4JFJA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with compound (1s,6r)-10-(1,3-benzothiazol-6-ylsulfonyl)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfjA00
2ZR6A 2UZ5A 1D7JA 3O5EA 3IK8A 1U79A 4LAWA 4TW8A 2Y78A 2L2SA 1KT0A 1F8AB 2RSEA 4TX0A 2VCDA 1Q6IA 2FAPA 5HWBA 4ODLA 2Q5AA 5HW6A 1FKJA 2JZVA 3KACA 1TCOC 3O5DA 4U86A 3UI6A 5HUAA 1F40A 2DG3A 2XPAA 1Q1CA 5GPGA 3UQBA 4DZ2A 3O5FA 3B7XA 3KAFA 2KI3A 1FKBA 4O2TA 1BKFA 1PINA 1QPLA 3NRKA 1C9HA 1M5YA 3IKDA 4DH0A 4DRKA 1Q6UA 4ITZA 5I98A 2IF4A 3UI4A 1ROTA 2MNTA 2LJ4A 3CGNA 3O5KA 4JFKA 1FKIA 3VAWA 3IHZA 3O5IA 1D7IA 4TYOA 1D6OA 1J4HA 2ZQUA 1D7HA 2LKNA 5J6EA 1FKSA 1QZ2A 1R9HA 2LPVA 1QPFA 4NNRA 3O5JA 1FKDA 2XP9A 4IQ2A 3O5LA 4JFMA 4W9OA 3H9RB 1J4RA 2ZQSA 3IKGA 4C02B 1PBKA 1ROUA 2PPNA 2LGOA 1FKHA 1JNSA 4TNSA 3O5PA 1FKFA 3O5MA 2PV3A 4BF8A 1B6CA 1FD9A 3I6CA 2PPOA 3PRDA 3KAIA 2XPBA 4JFIA 4G50A 1YATA 3KAGA 4ODMA 3RGCA 2N87A 3O5OA 3WH0A 3FAPA 4LAYA 4MGVA 2ZR4A 2K8IA 1FKGA 4U84A 1YW5A 3KCEA 3RFWA 3NTPA 2XP3A 2RUQA 4FN2A 1J4IA 2XP7A 4N19A 4QT3A 4TW7A 3TC5A 2F21A 2VN1A 1NMVA 5HW8A 2MLXA 3JXVA 1Y0OA 4ODQA 2RQSA 1L1PA 1FKTA 4ODNA 2XP4A 2ZQVA 4U85A 4J4OA 5BXJA 3EY6A 3JYMA 4DRQA 3MDYB 2OFNA 2XP8A 3O5RA 4QIBA 2MPHA 1FJDA 2KGJA 1W26A 2DG4A 3OOBA 4JYSA 4W9QA 3UI5A 1ZCNA 3LUOA 1JVWA 1Q6HA 5DITA 3KZ7A 2PBCA 4G2PA 5DIVA 4GGQA 2KFWA 3ODKA 4ODOA 2M08A 2ITKA 3KAHA 1EYMA 3NI6A 2PPPA 2D9FA 5HKGA 1FAPA 1KT1A 2KO7A 1ZK6A 2RUCA 4DRNA 3TCZA 3KADA 4JFLA 2KE0A 4ODRA 1BL4A 2RUDA 3KABA 4QT2A 3UQIA 4FAPA 1JNTA 1N1AA 5HW7A 3UF8A 2M1IA 1HXVA 4DRHA 4DT4A 5HWCA 2RURA 2MLYA 4DRIA 1FKRA 1NSGA 2DG9A 2FKEA 2MF9A 5DIUA 4DIPA 1T11A 5B8IC 2ZQTA 4JFJA 3TDBA 3GPKA 3CGMA 1P5QA 4J4NA 5HT1A 1FKKA 2F2DA 4MSPA 4ODPA 4DRJA 5D75A 4DROA 3O5GA 4LAXA 2XP6A 4IQCA 2XP5A 2ZR5A 3O5QA 1A7XA 4DZ3A 2F4EA 2PV2A 4IPXA 1NMWA 3PA7A 4ODKA 4DRMA 4TW6A 5HTGA 2M2AA 4R0XA 3UQAA 4W9PA 1FKLA 3JYJA 1J6YA 3PRBA 1EQ3A 2PV1A 4GIVA 4LAVA 4DRPA 2AWGA 2KR7A 2MLZA
chains in the Genus database with same CATH superfamily
2ZR6A 2UZ5A 3IK8A 4TW8A 2QF8A 2Y78A 2RSEA 1KT0A 1F8AB 2FAPA 4ODLA 1FKJA 4MNMA 3UI6A 2DG3A 2DSWA 3B7XA 2KI3A 1FKBA 1BKFA 3NRKA 1NWSA 4QZVB 4DH0A 4DRKA 4ITZA 5I98A 2IF4A 2MNTA 4HBEA 3VAWA 1WB0A 1E9LA 3ARSA 1D7HA 3WD2A 5J6EA 1FKSA 2LPVA 3CHCA 2OLHA 3O5JA 2WK2A 1X6LA 3O5LA 1J4RA 4C02B 2PPNA 1WNOA 2LGOA 1FKHA 1H0IA 1HJXA 2G41A 1LJYA 1SYTA 4NZCA 3KAIA 2XPBA 4ODMA 1YATA 3WH0A 4MTVA 4LAYA 4S3KA 4WKAA 1GRJA 1YW5A 3NTPA 1ITXA 4HARA 1NMVA 1ZBCA 1JCHB 1H0GA 2B31A 1L1PA 4U85A 3AS0A 5BXJA 1NWTA 2XP8A 2KGJA 2DG4A 3OOBA 1E6ZA 4W9QA 4P8XA 5DIVA 3QOKA 4ODOA 2M08A 2A3BA 2PPPA 2D9FA 4Q22A 1KT1A 2RUCA 3KADA 3WD1A 2KE0A 3KABA 2AOSA 3UQIA 3RM9A 4DRHA 4P8UA 1KFWA 2MLYA 1CTNA 4DRIA 2DG9A 4DWSA 4MNJA 4JFJA 3CH9A 3CGMA 4MAVA 1P5QA 5HT1A 4ODPA 3AS1A 4DROA 3O5GA 4W5UA 1D2KA 2ESCA 2M2AA 4W9PA 1EQ3A 4LAVA 2AWGA 3WD3A 4TX0A 5HWBA 2VCDA 3FY1A 1IX5A 2JZVA 3KACA 3O5DA 2A3EA 4U86A 4ZPTR 1F40A 1E6RA 1JNEA 3ARRA 4O2TA 3RM8A 4HBOA 1Q6UA 1W1TA 3AROA 5GPRA 2LJ4A 1FKIA 3O5IA 4ML4A 3CHDA 1EIBA 2ZQUA 1QZ2A 4L72B 2XP9A 1EDQA 4IQ2A 4JFMA 2ZQSA 2EULA 1X6NA 1FKFA 1B6CA 3I6CA 1EHNA 2PPOA 3ARVA 1OGGA 3AS2A 3O5OA 3FAPA 2DT0A 2ZR4A 2G8ZA 4U84A 2YBUA 2RUQA 4FN2A 2XP7A 3ARXA 3TC5A 2F21A 2VN1A 1W1VA 1FFRA 1Y0OA 3JXVA 4WIWA 4ZS6A 3JYMA 1FJDA 4DRQA 2ETNA 1UR8A 2OFNA 3O5RA 4R5EA 1OGBA 3G6MA 4LGXA 1ZCNA 3LUOA 1HKKA 3ALGA 3ODKA 2B5UB 2ITKA 4MPKA 1EYMA 1O6IA 2KO7A 3WKZA 4DRNA 2A3AA 3TCZA 4JFLA 4DWSD 1BL4A 2RUDA 4FAPA 3UF8A 1HXVA 1HJWA 1RD6A 1FKRA 4WK9A 3ARTA 3WD0A 2MF9A 4DIPA 5B8IC 2ZQTA 4J4NA 4MSPA 2O92A 2XP6A 4URIA 3O5QA 4DZ3A 2YBTA 1UR9A 4S3JA 3WL0A 4DRMA 4TW6A 5HTGA 4R0XA 1FKLA 3PRBA 2PV1A 3CHEA 5DEZA 1GUVA 1D7JA 3O5EA 1U79A 4LAWA 4KR0B 4DWSC 1Q6IA 5HW6A 2PN0A 3B8SA 1LL4A 5GPGA 3KAFA 3ARWA 1QPLA 3AS3A 3IKDA 2P4VA 4MNKA 1E6PA 3UI4A 3CGNA 1GOIA 5DF0A 3IHZA 4TYOA 1LG2A 1D6OA 1E6NA 1J4HA 4AY1A 1ZBWA 1LQ0A 4NNRA 1FKDA 4W9OA 3WL1A 1HKIA 1PBKA 1WAWA 4TNSA 3O5PA 3O5MA 3W4RA 1HKJA 3PRDA 4JFIA 3KAGA 1JNDA 4MGVA 3PR9A 2K8IA 1FKGA 1ZB5A 1K9TA 3KCEA 4WJXA 2WM0A 4P8WA 3B9AA 2XP3A 4TW7A 3WD4A 4WKFA 4P8VA 5HW8A 2MLXA 1E15A 4ODQA 2RQSA 1FKTA 4ODNA 2ZQVA 3CHFA 2WLZA 4QIBA 2FDMA 4JYSA 3UI5A 1JVWA 1Q6HA 2O9OA 3ARPA 3ARZA 4GGQA 2KFWA 3GU0A 1W9PA 1ZU8A 5HKGA 1FAPA 1W1YA 1W9UA 1ZK6A 1ZBKA 4NSBA 3EIPA 3B9DA 1JNTA 2RURA 3B9EA 4ZPWR 2FKEA 3BMBA 1T11A 3TDBA 1FKKA 2F2DA 5D75A 3RMEA 1GPFA 1FFQA 4IQCA 2ZR5A 1HJVA 2DPEA 5JH8A 1OWQA 2F4EA 2PV2A 4IPXA 1VF8A 2WLYA 4DWSB 3PRAA 4GIVA 4UDMA 3H9RB 2MLZA 3OA5A 4Z2JA 5HBFA 2L2SA 1XRVA 1ZBVA 2Q5AA 1TCOC 5HUAA 3AQUA 2XPAA 1Q1CA 3UQBA 4DZ2A 3O5FA 4KQZA 1PINA 1NWRA 1C9HA 1M5YA 3GTYX 1ROTA 1W9VA 3O5KA 4JFKA 5DO2A 1D7IA 2DT2A 4XAKA 2LKNA 3ARQA 1R9HA 3WQWA 1QPFA 4ZPVR 3ARYA 2IUZA 2A3CA 5GQBA 3RM4A 4Z2KA 3ALFA 3IKGA 1ROUA 3G6LA 4MNLA 2PV3A 4BF8A 1FD9A 4Z2LA 3RGCA 4G50A 2N87A 2DSUA 1LL6A 3WQVA 2DT3A 3RFWA 2DT1A 4IT6A 4N19A 1JNSA 1J4IA 4QT3A 1TFVA 1NH6A 2F23A 3BXWA 1LL7A 2XP4A 4J4OA 1NWUA 3EY6A 4Z2HA 3MDYB 2MPHA 1W26A 5DITA 3KZ7A 2PBCA 4G2PA 1W1PA 3KAHA 4IT4A 3NI6A 4PTMA 4L3NA 3WIJA 1ZL1A 4Z2IA 4ODRA 3FXYA 4QT2A 5HW7A 1N1AA 1HKMA 2M1IA 4Z2GA 2DSVA 4DT4A 5HWCA 1E44A 4WKHA 1NSGA 1XHGA 5DIUA 2DSZA 3ARUA 3GPKA 1J6YA 4DRJA 4LAXA 2PI6A 4Q7NA 2XP5A 1A7XA 1NMWA 3PA7A 4ODKA 1SR0A 3UQAA 3JYJA 3CZ8A 4DRPA 1LG1A 2KR7A
chains in the Genus database with same CATH topology
2ZR6A 2UZ5A 3IK8A 4TW8A 2QF8A 2Y78A 2RSEA 1KT0A 1F8AB 2FAPA 4ODLA 1FKJA 4MNMA 3UI6A 2DG3A 2DSWA 3B7XA 2KI3A 1FKBA 1BKFA 3NRKA 1NWSA 4QZVB 4DH0A 4DRKA 4ITZA 5I98A 2IF4A 2MNTA 4HBEA 3VAWA 1WB0A 1E9LA 3ARSA 1D7HA 3WD2A 5J6EA 1FKSA 2LPVA 3CHCA 2OLHA 3O5JA 2WK2A 1X6LA 3O5LA 1J4RA 4C02B 2PPNA 1WNOA 2LGOA 1FKHA 1H0IA 1HJXA 2G41A 1LJYA 1SYTA 4NZCA 3KAIA 2XPBA 4ODMA 1YATA 3WH0A 4MTVA 4LAYA 4S3KA 4WKAA 1YW5A 3NTPA 1ITXA 4HARA 1NMVA 1ZBCA 1H0GA 2B31A 1L1PA 4U85A 3AS0A 5BXJA 1NWTA 2XP8A 2KGJA 2DG4A 3OOBA 1E6ZA 4W9QA 4P8XA 5DIVA 3QOKA 4ODOA 2M08A 2A3BA 2PPPA 2D9FA 4Q22A 1KT1A 2RUCA 3KADA 3WD1A 2KE0A 3KABA 2AOSA 3UQIA 3RM9A 4DRHA 4P8UA 1KFWA 2MLYA 1CTNA 4DRIA 2DG9A 4DWSA 4MNJA 4JFJA 3CH9A 3CGMA 4MAVA 1P5QA 5HT1A 4ODPA 3AS1A 4DROA 3O5GA 4W5UA 1D2KA 2ESCA 2M2AA 4W9PA 1EQ3A 4LAVA 2AWGA 3WD3A 4TX0A 5HWBA 2VCDA 3FY1A 1IX5A 2JZVA 3KACA 3O5DA 2A3EA 4U86A 4ZPTR 1F40A 1E6RA 1JNEA 3ARRA 4O2TA 3RM8A 4HBOA 1Q6UA 1W1TA 3AROA 5GPRA 2LJ4A 1FKIA 3O5IA 4ML4A 3CHDA 1EIBA 2ZQUA 1QZ2A 4L72B 2XP9A 1EDQA 4IQ2A 4JFMA 2ZQSA 1X6NA 1FKFA 1B6CA 3I6CA 1EHNA 2PPOA 3ARVA 1OGGA 3AS2A 3O5OA 3FAPA 2DT0A 2ZR4A 2G8ZA 4U84A 2YBUA 2RUQA 4FN2A 2XP7A 3ARXA 3TC5A 2F21A 2VN1A 1W1VA 1FFRA 1Y0OA 3JXVA 4WIWA 4ZS6A 3JYMA 1FJDA 4DRQA 1UR8A 2OFNA 3O5RA 4R5EA 1OGBA 3G6MA 4LGXA 1ZCNA 3LUOA 1HKKA 3ALGA 3ODKA 2ITKA 4MPKA 1EYMA 1O6IA 2KO7A 3WKZA 4DRNA 2A3AA 3TCZA 4JFLA 4DWSD 1BL4A 2RUDA 4FAPA 3UF8A 1HXVA 1HJWA 1RD6A 1FKRA 4WK9A 3ARTA 3WD0A 2MF9A 4DIPA 5B8IC 2ZQTA 4J4NA 4MSPA 2O92A 2XP6A 4URIA 3O5QA 4DZ3A 2YBTA 1UR9A 4S3JA 3WL0A 4DRMA 4TW6A 5HTGA 4R0XA 1FKLA 3PRBA 2PV1A 3CHEA 5DEZA 1GUVA 1D7JA 3O5EA 1U79A 4LAWA 4KR0B 4DWSC 1Q6IA 5HW6A 3B8SA 1LL4A 5GPGA 3KAFA 3ARWA 1QPLA 3AS3A 3IKDA 4MNKA 1E6PA 3UI4A 3CGNA 1GOIA 5DF0A 3IHZA 4TYOA 1LG2A 1D6OA 1E6NA 1J4HA 4AY1A 1ZBWA 1LQ0A 4NNRA 1FKDA 4W9OA 3WL1A 1HKIA 1PBKA 1WAWA 4TNSA 3O5PA 3O5MA 3W4RA 1HKJA 3PRDA 4JFIA 3KAGA 1JNDA 4MGVA 3PR9A 2K8IA 1FKGA 1ZB5A 1K9TA 3KCEA 4WJXA 2WM0A 4P8WA 3B9AA 2XP3A 4TW7A 3WD4A 4WKFA 4P8VA 5HW8A 2MLXA 1E15A 4ODQA 2RQSA 1FKTA 4ODNA 2ZQVA 3CHFA 2WLZA 4QIBA 2FDMA 4JYSA 3UI5A 1JVWA 1Q6HA 2O9OA 3ARPA 3ARZA 4GGQA 2KFWA 1W9PA 1ZU8A 5HKGA 1FAPA 1W1YA 1W9UA 1ZK6A 1ZBKA 4NSBA 3B9DA 1JNTA 2RURA 3B9EA 4ZPWR 2FKEA 1T11A 3TDBA 1FKKA 2F2DA 5D75A 3RMEA 1GPFA 1FFQA 4IQCA 2ZR5A 1HJVA 2DPEA 5JH8A 1OWQA 2F4EA 2PV2A 4IPXA 1VF8A 2WLYA 4DWSB 3PRAA 4GIVA 3H9RB 2MLZA 3OA5A 4Z2JA 5HBFA 2L2SA 1XRVA 1ZBVA 2Q5AA 1TCOC 5HUAA 3AQUA 2XPAA 1Q1CA 3UQBA 4DZ2A 3O5FA 4KQZA 1PINA 1NWRA 1C9HA 1M5YA 1ROTA 1W9VA 3O5KA 4JFKA 5DO2A 1D7IA 2DT2A 4XAKA 2LKNA 3ARQA 1R9HA 3WQWA 1QPFA 4ZPVR 3ARYA 2IUZA 2A3CA 5GQBA 3RM4A 4Z2KA 3ALFA 3IKGA 1ROUA 3G6LA 4MNLA 2PV3A 4BF8A 1FD9A 4Z2LA 3RGCA 4G50A 2N87A 2DSUA 1LL6A 3WQVA 2DT3A 3RFWA 2DT1A 4IT6A 4N19A 1JNSA 1J4IA 4QT3A 1TFVA 1NH6A 3BXWA 1LL7A 2XP4A 4J4OA 1NWUA 3EY6A 4Z2HA 3MDYB 2MPHA 1W26A 5DITA 3KZ7A 2PBCA 4G2PA 1W1PA 3KAHA 4IT4A 3NI6A 4PTMA 4L3NA 3WIJA 1ZL1A 4Z2IA 4ODRA 3FXYA 4QT2A 5HW7A 1N1AA 1HKMA 2M1IA 4Z2GA 2DSVA 4DT4A 5HWCA 4WKHA 1NSGA 1XHGA 5DIUA 2DSZA 3ARUA 3GPKA 1J6YA 4DRJA 4LAXA 2PI6A 4Q7NA 2XP5A 1A7XA 1NMWA 3PA7A 4ODKA 1SR0A 3UQAA 3JYJA 3CZ8A 4DRPA 1LG1A 2KR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR6 A;  2UZ5 A;  1D7J A;  3O5E A;  3IK8 A;  1U79 A;  4LAW A;  4TW8 A;  2Y78 A;  2L2S A;  1KT0 A;  1F8A B;  2RSE A;  4TX0 A;  2VCD A;  1Q6I A;  2FAP A;  5HWB A;  4ODL A;  2Q5A A;  5HW6 A;  1FKJ A;  2JZV A;  3KAC A;  1TCO C;  3O5D A;  4U86 A;  3UI6 A;  5HUA A;  1F40 A;  2DG3 A;  2XPA A;  1Q1C A;  5GPG A;  3UQB A;  4DZ2 A;  3O5F A;  3B7X A;  3KAF A;  2KI3 A;  1FKB A;  4O2T A;  1BKF A;  1PIN A;  1QPL A;  3NRK A;  1C9H A;  1M5Y A;  3IKD A;  4DH0 A;  4DRK A;  1Q6U A;  4ITZ A;  5I98 A;  2IF4 A;  3UI4 A;  1ROT A;  2MNT A;  2LJ4 A;  3CGN A;  3O5K A;  4JFK A;  1FKI A;  3VAW A;  3IHZ A;  3O5I A;  1D7I A;  4TYO A;  1D6O A;  1J4H A;  2ZQU A;  1D7H A;  2LKN A;  5J6E A;  1FKS A;  1QZ2 A;  1R9H A;  2LPV A;  1QPF A;  4NNR A;  3O5J A;  1FKD A;  2XP9 A;  4IQ2 A;  3O5L A;  4JFM A;  4W9O A;  3H9R B;  1J4R A;  2ZQS A;  3IKG A;  4C02 B;  1PBK A;  1ROU A;  2PPN A;  2LGO A;  1FKH A;  1JNS A;  4TNS A;  3O5P A;  1FKF A;  3O5M A;  2PV3 A;  4BF8 A;  1B6C A;  1FD9 A;  3I6C A;  2PPO A;  3PRD A;  3KAI A;  2XPB A;  4JFI A;  4G50 A;  1YAT A;  3KAG A;  4ODM A;  3RGC A;  2N87 A;  3O5O A;  3WH0 A;  3FAP A;  4LAY A;  4MGV A;  2ZR4 A;  2K8I A;  1FKG A;  4U84 A;  1YW5 A;  3KCE A;  3RFW A;  3NTP A;  2XP3 A;  2RUQ A;  4FN2 A;  1J4I A;  2XP7 A;  4N19 A;  4QT3 A;  4TW7 A;  3TC5 A;  2F21 A;  2VN1 A;  1NMV A;  5HW8 A;  2MLX A;  3JXV A;  1Y0O A;  4ODQ A;  2RQS A;  1L1P A;  1FKT A;  4ODN A;  2XP4 A;  2ZQV A;  4U85 A;  4J4O A;  5BXJ A;  3EY6 A;  3JYM A;  4DRQ A;  3MDY B;  2OFN A;  2XP8 A;  3O5R A;  4QIB A;  2MPH A;  1FJD A;  2KGJ A;  1W26 A;  2DG4 A;  3OOB A;  4JYS A;  4W9Q A;  3UI5 A;  1ZCN A;  3LUO A;  1JVW A;  1Q6H A;  5DIT A;  3KZ7 A;  2PBC A;  4G2P A;  5DIV A;  4GGQ A;  2KFW A;  3ODK A;  4ODO A;  2M08 A;  2ITK A;  3KAH A;  1EYM A;  3NI6 A;  2PPP A;  2D9F A;  5HKG A;  1FAP A;  1KT1 A;  2KO7 A;  1ZK6 A;  2RUC A;  4DRN A;  3TCZ A;  3KAD A;  4JFL A;  2KE0 A;  4ODR A;  1BL4 A;  2RUD A;  3KAB A;  4QT2 A;  3UQI A;  4FAP A;  1JNT A;  1N1A A;  5HW7 A;  3UF8 A;  2M1I A;  1HXV A;  4DRH A;  4DT4 A;  5HWC A;  2RUR A;  2MLY A;  4DRI A;  1FKR A;  1NSG A;  2DG9 A;  2FKE A;  2MF9 A;  5DIU A;  4DIP A;  1T11 A;  5B8I C;  2ZQT A;  4JFJ A;  3TDB A;  3GPK A;  3CGM A;  1P5Q A;  4J4N A;  5HT1 A;  1FKK A;  2F2D A;  4MSP A;  4ODP A;  4DRJ A;  5D75 A;  4DRO A;  3O5G A;  4LAX A;  2XP6 A;  4IQC A;  2XP5 A;  2ZR5 A;  3O5Q A;  1A7X A;  4DZ3 A;  2F4E A;  2PV2 A;  4IPX A;  1NMW A;  3PA7 A;  4ODK A;  4DRM A;  4TW6 A;  5HTG A;  2M2A A;  4R0X A;  3UQA A;  4W9P A;  1FKL A;  3JYJ A;  1J6Y A;  3PRB A;  1EQ3 A;  2PV1 A;  4GIV A;  4LAV A;  4DRP A;  2AWG A;  2KR7 A;  2MLZ A; 
#chains in the Genus database with same CATH topology
 2ZR6 A;  2UZ5 A;  3IK8 A;  4TW8 A;  2QF8 A;  2Y78 A;  2RSE A;  1KT0 A;  1F8A B;  2FAP A;  4ODL A;  1FKJ A;  4MNM A;  3UI6 A;  2DG3 A;  2DSW A;  3B7X A;  2KI3 A;  1FKB A;  1BKF A;  3NRK A;  1NWS A;  4QZV B;  4DH0 A;  4DRK A;  4ITZ A;  5I98 A;  2IF4 A;  2MNT A;  4HBE A;  3VAW A;  1WB0 A;  1E9L A;  3ARS A;  1D7H A;  3WD2 A;  5J6E A;  1FKS A;  2LPV A;  3CHC A;  2OLH A;  3O5J A;  2WK2 A;  1X6L A;  3O5L A;  1J4R A;  4C02 B;  2PPN A;  1WNO A;  2LGO A;  1FKH A;  1H0I A;  1HJX A;  2G41 A;  1LJY A;  1SYT A;  4NZC A;  3KAI A;  2XPB A;  4ODM A;  1YAT A;  3WH0 A;  4MTV A;  4LAY A;  4S3K A;  4WKA A;  1GRJ A;  1YW5 A;  3NTP A;  1ITX A;  4HAR A;  1NMV A;  1ZBC A;  1JCH B;  1H0G A;  2B31 A;  1L1P A;  4U85 A;  3AS0 A;  5BXJ A;  1NWT A;  2XP8 A;  2KGJ A;  2DG4 A;  3OOB A;  1E6Z A;  4W9Q A;  4P8X A;  5DIV A;  3QOK A;  4ODO A;  2M08 A;  2A3B A;  2PPP A;  2D9F A;  4Q22 A;  1KT1 A;  2RUC A;  3KAD A;  3WD1 A;  2KE0 A;  3KAB A;  2AOS A;  3UQI A;  3RM9 A;  4DRH A;  4P8U A;  1KFW A;  2MLY A;  1CTN A;  4DRI A;  2DG9 A;  4DWS A;  4MNJ A;  4JFJ A;  3CH9 A;  3CGM A;  4MAV A;  1P5Q A;  5HT1 A;  4ODP A;  3AS1 A;  4DRO A;  3O5G A;  4W5U A;  1D2K A;  2ESC A;  2M2A A;  4W9P A;  1EQ3 A;  4LAV A;  2AWG A;  3WD3 A;  4TX0 A;  5HWB A;  2VCD A;  3FY1 A;  1IX5 A;  2JZV A;  3KAC A;  3O5D A;  2A3E A;  4U86 A;  4ZPT R;  1F40 A;  1E6R A;  1JNE A;  3ARR A;  4O2T A;  3RM8 A;  4HBO A;  1Q6U A;  1W1T A;  3ARO A;  5GPR A;  2LJ4 A;  1FKI A;  3O5I A;  4ML4 A;  3CHD A;  1EIB A;  2ZQU A;  1QZ2 A;  4L72 B;  2XP9 A;  1EDQ A;  4IQ2 A;  4JFM A;  2ZQS A;  2EUL A;  1X6N A;  1FKF A;  1B6C A;  3I6C A;  1EHN A;  2PPO A;  3ARV A;  1OGG A;  3AS2 A;  3O5O A;  3FAP A;  2DT0 A;  2ZR4 A;  2G8Z A;  4U84 A;  2YBU A;  2RUQ A;  4FN2 A;  2XP7 A;  3ARX A;  3TC5 A;  2F21 A;  2VN1 A;  1W1V A;  1FFR A;  1Y0O A;  3JXV A;  4WIW A;  4ZS6 A;  3JYM A;  1FJD A;  4DRQ A;  2ETN A;  1UR8 A;  2OFN A;  3O5R A;  4R5E A;  1OGB A;  3G6M A;  4LGX A;  1ZCN A;  3LUO A;  1HKK A;  3ALG A;  3ODK A;  2B5U B;  2ITK A;  4MPK A;  1EYM A;  1O6I A;  2KO7 A;  3WKZ A;  4DRN A;  2A3A A;  3TCZ A;  4JFL A;  4DWS D;  1BL4 A;  2RUD A;  4FAP A;  3UF8 A;  1HXV A;  1HJW A;  1RD6 A;  1FKR A;  4WK9 A;  3ART A;  3WD0 A;  2MF9 A;  4DIP A;  5B8I C;  2ZQT A;  4J4N A;  4MSP A;  2O92 A;  2XP6 A;  4URI A;  3O5Q A;  4DZ3 A;  2YBT A;  1UR9 A;  4S3J A;  3WL0 A;  4DRM A;  4TW6 A;  5HTG A;  4R0X A;  1FKL A;  3PRB A;  2PV1 A;  3CHE A;  5DEZ A;  1GUV A;  1D7J A;  3O5E A;  1U79 A;  4LAW A;  4KR0 B;  4DWS C;  1Q6I A;  5HW6 A;  2PN0 A;  3B8S A;  1LL4 A;  5GPG A;  3KAF A;  3ARW A;  1QPL A;  3AS3 A;  3IKD A;  2P4V A;  4MNK A;  1E6P A;  3UI4 A;  3CGN A;  1GOI A;  5DF0 A;  3IHZ A;  4TYO A;  1LG2 A;  1D6O A;  1E6N A;  1J4H A;  4AY1 A;  1ZBW A;  1LQ0 A;  4NNR A;  1FKD A;  4W9O A;  3WL1 A;  1HKI A;  1PBK A;  1WAW A;  4TNS A;  3O5P A;  3O5M A;  3W4R A;  1HKJ A;  3PRD A;  4JFI A;  3KAG A;  1JND A;  4MGV A;  3PR9 A;  2K8I A;  1FKG A;  1ZB5 A;  1K9T A;  3KCE A;  4WJX A;  2WM0 A;  4P8W A;  3B9A A;  2XP3 A;  4TW7 A;  3WD4 A;  4WKF A;  4P8V A;  5HW8 A;  2MLX A;  1E15 A;  4ODQ A;  2RQS A;  1FKT A;  4ODN A;  2ZQV A;  3CHF A;  2WLZ A;  4QIB A;  2FDM A;  4JYS A;  3UI5 A;  1JVW A;  1Q6H A;  2O9O A;  3ARP A;  3ARZ A;  4GGQ A;  2KFW A;  3GU0 A;  1W9P A;  1ZU8 A;  5HKG A;  1FAP A;  1W1Y A;  1W9U A;  1ZK6 A;  1ZBK A;  4NSB A;  3EIP A;  3B9D A;  1JNT A;  2RUR A;  3B9E A;  4ZPW R;  2FKE A;  3BMB A;  1T11 A;  3TDB A;  1FKK A;  2F2D A;  5D75 A;  3RME A;  1GPF A;  1FFQ A;  4IQC A;  2ZR5 A;  1HJV A;  2DPE A;  5JH8 A;  1OWQ A;  2F4E A;  2PV2 A;  4IPX A;  1VF8 A;  2WLY A;  4DWS B;  3PRA A;  4GIV A;  4UDM A;  3H9R B;  2MLZ A;  3OA5 A;  4Z2J A;  5HBF A;  2L2S A;  1XRV A;  1ZBV A;  2Q5A A;  1TCO C;  5HUA A;  3AQU A;  2XPA A;  1Q1C A;  3UQB A;  4DZ2 A;  3O5F A;  4KQZ A;  1PIN A;  1NWR A;  1C9H A;  1M5Y A;  3GTY X;  1ROT A;  1W9V A;  3O5K A;  4JFK A;  5DO2 A;  1D7I A;  2DT2 A;  4XAK A;  2LKN A;  3ARQ A;  1R9H A;  3WQW A;  1QPF A;  4ZPV R;  3ARY A;  2IUZ A;  2A3C A;  5GQB A;  3RM4 A;  4Z2K A;  3ALF A;  3IKG A;  1ROU A;  3G6L A;  4MNL A;  2PV3 A;  4BF8 A;  1FD9 A;  4Z2L A;  3RGC A;  4G50 A;  2N87 A;  2DSU A;  1LL6 A;  3WQV A;  2DT3 A;  3RFW A;  2DT1 A;  4IT6 A;  4N19 A;  1JNS A;  1J4I A;  4QT3 A;  1TFV A;  1NH6 A;  2F23 A;  3BXW A;  1LL7 A;  2XP4 A;  4J4O A;  1NWU A;  3EY6 A;  4Z2H A;  3MDY B;  2MPH A;  1W26 A;  5DIT A;  3KZ7 A;  2PBC A;  4G2P A;  1W1P A;  3KAH A;  4IT4 A;  3NI6 A;  4PTM A;  4L3N A;  3WIJ A;  1ZL1 A;  4Z2I A;  4ODR A;  3FXY A;  4QT2 A;  5HW7 A;  1N1A A;  1HKM A;  2M1I A;  4Z2G A;  2DSV A;  4DT4 A;  5HWC A;  1E44 A;  4WKH A;  1NSG A;  1XHG A;  5DIU A;  2DSZ A;  3ARU A;  3GPK A;  1J6Y A;  4DRJ A;  4LAX A;  2PI6 A;  4Q7N A;  2XP5 A;  1A7X A;  1NMW A;  3PA7 A;  4ODK A;  1SR0 A;  3UQA A;  3JYJ A;  3CZ8 A;  4DRP A;  1LG1 A;  2KR7 A; 
#chains in the Genus database with same CATH homology
 2ZR6 A;  2UZ5 A;  3IK8 A;  4TW8 A;  2QF8 A;  2Y78 A;  2RSE A;  1KT0 A;  1F8A B;  2FAP A;  4ODL A;  1FKJ A;  4MNM A;  3UI6 A;  2DG3 A;  2DSW A;  3B7X A;  2KI3 A;  1FKB A;  1BKF A;  3NRK A;  1NWS A;  4QZV B;  4DH0 A;  4DRK A;  4ITZ A;  5I98 A;  2IF4 A;  2MNT A;  4HBE A;  3VAW A;  1WB0 A;  1E9L A;  3ARS A;  1D7H A;  3WD2 A;  5J6E A;  1FKS A;  2LPV A;  3CHC A;  2OLH A;  3O5J A;  2WK2 A;  1X6L A;  3O5L A;  1J4R A;  4C02 B;  2PPN A;  1WNO A;  2LGO A;  1FKH A;  1H0I A;  1HJX A;  2G41 A;  1LJY A;  1SYT A;  4NZC A;  3KAI A;  2XPB A;  4ODM A;  1YAT A;  3WH0 A;  4MTV A;  4LAY A;  4S3K A;  4WKA A;  1YW5 A;  3NTP A;  1ITX A;  4HAR A;  1NMV A;  1ZBC A;  1H0G A;  2B31 A;  1L1P A;  4U85 A;  3AS0 A;  5BXJ A;  1NWT A;  2XP8 A;  2KGJ A;  2DG4 A;  3OOB A;  1E6Z A;  4W9Q A;  4P8X A;  5DIV A;  3QOK A;  4ODO A;  2M08 A;  2A3B A;  2PPP A;  2D9F A;  4Q22 A;  1KT1 A;  2RUC A;  3KAD A;  3WD1 A;  2KE0 A;  3KAB A;  2AOS A;  3UQI A;  3RM9 A;  4DRH A;  4P8U A;  1KFW A;  2MLY A;  1CTN A;  4DRI A;  2DG9 A;  4DWS A;  4MNJ A;  4JFJ A;  3CH9 A;  3CGM A;  4MAV A;  1P5Q A;  5HT1 A;  4ODP A;  3AS1 A;  4DRO A;  3O5G A;  4W5U A;  1D2K A;  2ESC A;  2M2A A;  4W9P A;  1EQ3 A;  4LAV A;  2AWG A;  3WD3 A;  4TX0 A;  5HWB A;  2VCD A;  3FY1 A;  1IX5 A;  2JZV A;  3KAC A;  3O5D A;  2A3E A;  4U86 A;  4ZPT R;  1F40 A;  1E6R A;  1JNE A;  3ARR A;  4O2T A;  3RM8 A;  4HBO A;  1Q6U A;  1W1T A;  3ARO A;  5GPR A;  2LJ4 A;  1FKI A;  3O5I A;  4ML4 A;  3CHD A;  1EIB A;  2ZQU A;  1QZ2 A;  4L72 B;  2XP9 A;  1EDQ A;  4IQ2 A;  4JFM A;  2ZQS A;  1X6N A;  1FKF A;  1B6C A;  3I6C A;  1EHN A;  2PPO A;  3ARV A;  1OGG A;  3AS2 A;  3O5O A;  3FAP A;  2DT0 A;  2ZR4 A;  2G8Z A;  4U84 A;  2YBU A;  2RUQ A;  4FN2 A;  2XP7 A;  3ARX A;  3TC5 A;  2F21 A;  2VN1 A;  1W1V A;  1FFR A;  1Y0O A;  3JXV A;  4WIW A;  4ZS6 A;  3JYM A;  1FJD A;  4DRQ A;  1UR8 A;  2OFN A;  3O5R A;  4R5E A;  1OGB A;  3G6M A;  4LGX A;  1ZCN A;  3LUO A;  1HKK A;  3ALG A;  3ODK A;  2ITK A;  4MPK A;  1EYM A;  1O6I A;  2KO7 A;  3WKZ A;  4DRN A;  2A3A A;  3TCZ A;  4JFL A;  4DWS D;  1BL4 A;  2RUD A;  4FAP A;  3UF8 A;  1HXV A;  1HJW A;  1RD6 A;  1FKR A;  4WK9 A;  3ART A;  3WD0 A;  2MF9 A;  4DIP A;  5B8I C;  2ZQT A;  4J4N A;  4MSP A;  2O92 A;  2XP6 A;  4URI A;  3O5Q A;  4DZ3 A;  2YBT A;  1UR9 A;  4S3J A;  3WL0 A;  4DRM A;  4TW6 A;  5HTG A;  4R0X A;  1FKL A;  3PRB A;  2PV1 A;  3CHE A;  5DEZ A;  1GUV A;  1D7J A;  3O5E A;  1U79 A;  4LAW A;  4KR0 B;  4DWS C;  1Q6I A;  5HW6 A;  3B8S A;  1LL4 A;  5GPG A;  3KAF A;  3ARW A;  1QPL A;  3AS3 A;  3IKD A;  4MNK A;  1E6P A;  3UI4 A;  3CGN A;  1GOI A;  5DF0 A;  3IHZ A;  4TYO A;  1LG2 A;  1D6O A;  1E6N A;  1J4H A;  4AY1 A;  1ZBW A;  1LQ0 A;  4NNR A;  1FKD A;  4W9O A;  3WL1 A;  1HKI A;  1PBK A;  1WAW A;  4TNS A;  3O5P A;  3O5M A;  3W4R A;  1HKJ A;  3PRD A;  4JFI A;  3KAG A;  1JND A;  4MGV A;  3PR9 A;  2K8I A;  1FKG A;  1ZB5 A;  1K9T A;  3KCE A;  4WJX A;  2WM0 A;  4P8W A;  3B9A A;  2XP3 A;  4TW7 A;  3WD4 A;  4WKF A;  4P8V A;  5HW8 A;  2MLX A;  1E15 A;  4ODQ A;  2RQS A;  1FKT A;  4ODN A;  2ZQV A;  3CHF A;  2WLZ A;  4QIB A;  2FDM A;  4JYS A;  3UI5 A;  1JVW A;  1Q6H A;  2O9O A;  3ARP A;  3ARZ A;  4GGQ A;  2KFW A;  1W9P A;  1ZU8 A;  5HKG A;  1FAP A;  1W1Y A;  1W9U A;  1ZK6 A;  1ZBK A;  4NSB A;  3B9D A;  1JNT A;  2RUR A;  3B9E A;  4ZPW R;  2FKE A;  1T11 A;  3TDB A;  1FKK A;  2F2D A;  5D75 A;  3RME A;  1GPF A;  1FFQ A;  4IQC A;  2ZR5 A;  1HJV A;  2DPE A;  5JH8 A;  1OWQ A;  2F4E A;  2PV2 A;  4IPX A;  1VF8 A;  2WLY A;  4DWS B;  3PRA A;  4GIV A;  3H9R B;  2MLZ A;  3OA5 A;  4Z2J A;  5HBF A;  2L2S A;  1XRV A;  1ZBV A;  2Q5A A;  1TCO C;  5HUA A;  3AQU A;  2XPA A;  1Q1C A;  3UQB A;  4DZ2 A;  3O5F A;  4KQZ A;  1PIN A;  1NWR A;  1C9H A;  1M5Y A;  1ROT A;  1W9V A;  3O5K A;  4JFK A;  5DO2 A;  1D7I A;  2DT2 A;  4XAK A;  2LKN A;  3ARQ A;  1R9H A;  3WQW A;  1QPF A;  4ZPV R;  3ARY A;  2IUZ A;  2A3C A;  5GQB A;  3RM4 A;  4Z2K A;  3ALF A;  3IKG A;  1ROU A;  3G6L A;  4MNL A;  2PV3 A;  4BF8 A;  1FD9 A;  4Z2L A;  3RGC A;  4G50 A;  2N87 A;  2DSU A;  1LL6 A;  3WQV A;  2DT3 A;  3RFW A;  2DT1 A;  4IT6 A;  4N19 A;  1JNS A;  1J4I A;  4QT3 A;  1TFV A;  1NH6 A;  3BXW A;  1LL7 A;  2XP4 A;  4J4O A;  1NWU A;  3EY6 A;  4Z2H A;  3MDY B;  2MPH A;  1W26 A;  5DIT A;  3KZ7 A;  2PBC A;  4G2P A;  1W1P A;  3KAH A;  4IT4 A;  3NI6 A;  4PTM A;  4L3N A;  3WIJ A;  1ZL1 A;  4Z2I A;  4ODR A;  3FXY A;  4QT2 A;  5HW7 A;  1N1A A;  1HKM A;  2M1I A;  4Z2G A;  2DSV A;  4DT4 A;  5HWC A;  4WKH A;  1NSG A;  1XHG A;  5DIU A;  2DSZ A;  3ARU A;  3GPK A;  1J6Y A;  4DRJ A;  4LAX A;  2PI6 A;  4Q7N A;  2XP5 A;  1A7X A;  1NMW A;  3PA7 A;  4ODK A;  1SR0 A;  3UQA A;  3JYJ A;  3CZ8 A;  4DRP A;  1LG1 A;  2KR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...