHGA 2ZQSA 2PDMA 3R11A 3WIJA 3WF0A 3GR4A 3KAIA 3O2LA 1YTDA 4Q4PA 2H9AB 4U85A 1XLJA 4YCPA 1J6OA 2X30A 1AMKA 1HO4A 2F61A 1E51A 1HVXA 1PKYA 3UY7A 1TPB1 1V6TA 3DG7A 3WFLA 1H7NA 1TPEA 3HU7A 3MVIA 2Q8XA 1KM6A 1H51A 3M5XA 4BF5A 2TYSA 5A8QA 5IFTA 5E6YA 5CGQA 1K9FA 1P6CA 4J2MA 3NOYA 4IG2B 1UWTA 1XL9A 3G22A 1DBTA 1TJ0A 4Q4RA 1G94A 4AHPA 4JTGA 4LBUA 3M0HA 1BRLA 2Y8VA 2OU4A 1EDGA 1P0BA 4GKLA 2RQSA 3IRDA 3NQMA 1A5BA 1UD3A 4CD7A 1JPMA 3VGBA 3P2VA 3CUFA 2YSWA 4U5IA 1TMQA 1X7FA 4L1WA 4LUYA 4WJ8A 4A3YA 3GR7A 4I6VA 4H19A 5KZEA 8A3HA 1LBMA 3E0WA 3JW7A 1QNVA 4GWEA 3JVAA 1Z89A 3JZUA 5D02A 2ZRUA 4XWUA 1SU5A 4L5ZA 3UYIA 4UWMA 1BYBA 4RW3A 3N2MA 4Z2IA 1YADA 4U2ZA 1FKBA 2DY3A 3M0XA 5DLCA 2DZBA 4IOTA 1G4PA 1VHCA 2PDIA 4POCA 3VNJA 1X1OA 2QVHA 3FJLA 4LAVA 4KRTA 2VL4A 4JIHA 3AALA 5JUVA 4XO7A 4DJFC 3T2OA 1GEHA 1FFRA 5DRIA 2HXTA 5G4WA 4H8HA 5F2GA 1KXTA 1W2VA 3GU0A 3WLPA 4GFSA 1TYGA 3DXIA 4HSHA 4OJYA 7XIMA 2I57A 3MUZ1 1W1VA 3GO2A 1JRBA 2J66A 3H55A 1VBRA 2Y88A 1ICPA 3MBFA 1E0XA 1S5MA 1BQCA 4J4KA 1U79A 3F4CA 3NSXA 4KERA 4PB3A 1K4GA 3AZRA 5FF3A 4GUJA 3VZXA 2J6XA 3H7UA 4TMBA 2K8IA 2Q6ZA 1HP5A 1KCXA 5MKGB 7REQA 4K2SA 4MWAE 5HUPA 1FWEC 2ACRA 3MI6A 4Q8NA 3N12A 1WZAA 1WX0A 3W24A 1S2WA 5IXEA 2D69A 4TVDA 3ERPA 4MWAA 3AXHA 3PB2A 4HB7A 1PX8A 3H8AA 2ZRWA 4O54A 1VPXA 4WDXA 4H8NA 2Q02A 2C16A 2XINA 3M0IA 1YNYA 1OZMA 1WKDA 2X1UA 1LQ0A 2PRMA 1MNSA 3WNMA 1P0KA 1VFMA 3TP4A 3NQ8A 1HP4A 2VD9A 3W72A 4IGHA 2QCNA 2VOTA 2E77A 4DJED 2NXIA 4MM1A 2VR4A 4LU0A 5I98A 4IMCA 3KCLA 3B8IA 3R0DA 1ISWA 2YA1A 4JHZA 3CZKA 4DH0A 2V3FA 2CBJA 4UZSA 1X6UA 3WLSA 5I6SA 2FTWA 2YCJA 5A6BA 3CIVA 7TIMA 1H11A 3SIMA 2PDWA 1XLMA 3CQIA 3C2OA 4Q22A 1AW1A 1D3GA 1E4IA 1JCTA 2RURA 4LWWA 3DX5A 4GX8A 2PBGA 2ZADA 4C02B 1VLIA 4D72A 1BRLB 2WC4A 2C13A 5CPSA 1UKOA 4IICA 5BU9A 4J3VA 4MY9A 2ON3A 3USZA 5CEWA 1F8AB 1SJDA 2V2HA 3FEMA 2HSAA 1PO9A 2ZZ5A 3E3HA 5C71A 1WBJA 4JFLA 1UP3A 1FCUA 1W1A1 1K03A 3N17A 1DXEA 5KETA 1GGOA 3NWRA 1US3A 4PULA 3CTLA 3LV5A 4U31A 4AZHA 5IBXA 3TZNA 4JCLA 4B5WA 3T0CA 5A8NA 1QNOA 1UJPA 3JXVA 1UD2A 2E6FA 5DELA 1MEIA 5M3WA 2UV8G 4QDPA 5FACA 4F9DA 2BXVA 4H2CA 4BS0A 2QUUA 1VBUA 1QTWA 2E8ZA 2ISWA 1XQLA 4IX2A 3HJEA 3SBFA 4WXYA 4URIA 4XZHA 3W2NA 1W37A 4DY1A 3N2OA 1XC4A 1CXLA 3UG3A 3ORWA 3VC5A 3I3BA 1UZDA 5DT5A 1K6WA 4W9QA 1KRCC 4L64A 3G2GA 3VE9A 3BOLA 1GVEA 3N34A 4NL1A 1YRRA 1QO2A 4DQWA 3EDEA 3W87A 4ZO8A 1SFJA 3E6EA 2HNHA 4LS2A 1E40A 2CHOA 4Z1DA 4ZENA 1D7HA 1KW1A 5FJPA 5K9XA 4GBDA 1VJIA 3CGTA 1E9YB 4DO6A 3HG3A 1RPXA 4P7QA 5FESA 1UA7A 7REQB 5AVNA 2VUNA 3T81A 4IMGA 3GW0A 4FLRA 5AC7A 3V36A 3W2KA 5I07A 3AYRA 4WRHA 2DSVA 4J3ZA 1ONEA 4ZL1A 1TRIA 1K7XA 4FIQA 3E5PA 4LF1A 3M0LA 3Q65A 4DM1A 4O4WA 3KP0A 3LHTA 4DIPA 3GH4A 1A80A 2ZUTA 2V3EA 1TV7A 3E49A 3EA1A 4I3GA 9CGTA 2LKNA 2C7FA 1PB0A 1K4HA 1DXFA 3GU9A 2ZUMA 2LLEA 3AISA 1XG4A 4GZIA 2OODA 1I2NA 5AOUA 3CGNA 1XCWA 5EFFA 4RW5A 2CERA 1A3HA 2EG7A 3W86A 1MQPA 3NQFA 3NSMA 4NJJA 1Q6DA 3FIGA 1W91A 1K3UA 2XM2A 1KBLA 5AHIA 1KFCA 4S3DA 2QCFA 2VRJA 6ENLA 3KRSA 4EWJA 2PODA 1RQBA 4YLWA 1W6TA 1QPRA 2ITKA 4N19A 3QKEA 5C7VA 2GWGA 1SQ7A 1UKTA 2J7EA 4IZGA 4I7WA 2YDQA 4LX4A 4XAPA 5C7HA 1JZ6A 2IKJA 3UVIA 4E8CA 4R85A 1VJZA 1VCFA 3DYPA 5I2UA 4WR3A 3BLKA 4XVDA 2XPAA 2F2HA 1EC8A 1OZQA 2QQ6A 3DBPA 2J24A 4W87A 1HJUA 2G4JA 4MLJA 2VYOA 2VD8A 4ZMGA 3CZEA 5FEPA 5CGTA 1LQ2A 2WMHA 3B8WA 5LIKX 3THQA 5F7UA 1XLGA 5F4SA 1WDRA 4GZ7A 2XZ9A 4ITZA 2EPHA 2Y2WA 3NG3A 5CPOA 4D6CA 3TJ4A 3DYOA 3PZOA 5CZTA 3RU8X 2H6RA 3DAQA 2FDSA 2C14A 1XIMA 1IEQA 3WUBA 3CIXA 1TWDA 1UUOA 1O66A 2FLIA 3V1PA 3UY8A 3EKGA 4GJJA 4FS9A 3THAA 1UWUA 3C56A 4Z1YA 1HG3A 4PE8A 2VEMA 4HU3A 1J18A 3PZNA 3BW4A 1QPLA 2VQUA 4BKNA 1HW6A 1K7EA 4O52A 3RITA 3IWPA 4Q8PA 4RLIA 3B40A 1W32A 5HULA 1ME7A 1ZCCA 4Q6JA 1GOIA 1EX5A 1XLFA 3T2QA 2IKGA 3GC5A 2NVAA 4FR6A 4KWUA 3VOHA 2VGBA 2PTZA 4P7OA 2OEJA 4ICCX 4JOMA 3W7PA 3TONA 4AYSA 3IRSA 3PN8A 3F2DA 2Y89A 1AJ2A 1KGWA 1YNPA 2E1WA 3LNMA 3P61A 4JCMA 4RE4A 1RY0A 2NZLA 5U4NA 1ROTA 1WA3A 4OGZA 3PVFA 4O19A 1QRQA 1E6QM 2WZIA 1WCGA 2FTPA 5SWUA 3IVTA 1PHQA 4RDWA 3LUTA 3BUVA 4G6CA 1MYRA 3EWCA 4BI5A 2VZSA 3QSRA 3D3FA 4UTWC 4F3HA 3LLDA 4QSFA 2O92A 3E2VA 4V33A 4U4MA 1JUBA 4YYFA 2RHGA 4GH1A 3O16A 4FOUA 5I78A 1KBBA 3PSVA 3P84A 4Z1AA 2WPBA 3DFQA 4JFVA 4JX5A 4XBJA 3QSTA 3ZLFA 3VUSA 2EJAA 2FYMA 2QCHA 3ITYA 1NMWA 1NMVA 4AD5A 5IDIA 4FLOA 5FKYA 4FX6M 3MP4A 3WBYA 3WH7A 1EYMA 3MUY1 3HPSA 2NQ9A 2J13A 4GC4A 2KX9A 5HA7A 4RL3A 4ATWA 4XSMA 2FFIA 5DCEA 3S1VA 3MJMA 2PLJA 2BVWA 2P53A 3UPWA 2AAMA 4AX6A 4EPEC 1ECEA 4H41A 4ACZA 5BYWA 4XD4A 2B7PA 3WDIA 1BXCA 4DT4A 3MKKA 3PZTA 2ABAA 4FX8A 2YB1A 5EU9A 3MANA 3GDKA 2CPUA 3URBA 1JR1A 5DRCA 1DJWA 3R6IA 4UUIA 4A2RA 2OX1A 4N4PA 4QFUA 2J8GA 2YL9A 5D32A 1QCWA 3QOKA 4RK8A 2OEMA 4NHVA 1Q7QA 3SUUA 2HQAA 5HW7A 3W7NA 2W0UA 1G6CA 1E0WA 4ODQA 5A2CA 3A3WA 5GJPA 4DLMA 1MW2A 3GVQA 1AZ1A 4P61A 3QY8A 1B4EA 5AKQA 4H9MA 1U2YA 4IQJA 3IK2A 1IEVA 4FX7A 4OECA 1B9BA 1A5CA 2YA0A 1W54A 1XLKA 4IUGA 2FMOA 1FKGA 3IJDA 2Z2BA 4HMNA 1BHGA 3BL3A 3FSTA 1EEXA 1VC4A 3K46A 2CLHA 4LUJA 3R43A 2QMKA 2C71A 1GKRA 3URQA 3R94A 5L9FA 4QZVB 2OWXA 3VD4A 1UKPA 4AZ5A 5BW6A 1EZWA 3WD1A 3AS0A 4PMQA 4A29A 1UD8A 4K8GA 2V5KA 2E67A 3BMWA 4K8EA 3LTPA 1OQFA 3BO9A 3RO8A 4JAWA 1RPKA 2OEKA 1N8IA 1JVNA 4QCEA 4W84A 2CNCA 1ODUA 4HVXA 3LB0A 3A22A 4FNPA 1KBIA 3OA3A 4ZOAA 4HN4A 4F0LA 1H09A 5A69A 1AK5A 4HJFA 1EF3A 1KC7A 2YJQA 4LW7A 3BURA 2WOQA 2WNQA 4QTGA 4DXVA 3ME3A 4QROA 3WMSA 1V7YA 3KS6A 4DRHA 5B80A 3PHAA 4DROA 1CBGA 2OGYA 2OQYA 1THFD 4DO5A 1RJPA 3V0UA 3URAA 2WC7A 4HP5A 1M6JA 5DO2A 2J9YA 2QF8A 5G1YA 3W83A 1WUEA 1KM2A 1LRQA 4MDPA 3EYPA 3WNOA 2FHBA 5CJNA 2MNRA 1Q63A 4DRSA 1XPYA 4HMDA 2XP7A 3KADA 4GYPC 1TUXA 4H83A 3W7CA 4BHYA 5DMNA 2WV8A 1M01A 4V28A 4C6NA 1XLIA 4IUOA 4UC5A 1OK6A 1ICQA 1IZCA 2ZZ7A 5AC4A 3GDBA 2WKJA 4ZQRA 3GKAA 4PFHA 3DHDA 2INFA 4YS1A 1BL4A 1PTAA 2VVSA 1YPFA 3WQGA 3ARRA 1BVZA 4G5DA 2TPSA 3ZZ1A 3B06A 5H8MA 3B8TA 3WQEA 3A13A 3FA5A 4CNSA 4H9YA 1UH2A 3CQHA 3W26A 1PZ1A 4PYSA 2PV1A 1ZBCA 4OIFA 3DERA 4KEVA 4IMAA 4JTTA 3N15A 1PTGA 4AVFA 3VABA 3KTSA 1AZ2A 1QPFA 4F0SA 3FVMA 3VNYA 3VIMA 4UB9A 4UQEA 2VMFA 3CBWA 3RR1A 3N4FA 5GNZA 3VFCA 4LEFA 3W7DA 4AAJA 2J75A 3W28A 3BW2A 1J79A 1V3JA 3GHUA 2WLZA 1I75A 4ODLA 4NVTA 3NM1A 1R5YA 4ZGYA 1Z48A 4XKMA 2ZUSA 3PTKA 1DP0A 1TPUA 2ZZ3A 4IL2A 3VZZA 3PUOA 4DJEC 3B03A 3HPZA 3I7RA 1H1ZA 4YTUA 3SM0A 1LYXA 1W1TA 4QDWA 3HA1A 1HJSA 4PRRA 2X09A 4NF7A 3C2RA 2DGAA 4XZ9A 1TZ9A 3NPXA 3W23A 2Z1KA 1VGAA 4BWLC 3G0UA 4GINA 3ABSA 4NYUA 2FFCA 3KDNA 3FVDA 5CZJA 2R1LA 3AXKA 1MZRA 3EX2A 1KLYA 2CLKA 3CT2A 3IPWA 5IHRA 4CNNA 3NVDA 4LPCA 4UFIA 4KWSA 4AC1X 1HJXA 2GJXA 1LCOA 4FXJA 4K3ZA 2VGGA 4YXGA 2DVUA 2X41A 3TYBA 4IM4A 1A5AA 4I5RA 1FD9A 3JRKA 1WXJA 4FNSA 1E1EA 3T7VA 4US5D 3LCLA 1R3RA 3ATYA 3MA8A 4PTMA 4JQ1A 2Z27A 4GCXA 4Y9AA 3C3NA 4J4OA 1ML1A 3SCTA 4ZE5A 3GXPA 4CU7A 2VC6A 2BGNE 4J5NA 1RY8A 1FHUA 3WBEA 1FWBC 3M7WA 3E2QA 3IV3A 4PODA 2E25A 3T40A 2CKRA 4ZPTR 2WHJA 1E70M 3NIYA 2EJ1A 1ODZA 4QR6A 3OZPA 1DQUA 3IACA 5AB3A 2BY3A 4DB7A 2ATMA 8RUCA 5TNVA 2QJGA 2RDWA 5FJOA 4LVDA 9XIMA 1ITXA 4YVXA 1F3TA 2QUMA 1QI4A 4H7CA 2QS8A 4O0KA 4HPJA 2D2HA 1EC9A 2P50A 1IWAA 2EEXA 4LUTB 2PPNA 1V6UA 3IKDA 2NV9A 3V7PA 1XISA 2XGZA 4GNJA 5T26A 3PUDA 4XQ6A 2QJMA 4ZB0A 6CGTA 3MI2A 4PBFA 3GXMA 3BLOA 3KTCA 1E1CA 1H5VA 4KWVA 1VEOA 1MO0A 1D8CA 1KBKA 4RZ6A 1V3KA 3FV9A 2O9RA 2VNCA 4QE4A 4XTIA 3EWDA 5J04A 4Q8QA 4Y9PA 3DHPA 4NI3A 1QPOA 2CLPA 2I7GA 2LGOA 3VDHA 4PCNA 2NX3A 1NELA 4ROQA 4GGHA 2WHLA 2X7WA 1OF8A 1XGEA 4MZ1A 3H23A 3LQLA 1JRCA 4AHQA 4GOAA 1FVPA 2WHKA 3W75A 1UR3M 1LRNA 1XD1A 3UJ2A 4GIAA 3WQPA 4MYXA 4PBEA 3NXLA 2YYTA 1X96A 3LD5A 1GVOA 1U22A 3KOZA 2IUZA 2QGHA 1TVLA 9XIAA 3CUHA 2QNEA 4YYCA 2BBFA 3E0LA 4FALA 1W8SA 1VEPA 3T44A 4IIHA 2V8ZA 3VD7A 2DSKA 3VD9A 1XCXA 1E73M 1G69A 3VNIA 1VBHA 3C0SA 1KRBC 1BSLA 3B9EA 1DL3A 4XAYA 3ODKA 1VD6A 3TR2A 2WZHA 2PI6A 4IX0A 3C0JA 1UWQA 3TOPA 1LWIA 4WXZA 5I3JA 3GFXA 3KS5A 3BAKA 1BKFA 4IXHA 2BXZA 2LJ4A 3DFPA 4DXKA 1ZP4A 3OZYA 2I9UA 5FF7A 3UG8A 1F6PA 1B54A 3LBOA 2WJZA 1C7TA 3PZIA 1A5LC 1GZ1A 3FJ6A 4IIEA 3ABZA 1DJNA 2HPMA 1D9EA 3KWSA 3R89A 3NQ7A 3QMRA 3PA7A 4GYFA 1E15A 4A3HA 1ZPTA 1XG3A 1CIUA 4DRKA 3E2SA 3OODA 4PTDA 4M6VA 3U2ZA 1CZ1A 3TA9A 2EULA 3D3AA 2W6RA 3C4UA 3FGCA 2F6XA 4L6HA 3VMNA 4LNYA 3CL7A 3T1GA 1PKMA 1FWCC 1U33A 4PCTA 2RAGA 3LCXA 1X7IA 3MUCA 2ESCA 1FKDA 2PTYA 3W38A 1T41A 2WMFA 3STCA 3O3RA 2PGRA 2VP8A 3QZAA 4HZMA 2G41A 2WQDA 3O9NA 3TYDA 4NX0A 3UNDA 2X16A 4MNJA 2Y7EA 3KACA 3T9PA 5E0FA 1L8PA 3WNKA 2VHLA 3LBCA 1FAPA 2OB3A 3HGSA 3IV8A 4H6KA 2EPKX 4XIAA 2PD5A 1NVMA 3KBMA 4NJIA 3TC7A 3WBWA 1E3ZA 3B8DA 1BXNA 3TTQA 4MKVA 3P81A 1JCNA 1ZCNA 3NO1A 1B3VA 4R3UA 4I7UA 1H62A 4OUEA 3GRIA 4C6BA 1Z32X 3QGVA 3RHGA 2Z2UA 2YBUA 2Z26A 4DAIA 3GZAA 1ZAHA 3UPBA 1RBOB 1IGSA 3HGRA 3T4WA 2ZRZA 1SZNA 1SPQA 3I3EA 2BP1A 4JKKA 1VH7A 4WSHA 3AIRA 3W7RA 1ITQA 1GYLA 2PWEA 3K2GA 1NF0A 2V5DA 2E09A 3PJTA 1ZLPA 2Y24A 3SCUA 5DY3A 3RN6A 1QK0A 4J2PA 3UXDA 1W9UA 3PF3A 2H90A 3QR3A 3C52A 3GR8A 3V3WA 4LAOA 3GPKA 2P8CA 3PBVA 3W2JA 5JU6A 3LPFA 3UI4A 4TIMA 5BOEA 1I2PA 2XSBA 1GW9A 1IT0A 3TDFA 3GM8A 1N2VA 5JIWA 4M6QA 3M41A 1V5XA 5CSYA 1UQYA 3IK4A 3VPLA 3WF2A 3AS1A 2A3BA 1FKWA 3WUGA 5DX7A 2ZOXA 4FF5A 3STEA 4GVHA 3HG2A 2HE8A 1A3WA 1PYFA 1TV5A 3WELA 3VYLA 1KTBA 2P4VA 4QJ5B 1WKFA 4Y96A 4DF1A 4KPLA 2WMIB 4IIFA 3N4AA 1MQQA 3P14A 2GJRA 4LBRA 4KRZA 3SSZA 4US5A 1XYBA 1KFLA 4ZO9A 1AH0A 2NLIA 1UASA 4AXKA 2NX9A 3VD5A 4AZIA 2HISA 1KFJA 1DV7A 4JTUA 4JS3A 3T78A 4K37A 3NNTA 3LTSA 4L80A 3GXFA 2PTDA 4Z1BA 4YCOA 2IS7A 5LIWX 2XZ7A 4B2DD 2VFGA 4F9JA 1NWTA 5I3HA 3PWGA 4U5KA 1S5VA 4O10A 2J47A 2CZ5A 3T8LA 2DJLA 4V27A 3IUDA 4D6HA 4G7FA 3P5YA 4M80A 3OGRA 3W7EA 3EWYA 3ZJKA 5LXEA 3OZOA 1SJBA 4DBDA 3MHFA 3WDJA 2BGQA 3U7VA 4HOWA 5CGMA 2ADAA 1ONRA 1JIBA 2ZWZA 5J5DA 1FDZA 1UBSA 3CEPA 4JIEA 4FI4A 1TRDA 2J27A 1XS2A 1OYCA 2ZZ2A 1W56A 3QN3A 3IIOA 5LGZA 1VHNA 1KBJA 3KBVA 3BV7A 3WF4A 4PMOA 1C93A 3AWNA 3SRKA 1PCKA 1Y7VA 2WK2A 3NQAA 4ZEPA 2Z29A 1VIWA 3RPMA 1LTDA 1SO5A 3AXIA 1XRVA 4B92A 4QNWA 4EE9A 2R14A 4PTXA 3S5NA 4V15A 3SIZA 4AY8A 3ZT6A 1WAUA 2Z1VA 1RD5A 3H7VA 2JBMA 1W31A 3L4UA 1HZYA 4UTTC 2JEQA 4W88A 4ZCWA 1TV4A 4IQCA 2ODOA 5I3KA 2OWCA 4NNRA 4JQ3A 4E8DA 1AA1B 2EKCA 2VFFA 1S1PA 4K8HA 4TX0A 1V6YA 1KFWA 1IXPA 2BXYA 1JZ5A 1F3XA 1IHIA 4BEQA 5IM51 2C1IA 4CVWA 4ENLA 3M16A 3N2TA 3C6CA 3ZR6A 2ZE3A 1KKOA 4NNBA 3GK0A 3W7MA 5JVLA 2V38A 1OGBA 1GONA 3TTOA 3WLQA 3ITOA 4ORMA 4R33A 2PDBA 1UH3A 5DMYA 5KSWA 1M5YA 2OZTA 3MP5A 5HXMA 3W85A 3D0CA 1MFVA 1QT1A 4FXRA 2AQVA 4QLKA 4TV6A 4ZTXA 3KDOA 2ONEA 1FQ0A 3ARPA 1FOBA 4L72B 3VMOA 3WQ8A 1XP3A 2XP6A 3H24A 4B5SA 7A3HA 1LM1A 3VUPA 4GIEA 1R7OA 2XPKA 4I9MA 1K8ZA 1SUXA 4QE5A 2ZCGA 3WLRA 5HUAA 5HPCA 4JTFA 4GE8A 3GHTA 3WNPA 1D7KA 1RZMA 4B5VA 1W1YA 3H2NA 3HV8A 2IPGA 2XFYA 1WKEA 4M19A 5AECA 1VYPX 2OMAA 3IJ9A 2YCLA 1OB0A 4IQLA 3GE7A 1LJYA 1FDJA 1Z42A 4KFOA 1I60A 1LOQA 3CWOX 1FUYA 1K8XA 3ANUA 3VMPA 1TO3A 4RZBA 1SZEA 3S9IA 3H26A 2R1KA 3NSNA 4XSLA 1ZBWA 1ITCA 1LLWA 4LCSA 5FSDC 2PWUA 5EMYA 2CZFA 3ZT7A 3L21A 1WB0A 4BFAA 5ABEA 1GWJA 2HMCA 2JZVA 2FPVA 1KLZA 3S5ZA 1YPIA 3G6LA 2RFGA 3GAKA 1TIWA 2ZC8A 3VKJA 2ZR5A 2REQA 3DCPA 2PCQA 3A9IA 2NQLA 5JXQA 1FKSA 4NZ3A 3NDZA 5AY7A 2CITA 4CKQA 3GC2A 1OFRA 1BD0A 4Y90A 1UG6A 1ESWA 4FK9A 3PBWA 1W3KA 4C1NB 3AC0A 4IFOA 1U1UA 2A7RA 1SJAA 3TTSA 4PSPA 3NTYA 1T7LA 2LPVA 1LOLA 2OCZA 4LB4A 1NWSA 2G95A 2NT1A 1DIOA 4AVOA 1T6MA 4QJ3B 4RXGA 6XIAA 1XW8A 3ANYA 3KOYA 1J9YA 3MB9A 4D2JA 4HHPA 4FA3A 2ZA1A 4IFKA 4HA1A 1UOKA 4M1BA 4JD4A 4L4MA 2PE4A 2F6KA 3LUOA 1J8VA 5CJMA 1QASA 3UR8A 2ANUA 3E2RA 2M1IA 2E6DA 4HA3A 4WGHA 2QXWA 4ZS6A 1GVYA 2X7VA 3TEVA 4BI7A 4JR5A 4AZGA 5C54A 3ECQA 1EJRC 1EO7A 2WAGA 3JYJA 3T09A 5I03A 1ADOA 3QC0A 1PEZA 4QEHA 4C6MA 4P2VA 3WLLA 3QEZA 4FEZA 3ZR4A 1MEHA 3SCQA 1NJJA 1EH9A 2PWDA 1NSJA 4KGLA 1J96A 1R30A 4KMQA 4RKAA 4WJEA 2Z2AA 2EBNA 4TV5A 3MV11 2XDFA 4PB5A 2MLXA 1L1PA 2VENA 4OE7A 3L67A 2V5JA 4LEQA 4AIOA 4H9UA 4WIWA 1I4NA 1WAWA 1Y5WA 5HMFA 1OABA 1CTNA 4NZ1A 4H4IA 3SI9A 5BXRA 1GEQA 4HTYA 1WZLA 1Z8AA 2PD9A 3BC9A 2OOFA 3EPMA 2J8FA 2NXGA 5L6UA 4WQ6A 4QJ4B 2EPNA 1BVWA 1LLOA 3GWQA 3W2LA 2BASA 5FF4A 1XBZA 1EJSC 3DI1A 4QSHA 3DFSA 2VC5A 1PYMA 5K4ZA 1H63A 3GUGA 1TJ2A 4M29A 4PUWA 1UMLA 2QJNA 2GQ9A 2D9FA 3LTYA 1Q66A 1EBHA 2YCLB 1RLDA 1IEXA 3TWAA 4JL1A 1UR4A 3OBAA 4OTKA 1XIGA 1F7BA 3THCA 2O4QA 5DFAA 5E6ZA 1PIFA 2B0MA 3WL1A 4Q8MA 4XISA 1EWDA 4TW7A 3PTQA 3ALFA 1NOUA 5G2HA 1TKKA 4KGJA 3KUMA 3WDHA 4WCJA 1HKMA 2X0HA 1P5BA 3O5RA 3NA8A 4LOCA 4NNAA 1Q6UA 5AHNA 3W6LA 3I3DA 3ZM8A 4LSBA 4PCPA 1N1AA 2Q8LA 7CGTA 5LNRA 1KR1A 3P6LA 1GZGA 5AHMA 2G3NA 3G24A 4XAFA 4R88A 2Z1WA 1PCWA 1XINA 2VJXA 3BPWA 2WANA 2X05A 3VDGA 3K1DA 3UQAA 4MUZA 4L7ZA 1A5KC 3G1AA 2HBXA 1O7AA 2TMDA 1RQEA 3O5LA 3GKFA 2ZVIA 4NJKA 2PAJA 4A8IA 4IFKB 2GJPA 4A21A 4LQ1A 3GNRA 3LRLA 1KXHA 4J27A 3ARYA 5EPDA 4RV8A 3G0XA 4LY4A 3KVKA 3CAVA 5HANA 4JFJA 2Y8UA 3VGHA 2D0GA 3BARA 3UGRA 5AZ1A 1P7TA 3LRKA 4RZ5A 2V2CA 5E0CA 3QV6A 4ORIA 4CCDA 1XBXA 2YZ5A 2P8BA 4S3AA 3U2EA 5E9AA 3HM7A 3HQNA 3SRFA 2ZBTA 3IGHX 1ZSXA 2SFPA 5K9CA 4E4UA 3I7SA 2OSWA 1YYAA 5CXPA 2YW4A 4TMCA 3IGSA 1CENA 2PC4A 1QPKA 2VT0A 1F40A 4AZ7A 4M24A 4PH6A 3UERA 4BEUA 3NTPA 3KFTA 2P3ZA 4ZQOA 2IPJA 1RVKA 1XPGA 4C6JA 2DDXA 2PLCA 5D2TA 1PDZA 3N2BA 3WQCA 1YPXA 4FF7A 3U48A 3NO3A 4F4RA 4P8UA 4GJ1A 3SZ8A 1G0CA 4JHOA 3MCNA 1V6XA 2OPJA 4GH3A 4FHAA 3W37A 2UY4A 3UR7A 3PRDA 4GI9A 1EJXC 3M6DA 4AMCA 2EF9A 1VPQA 2IXUA 3FS2A 1QHOA 3CUIA 2XIJA 2BVTA 3CPRA 2FB3A 4H6EA 5EMMA 1UUQA 1OIMA 4DM2A 3CZJA 3H4XA 2DIKA 4HU0A 1XUUA 3SCWA 4EXAA 3AMDA 4QLJA 3RO6A 1B3XA 4ZO6A 4AISA 1DEDA 4LYQA 3CT7A 5M1TA 3LK6A 4G50A 3AIEA 2ZRVA 1FH7A 1TSIA 3KL5A 3N29A 4PCFA 3AMGA 1HJVA 3EWXA 2D2OA 5HJXA 3UA4A 1XX1A 2J62A 2QJJA 1FWAC 3KBJA 2BSLA 2Z7KA 1YDNA 4ASTA 1FWNA 3LX9A 2A3EA 2PDJA 5G1TA 1I45A 4O0QA 4RX0A 4AIEA 5E93A 8XIMA 4ZOCA 4H00A 3PZMA 3H2EA 3GHSA 3TIMA 3FJNA 5I3FA 3QXBA 4O1DA 1JD7A 3H12A 3UWEA 3IIVA 3PPGA 4HU4A 4Y7EA 2OXNA 3WJXA 1V0MA 2VGIA 3W1TA 1LBLA 4WGXA 2W62A 3UA3A 4MJ2A 3UWQA 2QCGA 3U2CA 3VINA 1TVPA 4PEKA 1XIDA 3GDLA 4JFSA 2JIWA 1R9ZA 2YYUA 3ARTA 1V03A 1UWRA 1K9TA 1X98A 1EHAA 2QVNA 5TF0A 4FOJA 4JHMA 4OOUA 5A6AA 3CMGA 3URNA 3NQVA 1W1IE 4ATLA 4X2RA 1P7TB 3WENA 3OVQA 3PPHA 4Q4MA 3RX2A 4ZBCA 2XVNA 3KAFA 4LALA 3RDKA 1I2RA 2W5FA 3PBGA 2EXOA 2FTYA 4XZWA 3WLOA 3LCWA 2HVNA 4AH7A 4JFTA 2MLYA 2EQDA 3W73A 1HTIA 1QPQA 2FZ9A 1NDWA 4J3XA 1LT7A 4TR9A 5CAHA 4WF7A 4D6IA 2XIBA 4UTFA 4PUMA 1GJWA 1RALA 1YDYA 3B0XA 3A4WA 3BG9A 3PFRA 2NQJA 4FLSA 4AYGA 4AEFA 1QNQA 1S2UA 2VFIA 1O94A 5D04C 2Y5SA 1S2AA 3ITVA 5F2LA 2WXDM 3DDMA 3G1YA 3EOLA 1JDEA 2VEPA 2WSQA 4UFHA 3LYEA 3CASA 1N82A 2QT3A 1HFBA 3SUVA 2PP0A 1TJPA 2PF8A 2HS8A 3BSHA 4AD0A 2GGEA 4Q8OA 4B5NA 2ZUWA 4C5ZA 2VR2A 4IPJA 4YTTA 2QLYA 3SFKA 1GJUA 1MW0A 3EOOA 2BB0A 4LYRA 5T91A 3EA3A 1FKKA 2Q09A 2MF9A 1JCLA 1QFEA 3HFYA 2WSKA 1BF6A 1D7IA 1X39A 4DRPA 4QJ1A 3NM3A 3WQ4A 3M0YA 3GS6A 1IX5A 2GGIA 3UP8A 3HIJA 2Y61A 3RILA 3WNLA 1D2KA 4I90A 4L4LA 2YFOA 4LVAA 4TO8A 1LL7A 1UMYA 3F03K 3N73A 1UPMB 1GK8A 4X9SA 3UPMA 1B9ZA 3KVMA 3PC0A 3ZOAA 3W27A 2ZTKA 1W5OA 1YDOA 2C1HA 4O8RA 1D7JA 1J2BA 2DT0A 4HMEA 2ZDSA 3VNDA 3W6YA 1BG4A 1US0A 3PJUA 3STPA 4CEUC 2PU0A 1JDFA 1CB7B 2VR5A 4IIGA 4W9TA 3O5JA 4J35A 4A8RA 1HIZA 5LIYX 2P5NA 4RV3A 3IGUA 3CHFA 5C2CA 3SCVA 4CQ8A 2VEFA 3UR2A 5BXSA 3REQA 2CFFA 5DXXA 3SJ3A 4A2SA 2NQZA 3VIHA 3NL6A 1W3HA 1V79A 3UQIA 3RXZA 5C0QA 4GVIA 3UWZA 3TW6A 3IK8A 1JUKA 4H7VA 1R47A 1Q5MA 5A6TC 3XIMA 1KXQA 3E12A 4IQ2A 3IHZA 3FA3A 1W8GA 1M7OA 1FKJA 4Q8WA 3AZTA 3L65A 2B7OA 3O6AA 3GH5A 3MUAA 1OC6A 1O5KA 2D23A 4WK9A 1E72M 5LA1A 1CGVA 4LNCA 3AHVA 2X1RA 4LAMA 4HHMA 1LLZA 5LNWA 5U7SA 3GSMA 1MVYA 2HK1A 2YCEA 5FI8A 2W27A 2IMRA 4JTDA 1K8YA 4ML4A 3PBUA 3SJNA 3GHRA 2NWRA 4DI8A 1MMFA 4W89A 2A6LA 3QFWA 4LB3A 3VZYA 4A35A 3UQNA 1P43A 5J8LA 3VOFA 4BI6A 2Y7DA 1CXIA 3LHVA 3BH4A 3PM6A 4AZCA 1JI2A 5CAKA 5BOFA 1E6RA 5C70A 1R46A 1FJDA 3E1F1 3PPCA 2AL2B 3BAWA 4BCEA 3MWAA 1JDAA 4DWSA 4OV9A 6PTDA 3OYXA 2PGWA 3LERA 4MJZA 3C2YA 1OGSA 2R24A 5AHLA 1ENUA 2J74A 3TV8A 3C5QA 2DT2A 1YE4A 1MRQA 3LGDA 2ZX5A 1TE1A 1S5WA 2QCCA 2DVTA 4X3ZA 3O5OA 1Q6LA 3EDJA 3T55A 4W9PA 1GVRA 1XDLA 4ODPA 5CPQA 5BRQA 4I5XA 4RNFA 1EQPA 1PZ2A 2H3DA 3KX6A 3KWXA 1WV2A 4X22A 5B8IC 1Y5XA 3AXMA 2VKZG 2XP8A 3B9AA 2PGEA 1F05A 4D6EA 3B4YA 1W3NA 1DJQA 1A0DA 2FKEA 1PV8A 4EIVA 1DTNA 3GLCA 3KBSA 1BWKA 4QG9A 3I6RA 1JEZA 2GSEA 1JNEA 1F07A 1AD4A 5LHEA 3CUGA 4O13A 3KHJA 4MJ4A 2O4MA 1V3LA 4L6OA 1RBLA 2QZRA 5CC7A 2BV9A 2IPW