4JFJA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with compound (1s,6r)-10-(1,3-benzothiazol-6-ylsulfonyl)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfjA00
1FKRA 2F2DA 4DROA 4JFJA 3NTPA 3KCEA 4ODPA 1FKGA 1D7HA 5GPGA 1J6YA 2PV1A 3JXVA 1L1PA 4ITZA 3WH0A 4GGQA 3UF8A 4G2PA 3MDYB 2VN1A 4DRHA 3O5QA 4R0XA 5HW8A 1FD9A 4ODQA 4DT4A 2FKEA 2MPHA 3KAGA 3O5GA 3PA7A 1FKKA 4LAWA 4TW7A 1B6CA 4JYSA 5HKGA 5I98A 1F40A 1BKFA 3KZ7A 2RQSA 4JFKA 1D6OA 3CGMA 5J6EA 4DIPA 2D9FA 2F4EA 1YATA 3TC5A 2RSEA 2MLXA 4LAVA 4TW8A 4U86A 2LGOA 5DIUA 2MF9A 2Y78A 1FKDA 4ODLA 1FKTA 3IHZA 4MSPA 1JVWA 3UQAA 4O2TA 4C02B 2RURA 1J4IA 3B7XA 5B8IC 2DG3A 2ZQVA 1QPLA 1R9HA 2KGJA 1FKFA 3KAHA 3FAPA 3KAFA 2KE0A 2F21A 1FAPA 1PBKA 2RUCA 4LAYA 3O5RA 1FJDA 2FAPA 1JNTA 1FKJA 4U85A 1QPFA 3H9RB 2AWGA 4GIVA 2RUDA 4DRJA 4DRIA 1EYMA 2XP9A 3EY6A 3IKDA 4NNRA 4BF8A 1BL4A 1KT1A 3KABA 1FKSA 2XP3A 1Q6HA 2XP4A 4ODRA 3UQBA 2KO7A 1Q6IA 1ROTA 4IQ2A 4J4NA 4W9OA 4W9QA 2PPPA 1FKLA 2L2SA 4J4OA 3O5PA 4ODOA 2XPAA 1F8AB 2XPBA 4TNSA 5HWBA 3IK8A 3KAIA 2MLYA 2JZVA 2DG9A 4MGVA 2OFNA 3NRKA 3O5OA 2PPNA 3IKGA 1Y0OA 3UI4A 3CGNA 4DH0A 2DG4A 4DRNA 1Q1CA 1J4RA 3RGCA 3O5IA 3O5LA 2M08A 4U84A 1ROUA 2PV3A 4DZ2A 1D7IA 5HW7A 2MLZA 4JFMA 3RFWA 1D7JA 4FN2A 4ODMA 4DRPA 2XP6A 4TX0A 1QZ2A 2KFWA 1EQ3A 5HT1A 1TCOC 2PPOA 2XP5A 2ITKA 3I6CA 1NMWA 2Q5AA 3NI6A 4G50A 3VAWA 3PRDA 2M2AA 5HTGA 2ZR6A 4W9PA 3KADA 4QT3A 5D75A 2VCDA 3UI6A 1HXVA 1U79A 2ZQUA 2LKNA 3ODKA 1FKIA 1N1AA 1P5QA 1FKBA 2PBCA 2KI3A 3OOBA 5DITA 2ZR5A 3UI5A 4IPXA 3PRBA 1ZCNA 2RUQA 5HWCA 2XP7A 2LPVA 2LJ4A 4ODNA 3JYMA 2ZQSA 4TW6A 5DIVA 5BXJA 5HUAA 3LUOA 4JFIA 1J4HA 3O5EA 4IQCA 1KT0A 1Q6UA 3O5FA 4QIBA 4TYOA 3TCZA 1A7XA 1M5YA 2K8IA 3GPKA 4QT2A 1FKHA 1C9HA 1NSGA 2IF4A 3O5DA 4ODKA 3UQIA 2ZR4A 5HW6A 1W26A 2M1IA 1NMVA 2KR7A 2N87A 4N19A 4DZ3A 3JYJA 2PV2A 4DRQA 3TDBA 1PINA 1T11A 1YW5A 3O5KA 2ZQTA 4DRKA 4LAXA 4DRMA 4FAPA 2XP8A 3O5MA 3O5JA 4JFLA 3KACA 2MNTA 1JNSA 1ZK6A 2UZ5A
chains in the Genus database with same CATH superfamily
1SR0A 3NTPA 1FFQA 3KCEA 3WD2A 5GPGA 1J6YA 1W9PA 4G2PA 2VN1A 3B9EA 1OWQA 2MPHA 4LAWA 4JYSA 4WK9A 4ZPWR 1O6IA 3OA5A 1NH6A 1D6OA 5J6EA 2F4EA 3TC5A 2RSEA 3WD3A 3ARWA 1JVWA 4P8XA 4O2TA 2RURA 4MTVA 3WD1A 1R9HA 3KAHA 3FAPA 1PBKA 1JNTA 3H9RB 2DSWA 1W1PA 4DRJA 4MNKA 3EY6A 3IKDA 1LQ0A 1Q6HA 2A3CA 3BMBA 3WIJA 2DT1A 1F8AB 2XPBA 3ARZA 5DEZA 3IK8A 4Z2KA 2MLYA 2JZVA 4MGVA 4NZCA 3RMEA 4MNMA 3IKGA 4WIWA 2A3EA 1GRJA 1J4RA 3RGCA 4U84A 4Z2LA 1CTNA 1D7JA 4ML4A 1EQ3A 1D2KA 1HJXA 2Q5AA 1WAWA 3AS3A 4HBOA 4L72B 3UI6A 2LKNA 1VF8A 1FKIA 1N1AA 3ODKA 1SYTA 3B9AA 1HKJA 1JNDA 4Q22A 2F23A 3PRBA 1HKMA 3WKZA 4TW6A 3ARVA 5DIVA 1NWTA 4QIBA 4TYOA 3TCZA 1NSGA 3UQIA 3PRAA 2ZR4A 5HW6A 1NMVA 4S3KA 4HARA 4DRQA 1KFWA 1T11A 1ZBVA 4URIA 1W9VA 2XP8A 3WL0A 3RM8A 3GTYX 2PV1A 1L1PA 3WH0A 3UF8A 3MDYB 3CHEA 2EULA 4R0XA 2IUZA 4DWSC 1FD9A 4DWSB 1WB0A 1LL4A 4ODQA 3O5GA 1XHGA 5HKGA 2DT2A 1BKFA 3KZ7A 1GPFA 5DO2A 2WLZA 1YATA 1ZBKA 5GPRA 1FKDA 4ODLA 1FKTA 2DT0A 3IHZA 3B7XA 3WQWA 2KE0A 4LAYA 1GOIA 4MNLA 1OGGA 1FJDA 4GIVA 2AWGA 4S3JA 2RUDA 1X6LA 3FY1A 1EYMA 4DWSA 4BF8A 2DT3A 3AQUA 4PTMA 1FKSA 2XP4A 4J4NA 2PPPA 1FKLA 2L2SA 1IX5A 3O5PA 2WM0A 4Z2GA 5HWBA 3BXWA 1ZB5A 4ZPVR 3O5OA 3ARTA 1Y0OA 3UI4A 3CGNA 4DRNA 3RM9A 3ALFA 1D7IA 1E15A 4ODMA 4DRPA 4KR0B 4TX0A 1QZ2A 4MNJA 5HT1A 2XP5A 2G8ZA 3I6CA 4G50A 1TFVA 2ZQUA 1FKBA 1P5QA 2PBCA 5DITA 2KI3A 3UI5A 3ARXA 4IPXA 2PN0A 5DF0A 3G6MA 1ZL1A 1W9UA 3JYMA 2ZQSA 1K9TA 3O5EA 4NSBA 1LG2A 1HKIA 1A7XA 2K8IA 4QT2A 1C9HA 4ODKA 3FXYA 1OGBA 1W1TA 2G41A 4XAKA 2M1IA 3ARUA 4L3NA 3TDBA 4W5UA 1YW5A 3O5KA 4LAXA 4Z2HA 4FAPA 3ARYA 4UDMA 3KACA 3AS0A 2UZ5A 1NWSA 1ZU8A 4DROA 1EDQA 1FKGA 1D7HA 4ODPA 3JXVA 3ALGA 4GGQA 4DRHA 1WNOA 1ITXA 3O5QA 3KAGA 4TW7A 1FKKA 1B6CA 5I98A 2RQSA 2PI6A 2D9FA 2MLXA 4TW8A 2LGOA 5DIUA 4WKFA 2Y78A 2YBUA 3UQAA 1HKKA 4C02B 1J4IA 2DG3A 2ZQVA 2KGJA 1FKFA 5GQBA 4P8VA 2RUCA 1FFRA 1FAPA 2F21A 3O5RA 3CHDA 1QPFA 3W4RA 2XP9A 2XP3A 4ODRA 3ARPA 3UQBA 2KO7A 1Q6IA 2AOSA 4W9OA 1ZBWA 4J4OA 1UR9A 4P8UA 2ETNA 3WD4A 3PR9A 3WL1A 2OFNA 4ZS6A 4DH0A 1Q1CA 2QF8A 3O5IA 3WD0A 3O5LA 1UR8A 2PV3A 4DZ2A 5HW7A 1E44A 2B5UB 2XP6A 2KFWA 4P8WA 1HJVA 2ITKA 2YBTA 2DSUA 1HJWA 5HTGA 2DSZA 2ZR6A 3KADA 5D75A 1HXVA 1NWRA 4R5EA 2O9OA 1GUVA 1ZCNA 3QOKA 2RUQA 2XP7A 3ARRA 3ARQA 2LJ4A 2B31A 2OLHA 4MPKA 3G6LA 5BXJA 2WLYA 4JFIA 1KT0A 1Q6UA 3O5FA 1EIBA 4LGXA 4DRMA 3CH9A 2IF4A 4WKAA 3AS2A 4KQZA 2N87A 4N19A 1X6NA 3AROA 2PV2A 2WK2A 3O5MA 4JFLA 1ZK6A 2P4VA 1FKRA 2F2DA 4JFJA 4AY1A 4WKHA 4IT6A 4ITZA 1RD6A 2A3BA 1W1YA 4Z2IA 5HW8A 4DT4A 2FKEA 3PA7A 1JCHB 1H0GA 1F40A 4JFKA 1W1VA 3CGMA 4DIPA 4LAVA 4U86A 3CHCA 2MF9A 4QZVB 4MSPA 5B8IC 1QPLA 3KAFA 3ARSA 4DWSD 2FAPA 4U85A 3CHFA 2FDMA 4MAVA 4DRIA 1LG1A 1NWUA 4NNRA 1BL4A 5JH8A 1KT1A 3KABA 1LJYA 1E6ZA 1ROTA 4IQ2A 4W9QA 2ESCA 4ODOA 2XPAA 4TNSA 3KAIA 2DG9A 3NRKA 2PPNA 1JNEA 3WQVA 2DG4A 1LL7A 3CZ8A 2M08A 1ROUA 1E9LA 2MLZA 1E6NA 1XRVA 4JFMA 3RFWA 4FN2A 4Z2JA 3AS1A 1E6RA 1TCOC 2PPOA 3RM4A 3B9DA 1ZBCA 4Q7NA 1NMWA 3NI6A 3VAWA 3EIPA 3PRDA 2M2AA 1LL6A 4IT4A 4W9PA 4QT3A 2VCDA 1U79A 1H0IA 3OOBA 3GU0A 2ZR5A 5HBFA 5HWCA 2LPVA 3B8SA 4ODNA 5HUAA 3LUOA 1J4HA 2DPEA 4IQCA 1M5YA 3GPKA 2DSVA 1FKHA 2O92A 4WJXA 3O5DA 4ZPTR 1W26A 2KR7A 4DZ3A 3JYJA 4HBEA 1PINA 2ZQTA 4DRKA 3O5JA 1EHNA 2MNTA 1E6PA 1JNSA 2A3AA 1FKJA
chains in the Genus database with same CATH topology
1SR0A 3NTPA 1FFQA 3KCEA 3WD2A 5GPGA 1J6YA 1W9PA 4G2PA 2VN1A 3B9EA 1OWQA 2MPHA 4LAWA 4JYSA 4WK9A 4ZPWR 1O6IA 3OA5A 1NH6A 1D6OA 5J6EA 2F4EA 3TC5A 2RSEA 3WD3A 3ARWA 1JVWA 4P8XA 4O2TA 2RURA 4MTVA 3WD1A 1R9HA 3KAHA 3FAPA 1PBKA 1JNTA 3H9RB 2DSWA 1W1PA 4DRJA 4MNKA 3EY6A 3IKDA 1LQ0A 1Q6HA 2A3CA 3WIJA 2DT1A 1F8AB 2XPBA 3ARZA 5DEZA 3IK8A 4Z2KA 2MLYA 2JZVA 4MGVA 4NZCA 3RMEA 4MNMA 3IKGA 4WIWA 2A3EA 1J4RA 3RGCA 4U84A 4Z2LA 1CTNA 1D7JA 4ML4A 1EQ3A 1D2KA 1HJXA 2Q5AA 1WAWA 3AS3A 4HBOA 4L72B 3UI6A 2LKNA 1VF8A 1FKIA 1N1AA 3ODKA 1SYTA 3B9AA 1HKJA 1JNDA 4Q22A 3PRBA 1HKMA 3WKZA 4TW6A 3ARVA 5DIVA 1NWTA 4QIBA 4TYOA 3TCZA 1NSGA 3UQIA 3PRAA 2ZR4A 5HW6A 1NMVA 4S3KA 4HARA 4DRQA 1KFWA 1T11A 1ZBVA 4URIA 1W9VA 2XP8A 3WL0A 3RM8A 2PV1A 1L1PA 3WH0A 3UF8A 3MDYB 3CHEA 4R0XA 2IUZA 4DWSC 1FD9A 4DWSB 1WB0A 1LL4A 4ODQA 3O5GA 1XHGA 5HKGA 2DT2A 1BKFA 3KZ7A 1GPFA 5DO2A 2WLZA 1YATA 1ZBKA 5GPRA 1FKDA 4ODLA 1FKTA 2DT0A 3IHZA 3B7XA 3WQWA 2KE0A 4LAYA 1GOIA 4MNLA 1OGGA 1FJDA 4GIVA 2AWGA 4S3JA 2RUDA 1X6LA 3FY1A 1EYMA 4DWSA 4BF8A 2DT3A 3AQUA 4PTMA 1FKSA 2XP4A 4J4NA 2PPPA 1FKLA 2L2SA 1IX5A 3O5PA 2WM0A 4Z2GA 5HWBA 3BXWA 1ZB5A 4ZPVR 3O5OA 3ARTA 1Y0OA 3UI4A 3CGNA 4DRNA 3RM9A 3ALFA 1D7IA 1E15A 4ODMA 4DRPA 4KR0B 4TX0A 1QZ2A 4MNJA 5HT1A 2XP5A 2G8ZA 3I6CA 4G50A 1TFVA 2ZQUA 1FKBA 1P5QA 2PBCA 5DITA 2KI3A 3UI5A 3ARXA 4IPXA 5DF0A 3G6MA 1ZL1A 1W9UA 3JYMA 2ZQSA 1K9TA 3O5EA 4NSBA 1LG2A 1HKIA 1A7XA 2K8IA 4QT2A 1C9HA 4ODKA 3FXYA 1OGBA 1W1TA 2G41A 4XAKA 2M1IA 3ARUA 4L3NA 3TDBA 4W5UA 1YW5A 3O5KA 4LAXA 4Z2HA 4FAPA 3ARYA 3KACA 3AS0A 2UZ5A 1NWSA 1ZU8A 4DROA 1EDQA 1FKGA 1D7HA 4ODPA 3JXVA 3ALGA 4GGQA 4DRHA 1WNOA 1ITXA 3O5QA 3KAGA 4TW7A 1FKKA 1B6CA 5I98A 2RQSA 2PI6A 2D9FA 2MLXA 4TW8A 2LGOA 5DIUA 4WKFA 2Y78A 2YBUA 3UQAA 1HKKA 4C02B 1J4IA 2DG3A 2ZQVA 2KGJA 1FKFA 5GQBA 4P8VA 2RUCA 1FFRA 1FAPA 2F21A 3O5RA 3CHDA 1QPFA 3W4RA 2XP9A 2XP3A 4ODRA 3ARPA 3UQBA 2KO7A 1Q6IA 2AOSA 4W9OA 1ZBWA 4J4OA 1UR9A 4P8UA 3WD4A 3PR9A 3WL1A 2OFNA 4ZS6A 4DH0A 1Q1CA 2QF8A 3O5IA 3WD0A 3O5LA 1UR8A 2PV3A 4DZ2A 5HW7A 2XP6A 2KFWA 4P8WA 1HJVA 2ITKA 2YBTA 2DSUA 1HJWA 5HTGA 2DSZA 2ZR6A 3KADA 5D75A 1HXVA 1NWRA 4R5EA 2O9OA 1GUVA 1ZCNA 3QOKA 2RUQA 2XP7A 3ARRA 3ARQA 2LJ4A 2B31A 2OLHA 4MPKA 3G6LA 5BXJA 2WLYA 4JFIA 1KT0A 1Q6UA 3O5FA 1EIBA 4LGXA 4DRMA 3CH9A 2IF4A 4WKAA 3AS2A 4KQZA 2N87A 4N19A 1X6NA 3AROA 2PV2A 2WK2A 3O5MA 4JFLA 1ZK6A 1FKRA 2F2DA 4JFJA 4AY1A 4WKHA 4IT6A 4ITZA 1RD6A 2A3BA 1W1YA 4Z2IA 5HW8A 4DT4A 2FKEA 3PA7A 1F40A 1H0GA 4JFKA 1W1VA 3CGMA 4DIPA 4LAVA 4U86A 3CHCA 2MF9A 4QZVB 4MSPA 5B8IC 1QPLA 3KAFA 3ARSA 4DWSD 2FAPA 4U85A 3CHFA 2FDMA 4MAVA 4DRIA 1LG1A 1NWUA 4NNRA 1BL4A 5JH8A 1KT1A 3KABA 1LJYA 1E6ZA 1ROTA 4IQ2A 4W9QA 2ESCA 4ODOA 2XPAA 4TNSA 3KAIA 2DG9A 3NRKA 2PPNA 1JNEA 3WQVA 2DG4A 1LL7A 3CZ8A 2M08A 1ROUA 1E9LA 2MLZA 1E6NA 1XRVA 4JFMA 3RFWA 4FN2A 4Z2JA 3AS1A 1E6RA 1TCOC 2PPOA 3RM4A 3B9DA 1ZBCA 4Q7NA 1NMWA 3NI6A 3VAWA 3PRDA 2M2AA 1LL6A 4IT4A 4W9PA 4QT3A 2VCDA 1U79A 1H0IA 3OOBA 2ZR5A 5HBFA 5HWCA 2LPVA 3B8SA 4ODNA 5HUAA 3LUOA 1J4HA 2DPEA 4IQCA 1M5YA 3GPKA 2DSVA 1FKHA 2O92A 4WJXA 3O5DA 4ZPTR 1W26A 2KR7A 4DZ3A 3JYJA 4HBEA 1PINA 2ZQTA 4DRKA 3O5JA 1EHNA 2MNTA 1E6PA 1JNSA 2A3AA 1FKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKR A;  2F2D A;  4DRO A;  4JFJ A;  3NTP A;  3KCE A;  4ODP A;  1FKG A;  1D7H A;  5GPG A;  1J6Y A;  2PV1 A;  3JXV A;  1L1P A;  4ITZ A;  3WH0 A;  4GGQ A;  3UF8 A;  4G2P A;  3MDY B;  2VN1 A;  4DRH A;  3O5Q A;  4R0X A;  5HW8 A;  1FD9 A;  4ODQ A;  4DT4 A;  2FKE A;  2MPH A;  3KAG A;  3O5G A;  3PA7 A;  1FKK A;  4LAW A;  4TW7 A;  1B6C A;  4JYS A;  5HKG A;  5I98 A;  1F40 A;  1BKF A;  3KZ7 A;  2RQS A;  4JFK A;  1D6O A;  3CGM A;  5J6E A;  4DIP A;  2D9F A;  2F4E A;  1YAT A;  3TC5 A;  2RSE A;  2MLX A;  4LAV A;  4TW8 A;  4U86 A;  2LGO A;  5DIU A;  2MF9 A;  2Y78 A;  1FKD A;  4ODL A;  1FKT A;  3IHZ A;  4MSP A;  1JVW A;  3UQA A;  4O2T A;  4C02 B;  2RUR A;  1J4I A;  3B7X A;  5B8I C;  2DG3 A;  2ZQV A;  1QPL A;  1R9H A;  2KGJ A;  1FKF A;  3KAH A;  3FAP A;  3KAF A;  2KE0 A;  2F21 A;  1FAP A;  1PBK A;  2RUC A;  4LAY A;  3O5R A;  1FJD A;  2FAP A;  1JNT A;  1FKJ A;  4U85 A;  1QPF A;  3H9R B;  2AWG A;  4GIV A;  2RUD A;  4DRJ A;  4DRI A;  1EYM A;  2XP9 A;  3EY6 A;  3IKD A;  4NNR A;  4BF8 A;  1BL4 A;  1KT1 A;  3KAB A;  1FKS A;  2XP3 A;  1Q6H A;  2XP4 A;  4ODR A;  3UQB A;  2KO7 A;  1Q6I A;  1ROT A;  4IQ2 A;  4J4N A;  4W9O A;  4W9Q A;  2PPP A;  1FKL A;  2L2S A;  4J4O A;  3O5P A;  4ODO A;  2XPA A;  1F8A B;  2XPB A;  4TNS A;  5HWB A;  3IK8 A;  3KAI A;  2MLY A;  2JZV A;  2DG9 A;  4MGV A;  2OFN A;  3NRK A;  3O5O A;  2PPN A;  3IKG A;  1Y0O A;  3UI4 A;  3CGN A;  4DH0 A;  2DG4 A;  4DRN A;  1Q1C A;  1J4R A;  3RGC A;  3O5I A;  3O5L A;  2M08 A;  4U84 A;  1ROU A;  2PV3 A;  4DZ2 A;  1D7I A;  5HW7 A;  2MLZ A;  4JFM A;  3RFW A;  1D7J A;  4FN2 A;  4ODM A;  4DRP A;  2XP6 A;  4TX0 A;  1QZ2 A;  2KFW A;  1EQ3 A;  5HT1 A;  1TCO C;  2PPO A;  2XP5 A;  2ITK A;  3I6C A;  1NMW A;  2Q5A A;  3NI6 A;  4G50 A;  3VAW A;  3PRD A;  2M2A A;  5HTG A;  2ZR6 A;  4W9P A;  3KAD A;  4QT3 A;  5D75 A;  2VCD A;  3UI6 A;  1HXV A;  1U79 A;  2ZQU A;  2LKN A;  3ODK A;  1FKI A;  1N1A A;  1P5Q A;  1FKB A;  2PBC A;  2KI3 A;  3OOB A;  5DIT A;  2ZR5 A;  3UI5 A;  4IPX A;  3PRB A;  1ZCN A;  2RUQ A;  5HWC A;  2XP7 A;  2LPV A;  2LJ4 A;  4ODN A;  3JYM A;  2ZQS A;  4TW6 A;  5DIV A;  5BXJ A;  5HUA A;  3LUO A;  4JFI A;  1J4H A;  3O5E A;  4IQC A;  1KT0 A;  1Q6U A;  3O5F A;  4QIB A;  4TYO A;  3TCZ A;  1A7X A;  1M5Y A;  2K8I A;  3GPK A;  4QT2 A;  1FKH A;  1C9H A;  1NSG A;  2IF4 A;  3O5D A;  4ODK A;  3UQI A;  2ZR4 A;  5HW6 A;  1W26 A;  2M1I A;  1NMV A;  2KR7 A;  2N87 A;  4N19 A;  4DZ3 A;  3JYJ A;  2PV2 A;  4DRQ A;  3TDB A;  1PIN A;  1T11 A;  1YW5 A;  3O5K A;  2ZQT A;  4DRK A;  4LAX A;  4DRM A;  4FAP A;  2XP8 A;  3O5M A;  3O5J A;  4JFL A;  3KAC A;  2MNT A;  1JNS A;  1ZK6 A;  2UZ5 A; 
#chains in the Genus database with same CATH topology
 1SR0 A;  3NTP A;  1FFQ A;  3KCE A;  3WD2 A;  5GPG A;  1J6Y A;  1W9P A;  4G2P A;  2VN1 A;  3B9E A;  1OWQ A;  2MPH A;  4LAW A;  4JYS A;  4WK9 A;  4ZPW R;  1O6I A;  3OA5 A;  1NH6 A;  1D6O A;  5J6E A;  2F4E A;  3TC5 A;  2RSE A;  3WD3 A;  3ARW A;  1JVW A;  4P8X A;  4O2T A;  2RUR A;  4MTV A;  3WD1 A;  1R9H A;  3KAH A;  3FAP A;  1PBK A;  1JNT A;  3H9R B;  2DSW A;  1W1P A;  4DRJ A;  4MNK A;  3EY6 A;  3IKD A;  1LQ0 A;  1Q6H A;  2A3C A;  3BMB A;  3WIJ A;  2DT1 A;  1F8A B;  2XPB A;  3ARZ A;  5DEZ A;  3IK8 A;  4Z2K A;  2MLY A;  2JZV A;  4MGV A;  4NZC A;  3RME A;  4MNM A;  3IKG A;  4WIW A;  2A3E A;  1GRJ A;  1J4R A;  3RGC A;  4U84 A;  4Z2L A;  1CTN A;  1D7J A;  4ML4 A;  1EQ3 A;  1D2K A;  1HJX A;  2Q5A A;  1WAW A;  3AS3 A;  4HBO A;  4L72 B;  3UI6 A;  2LKN A;  1VF8 A;  1FKI A;  1N1A A;  3ODK A;  1SYT A;  3B9A A;  1HKJ A;  1JND A;  4Q22 A;  2F23 A;  3PRB A;  1HKM A;  3WKZ A;  4TW6 A;  3ARV A;  5DIV A;  1NWT A;  4QIB A;  4TYO A;  3TCZ A;  1NSG A;  3UQI A;  3PRA A;  2ZR4 A;  5HW6 A;  1NMV A;  4S3K A;  4HAR A;  4DRQ A;  1KFW A;  1T11 A;  1ZBV A;  4URI A;  1W9V A;  2XP8 A;  3WL0 A;  3RM8 A;  3GTY X;  2PV1 A;  1L1P A;  3WH0 A;  3UF8 A;  3MDY B;  3CHE A;  2EUL A;  4R0X A;  2IUZ A;  4DWS C;  1FD9 A;  4DWS B;  1WB0 A;  1LL4 A;  4ODQ A;  3O5G A;  1XHG A;  5HKG A;  2DT2 A;  1BKF A;  3KZ7 A;  1GPF A;  5DO2 A;  2WLZ A;  1YAT A;  1ZBK A;  5GPR A;  1FKD A;  4ODL A;  1FKT A;  2DT0 A;  3IHZ A;  3B7X A;  3WQW A;  2KE0 A;  4LAY A;  1GOI A;  4MNL A;  1OGG A;  1FJD A;  4GIV A;  2AWG A;  4S3J A;  2RUD A;  1X6L A;  3FY1 A;  1EYM A;  4DWS A;  4BF8 A;  2DT3 A;  3AQU A;  4PTM A;  1FKS A;  2XP4 A;  4J4N A;  2PPP A;  1FKL A;  2L2S A;  1IX5 A;  3O5P A;  2WM0 A;  4Z2G A;  5HWB A;  3BXW A;  1ZB5 A;  4ZPV R;  3O5O A;  3ART A;  1Y0O A;  3UI4 A;  3CGN A;  4DRN A;  3RM9 A;  3ALF A;  1D7I A;  1E15 A;  4ODM A;  4DRP A;  4KR0 B;  4TX0 A;  1QZ2 A;  4MNJ A;  5HT1 A;  2XP5 A;  2G8Z A;  3I6C A;  4G50 A;  1TFV A;  2ZQU A;  1FKB A;  1P5Q A;  2PBC A;  5DIT A;  2KI3 A;  3UI5 A;  3ARX A;  4IPX A;  2PN0 A;  5DF0 A;  3G6M A;  1ZL1 A;  1W9U A;  3JYM A;  2ZQS A;  1K9T A;  3O5E A;  4NSB A;  1LG2 A;  1HKI A;  1A7X A;  2K8I A;  4QT2 A;  1C9H A;  4ODK A;  3FXY A;  1OGB A;  1W1T A;  2G41 A;  4XAK A;  2M1I A;  3ARU A;  4L3N A;  3TDB A;  4W5U A;  1YW5 A;  3O5K A;  4LAX A;  4Z2H A;  4FAP A;  3ARY A;  4UDM A;  3KAC A;  3AS0 A;  2UZ5 A;  1NWS A;  1ZU8 A;  4DRO A;  1EDQ A;  1FKG A;  1D7H A;  4ODP A;  3JXV A;  3ALG A;  4GGQ A;  4DRH A;  1WNO A;  1ITX A;  3O5Q A;  3KAG A;  4TW7 A;  1FKK A;  1B6C A;  5I98 A;  2RQS A;  2PI6 A;  2D9F A;  2MLX A;  4TW8 A;  2LGO A;  5DIU A;  4WKF A;  2Y78 A;  2YBU A;  3UQA A;  1HKK A;  4C02 B;  1J4I A;  2DG3 A;  2ZQV A;  2KGJ A;  1FKF A;  5GQB A;  4P8V A;  2RUC A;  1FFR A;  1FAP A;  2F21 A;  3O5R A;  3CHD A;  1QPF A;  3W4R A;  2XP9 A;  2XP3 A;  4ODR A;  3ARP A;  3UQB A;  2KO7 A;  1Q6I A;  2AOS A;  4W9O A;  1ZBW A;  4J4O A;  1UR9 A;  4P8U A;  2ETN A;  3WD4 A;  3PR9 A;  3WL1 A;  2OFN A;  4ZS6 A;  4DH0 A;  1Q1C A;  2QF8 A;  3O5I A;  3WD0 A;  3O5L A;  1UR8 A;  2PV3 A;  4DZ2 A;  5HW7 A;  1E44 A;  2B5U B;  2XP6 A;  2KFW A;  4P8W A;  1HJV A;  2ITK A;  2YBT A;  2DSU A;  1HJW A;  5HTG A;  2DSZ A;  2ZR6 A;  3KAD A;  5D75 A;  1HXV A;  1NWR A;  4R5E A;  2O9O A;  1GUV A;  1ZCN A;  3QOK A;  2RUQ A;  2XP7 A;  3ARR A;  3ARQ A;  2LJ4 A;  2B31 A;  2OLH A;  4MPK A;  3G6L A;  5BXJ A;  2WLY A;  4JFI A;  1KT0 A;  1Q6U A;  3O5F A;  1EIB A;  4LGX A;  4DRM A;  3CH9 A;  2IF4 A;  4WKA A;  3AS2 A;  4KQZ A;  2N87 A;  4N19 A;  1X6N A;  3ARO A;  2PV2 A;  2WK2 A;  3O5M A;  4JFL A;  1ZK6 A;  2P4V A;  1FKR A;  2F2D A;  4JFJ A;  4AY1 A;  4WKH A;  4IT6 A;  4ITZ A;  1RD6 A;  2A3B A;  1W1Y A;  4Z2I A;  5HW8 A;  4DT4 A;  2FKE A;  3PA7 A;  1JCH B;  1H0G A;  1F40 A;  4JFK A;  1W1V A;  3CGM A;  4DIP A;  4LAV A;  4U86 A;  3CHC A;  2MF9 A;  4QZV B;  4MSP A;  5B8I C;  1QPL A;  3KAF A;  3ARS A;  4DWS D;  2FAP A;  4U85 A;  3CHF A;  2FDM A;  4MAV A;  4DRI A;  1LG1 A;  1NWU A;  4NNR A;  1BL4 A;  5JH8 A;  1KT1 A;  3KAB A;  1LJY A;  1E6Z A;  1ROT A;  4IQ2 A;  4W9Q A;  2ESC A;  4ODO A;  2XPA A;  4TNS A;  3KAI A;  2DG9 A;  3NRK A;  2PPN A;  1JNE A;  3WQV A;  2DG4 A;  1LL7 A;  3CZ8 A;  2M08 A;  1ROU A;  1E9L A;  2MLZ A;  1E6N A;  1XRV A;  4JFM A;  3RFW A;  4FN2 A;  4Z2J A;  3AS1 A;  1E6R A;  1TCO C;  2PPO A;  3RM4 A;  3B9D A;  1ZBC A;  4Q7N A;  1NMW A;  3NI6 A;  3VAW A;  3EIP A;  3PRD A;  2M2A A;  1LL6 A;  4IT4 A;  4W9P A;  4QT3 A;  2VCD A;  1U79 A;  1H0I A;  3OOB A;  3GU0 A;  2ZR5 A;  5HBF A;  5HWC A;  2LPV A;  3B8S A;  4ODN A;  5HUA A;  3LUO A;  1J4H A;  2DPE A;  4IQC A;  1M5Y A;  3GPK A;  2DSV A;  1FKH A;  2O92 A;  4WJX A;  3O5D A;  4ZPT R;  1W26 A;  2KR7 A;  4DZ3 A;  3JYJ A;  4HBE A;  1PIN A;  2ZQT A;  4DRK A;  3O5J A;  1EHN A;  2MNT A;  1E6P A;  1JNS A;  2A3A A;  1FKJ A; 
#chains in the Genus database with same CATH homology
 1SR0 A;  3NTP A;  1FFQ A;  3KCE A;  3WD2 A;  5GPG A;  1J6Y A;  1W9P A;  4G2P A;  2VN1 A;  3B9E A;  1OWQ A;  2MPH A;  4LAW A;  4JYS A;  4WK9 A;  4ZPW R;  1O6I A;  3OA5 A;  1NH6 A;  1D6O A;  5J6E A;  2F4E A;  3TC5 A;  2RSE A;  3WD3 A;  3ARW A;  1JVW A;  4P8X A;  4O2T A;  2RUR A;  4MTV A;  3WD1 A;  1R9H A;  3KAH A;  3FAP A;  1PBK A;  1JNT A;  3H9R B;  2DSW A;  1W1P A;  4DRJ A;  4MNK A;  3EY6 A;  3IKD A;  1LQ0 A;  1Q6H A;  2A3C A;  3WIJ A;  2DT1 A;  1F8A B;  2XPB A;  3ARZ A;  5DEZ A;  3IK8 A;  4Z2K A;  2MLY A;  2JZV A;  4MGV A;  4NZC A;  3RME A;  4MNM A;  3IKG A;  4WIW A;  2A3E A;  1J4R A;  3RGC A;  4U84 A;  4Z2L A;  1CTN A;  1D7J A;  4ML4 A;  1EQ3 A;  1D2K A;  1HJX A;  2Q5A A;  1WAW A;  3AS3 A;  4HBO A;  4L72 B;  3UI6 A;  2LKN A;  1VF8 A;  1FKI A;  1N1A A;  3ODK A;  1SYT A;  3B9A A;  1HKJ A;  1JND A;  4Q22 A;  3PRB A;  1HKM A;  3WKZ A;  4TW6 A;  3ARV A;  5DIV A;  1NWT A;  4QIB A;  4TYO A;  3TCZ A;  1NSG A;  3UQI A;  3PRA A;  2ZR4 A;  5HW6 A;  1NMV A;  4S3K A;  4HAR A;  4DRQ A;  1KFW A;  1T11 A;  1ZBV A;  4URI A;  1W9V A;  2XP8 A;  3WL0 A;  3RM8 A;  2PV1 A;  1L1P A;  3WH0 A;  3UF8 A;  3MDY B;  3CHE A;  4R0X A;  2IUZ A;  4DWS C;  1FD9 A;  4DWS B;  1WB0 A;  1LL4 A;  4ODQ A;  3O5G A;  1XHG A;  5HKG A;  2DT2 A;  1BKF A;  3KZ7 A;  1GPF A;  5DO2 A;  2WLZ A;  1YAT A;  1ZBK A;  5GPR A;  1FKD A;  4ODL A;  1FKT A;  2DT0 A;  3IHZ A;  3B7X A;  3WQW A;  2KE0 A;  4LAY A;  1GOI A;  4MNL A;  1OGG A;  1FJD A;  4GIV A;  2AWG A;  4S3J A;  2RUD A;  1X6L A;  3FY1 A;  1EYM A;  4DWS A;  4BF8 A;  2DT3 A;  3AQU A;  4PTM A;  1FKS A;  2XP4 A;  4J4N A;  2PPP A;  1FKL A;  2L2S A;  1IX5 A;  3O5P A;  2WM0 A;  4Z2G A;  5HWB A;  3BXW A;  1ZB5 A;  4ZPV R;  3O5O A;  3ART A;  1Y0O A;  3UI4 A;  3CGN A;  4DRN A;  3RM9 A;  3ALF A;  1D7I A;  1E15 A;  4ODM A;  4DRP A;  4KR0 B;  4TX0 A;  1QZ2 A;  4MNJ A;  5HT1 A;  2XP5 A;  2G8Z A;  3I6C A;  4G50 A;  1TFV A;  2ZQU A;  1FKB A;  1P5Q A;  2PBC A;  5DIT A;  2KI3 A;  3UI5 A;  3ARX A;  4IPX A;  5DF0 A;  3G6M A;  1ZL1 A;  1W9U A;  3JYM A;  2ZQS A;  1K9T A;  3O5E A;  4NSB A;  1LG2 A;  1HKI A;  1A7X A;  2K8I A;  4QT2 A;  1C9H A;  4ODK A;  3FXY A;  1OGB A;  1W1T A;  2G41 A;  4XAK A;  2M1I A;  3ARU A;  4L3N A;  3TDB A;  4W5U A;  1YW5 A;  3O5K A;  4LAX A;  4Z2H A;  4FAP A;  3ARY A;  3KAC A;  3AS0 A;  2UZ5 A;  1NWS A;  1ZU8 A;  4DRO A;  1EDQ A;  1FKG A;  1D7H A;  4ODP A;  3JXV A;  3ALG A;  4GGQ A;  4DRH A;  1WNO A;  1ITX A;  3O5Q A;  3KAG A;  4TW7 A;  1FKK A;  1B6C A;  5I98 A;  2RQS A;  2PI6 A;  2D9F A;  2MLX A;  4TW8 A;  2LGO A;  5DIU A;  4WKF A;  2Y78 A;  2YBU A;  3UQA A;  1HKK A;  4C02 B;  1J4I A;  2DG3 A;  2ZQV A;  2KGJ A;  1FKF A;  5GQB A;  4P8V A;  2RUC A;  1FFR A;  1FAP A;  2F21 A;  3O5R A;  3CHD A;  1QPF A;  3W4R A;  2XP9 A;  2XP3 A;  4ODR A;  3ARP A;  3UQB A;  2KO7 A;  1Q6I A;  2AOS A;  4W9O A;  1ZBW A;  4J4O A;  1UR9 A;  4P8U A;  3WD4 A;  3PR9 A;  3WL1 A;  2OFN A;  4ZS6 A;  4DH0 A;  1Q1C A;  2QF8 A;  3O5I A;  3WD0 A;  3O5L A;  1UR8 A;  2PV3 A;  4DZ2 A;  5HW7 A;  2XP6 A;  2KFW A;  4P8W A;  1HJV A;  2ITK A;  2YBT A;  2DSU A;  1HJW A;  5HTG A;  2DSZ A;  2ZR6 A;  3KAD A;  5D75 A;  1HXV A;  1NWR A;  4R5E A;  2O9O A;  1GUV A;  1ZCN A;  3QOK A;  2RUQ A;  2XP7 A;  3ARR A;  3ARQ A;  2LJ4 A;  2B31 A;  2OLH A;  4MPK A;  3G6L A;  5BXJ A;  2WLY A;  4JFI A;  1KT0 A;  1Q6U A;  3O5F A;  1EIB A;  4LGX A;  4DRM A;  3CH9 A;  2IF4 A;  4WKA A;  3AS2 A;  4KQZ A;  2N87 A;  4N19 A;  1X6N A;  3ARO A;  2PV2 A;  2WK2 A;  3O5M A;  4JFL A;  1ZK6 A;  1FKR A;  2F2D A;  4JFJ A;  4AY1 A;  4WKH A;  4IT6 A;  4ITZ A;  1RD6 A;  2A3B A;  1W1Y A;  4Z2I A;  5HW8 A;  4DT4 A;  2FKE A;  3PA7 A;  1F40 A;  1H0G A;  4JFK A;  1W1V A;  3CGM A;  4DIP A;  4LAV A;  4U86 A;  3CHC A;  2MF9 A;  4QZV B;  4MSP A;  5B8I C;  1QPL A;  3KAF A;  3ARS A;  4DWS D;  2FAP A;  4U85 A;  3CHF A;  2FDM A;  4MAV A;  4DRI A;  1LG1 A;  1NWU A;  4NNR A;  1BL4 A;  5JH8 A;  1KT1 A;  3KAB A;  1LJY A;  1E6Z A;  1ROT A;  4IQ2 A;  4W9Q A;  2ESC A;  4ODO A;  2XPA A;  4TNS A;  3KAI A;  2DG9 A;  3NRK A;  2PPN A;  1JNE A;  3WQV A;  2DG4 A;  1LL7 A;  3CZ8 A;  2M08 A;  1ROU A;  1E9L A;  2MLZ A;  1E6N A;  1XRV A;  4JFM A;  3RFW A;  4FN2 A;  4Z2J A;  3AS1 A;  1E6R A;  1TCO C;  2PPO A;  3RM4 A;  3B9D A;  1ZBC A;  4Q7N A;  1NMW A;  3NI6 A;  3VAW A;  3PRD A;  2M2A A;  1LL6 A;  4IT4 A;  4W9P A;  4QT3 A;  2VCD A;  1U79 A;  1H0I A;  3OOB A;  2ZR5 A;  5HBF A;  5HWC A;  2LPV A;  3B8S A;  4ODN A;  5HUA A;  3LUO A;  1J4H A;  2DPE A;  4IQC A;  1M5Y A;  3GPK A;  2DSV A;  1FKH A;  2O92 A;  4WJX A;  3O5D A;  4ZPT R;  1W26 A;  2KR7 A;  4DZ3 A;  3JYJ A;  4HBE A;  1PIN A;  2ZQT A;  4DRK A;  3O5J A;  1EHN A;  2MNT A;  1E6P A;  1JNS A;  2A3A A;  1FKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...