4JFJA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with compound (1s,6r)-10-(1,3-benzothiazol-6-ylsulfonyl)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfjA00
3EY6A 4TW6A 1TCOC 4ODPA 4TYOA 3KACA 5DIVA 4GGQA 3KZ7A 1FKIA 4NNRA 4ODRA 4DRPA 4TW7A 4W9QA 1J6YA 2XPBA 1FAPA 4J4OA 3B7XA 1FKDA 2PV2A 1YW5A 5HT1A 3WH0A 1FKKA 2VCDA 4ITZA 4J4NA 2KO7A 2RUQA 3VAWA 2MF9A 1FKFA 3KADA 1A7XA 2XP9A 5HUAA 1J4IA 2F21A 2PPOA 2RURA 5HW7A 5D75A 1FKBA 1FKGA 2M2AA 3PRDA 1JNSA 2ZQVA 1D7IA 1D6OA 5GPGA 1F40A 2XPAA 3O5MA 4U85A 1BKFA 4JYSA 4O2TA 2IF4A 2KFWA 3KAGA 3O5JA 3ODKA 4IPXA 4TX0A 2UZ5A 4ODOA 4DRIA 4JFIA 4DRKA 5B8IC 1ROUA 3CGMA 3LUOA 1QPLA 3IK8A 3IKGA 3GPKA 1B6CA 2N87A 1PINA 1QPFA 1C9HA 1J4HA 1FKHA 3KAIA 4LAXA 4TW8A 5DITA 3H9RB 2Y78A 3IHZA 3PRBA 1KT1A 2ZR5A 2MLZA 4JFMA 2L2SA 1D7JA 3UI6A 1ZK6A 2XP8A 3KAFA 2Q5AA 3TCZA 4DRQA 1EYMA 2LGOA 3O5OA 4FAPA 4G50A 1ROTA 2M1IA 2VN1A 4JFLA 2RSEA 2PPNA 2PV1A 1NMVA 3OOBA 1HXVA 2F4EA 5HKGA 1Q6IA 2DG4A 3PA7A 4JFJA 1R9HA 3UQBA 2ZQUA 4IQ2A 2KGJA 2XP7A 2LPVA 1Q6UA 3TDBA 4DRNA 2DG3A 5HW8A 2JZVA 1U79A 1Q1CA 3RGCA 4ODKA 4DRHA 4DRJA 5HW6A 3UI5A 2MPHA 3JXVA 1Y0OA 2RUCA 2ZQSA 3FAPA 3NI6A 4DZ3A 3RFWA 1EQ3A 4W9OA 2PBCA 1M5YA 2FAPA 5HTGA 5HWBA 1D7HA 4QIBA 4DT4A 1JNTA 3I6CA 4DIPA 3IKDA 4DROA 1J4RA 1PBKA 2MLXA 3O5QA 3UF8A 1QZ2A 1T11A 2RUDA 4LAVA 1NMWA 3KABA 1YATA 5BXJA 4G2PA 5J6EA 4U84A 2LKNA 1F8AB 4MSPA 4DH0A 1FKLA 2D9FA 1BL4A 4QT2A 4FN2A 4TNSA 4JFKA 4MGVA 3O5DA 3O5KA 4C02B 4DRMA 3O5LA 2KR7A 4ODNA 2OFNA 2DG9A 2M08A 1FKJA 2MNTA 3JYJA 1KT0A 2FKEA 4ODMA 1FD9A 2XP4A 4DZ2A 1ZCNA 5DIUA 5HWCA 2PV3A 3KAHA 4QT3A 3UQAA 4BF8A 1NSGA 1FKSA 3KCEA 3O5PA 1FKRA 3O5GA 1N1AA 4R0XA 2AWGA 4U86A 2MLYA 1P5QA 2PPPA 3O5EA 4N19A 3UI4A 1L1PA 2XP5A 1FJDA 2XP6A 2RQSA 3O5RA 4IQCA 4ODLA 1FKTA 4GIVA 1JVWA 4LAYA 1W26A 2K8IA 3TC5A 4ODQA 3O5FA 2XP3A 3O5IA 2ZR4A 2LJ4A 4W9PA 5I98A 4LAWA 3JYMA 2ZR6A 2KE0A 3CGNA 2KI3A 2ZQTA 1Q6HA 3UQIA 3NRKA 2ITKA 2F2DA 3NTPA 3MDYB
chains in the Genus database with same CATH superfamily
4ODPA 3WL1A 4GGQA 4NNRA 4DRPA 1KFWA 2XPBA 3ARPA 3B7XA 3BXWA 4P8XA 4WKAA 1W9UA 3KADA 5HUAA 2F21A 2PPOA 2RURA 4DWSD 5HW7A 3WD2A 4QZVB 4ZS6A 3O5MA 5DF0A 1BKFA 2A3AA 1CTNA 4JYSA 4O2TA 4ODOA 1H0IA 1ROUA 3LUOA 3ALGA 3IKGA 3KAIA 4PTMA 1FKHA 1KT1A 2YBUA 3ARTA 4JFMA 1E15A 2L2SA 1E6RA 3W4RA 3TCZA 2DT1A 4Z2IA 3O5OA 4FAPA 2PPNA 3WIJA 1SYTA 1TFVA 1HJXA 2XP7A 2KGJA 1E9LA 2LPVA 4ZPWR 3CHEA 1U79A 4P8VA 1SR0A 4ODKA 4DRHA 1GUVA 2AOSA 4WIWA 3RM8A 2EULA 3RFWA 1M5YA 3CHFA 1ZBKA 2OLHA 3CZ8A 1ZB5A 1E44A 4IT6A 1PBKA 2ESCA 1T11A 3ARXA 4LAVA 3KABA 2PN0A 4NSBA 4TNSA 5HBFA 4W5UA 4ZPVR 4MGVA 3O5DA 3O5KA 4AY1A 2DPEA 4ODNA 2OFNA 2DG9A 2MNTA 1HKKA 1FD9A 4LGXA 4HARA 1NSGA 3O5PA 1W1PA 2AWGA 2PPPA 1GOIA 4N19A 2A3CA 1FJDA 3O5RA 4ODLA 1FKTA 1W26A 3WKZA 4WKHA 3GU0A 5JH8A 4ODQA 4ZPTR 1E6NA 2ZR4A 1HKIA 5I98A 1X6NA 3JYMA 2ZR6A 4LAWA 4L72B 2F2DA 1TCOC 1ZBVA 3KACA 5DIVA 1J6YA 4ODRA 4W9QA 4Q22A 1NWUA 1FKDA 1YW5A 3AS1A 4UDMA 4MNJA 1FKKA 2WK2A 1LL4A 5GPRA 2MF9A 2B31A 1A7XA 1J4IA 1FKBA 1FKGA 2M2AA 1JNSA 2ZQVA 5GPGA 4KR0B 1XHGA 1VF8A 3B9DA 2FDMA 3KAGA 3ARUA 4JFIA 1QPLA 1L1PA 1EDQA 1B6CA 2N87A 3GPKA 4LAXA 1C9HA 5HW6A 3H9RB 3IHZA 3ARYA 1D2KA 4R5EA 3UI6A 3KAFA 2Q5AA 2LGOA 2B5UB 3PRAA 1ZL1A 2VN1A 4JFLA 4P8WA 2YBTA 1NMVA 4MNLA 1HXVA 2F4EA 1Q6IA 2DG4A 1OGBA 3PA7A 4Z2LA 1EHNA 3EIPA 1R9HA 4IQ2A 3UQBA 2DT0A 2IUZA 5GQBA 4DRNA 4HBEA 2DG3A 3PR9A 1Y0OA 2ZQSA 1JNDA 3NI6A 4W9OA 2PBCA 5HWBA 5HTGA 2WM0A 2DSZA 4Z2JA 1W9PA 4DROA 2MLXA 3O5QA 1QZ2A 2RUDA 5BXJA 1FFQA 4U84A 1F8AB 1FKLA 2D9FA 1BL4A 3B9EA 1WAWA 4FN2A 3WD0A 4C02B 3O5LA 3JYJA 1KT0A 3RM9A 1NWTA 1HKMA 2DSVA 4Z2KA 2O92A 2XP4A 1OGGA 3ARVA 1LJYA 2PV3A 3RM4A 1GPFA 4DWSA 3UI4A 2MLYA 3O5EA 2DT2A 2XP5A 3FXYA 4GIVA 2DSUA 3TC5A 1O6IA 4HBOA 2KI3A 3UQIA 2ITKA 1LQ0A 3MDYB 4TW6A 4TYOA 1XRVA 1ZBWA 3B9AA 3KZ7A 3AS2A 3G6MA 5HT1A 4ITZA 4J4NA 2KO7A 2RUQA 3VAWA 1FKFA 2A3EA 5D75A 3PRDA 3ARSA 1D7IA 1D6OA 1JCHB 1UR9A 4U85A 1W9VA 2IF4A 3O5JA 3ODKA 4IPXA 2UZ5A 5B8IC 3CGMA 1PINA 1LG1A 5DITA 2Y78A 1E6ZA 2MLZA 2XP8A 4DRQA 3WQVA 1ROTA 1OWQA 2RSEA 2PV1A 3OOBA 4WJXA 5HKGA 3ARWA 4JFJA 2ZQUA 3TDBA 1Q6UA 5HW8A 2O9OA 4DWSC 2JZVA 1HJVA 1HJWA 4S3KA 4DRJA 3FY1A 2MPHA 1H0GA 3JXVA 1EQ3A 1D7HA 1W1TA 3GTYX 1JNTA 1ZBCA 4DIPA 4DT4A 1LL6A 1J4RA 4IT4A 4MPKA 5J6EA 1NMWA 2P4VA 2F23A 2LKNA 4QT2A 4URIA 4JFKA 4ML4A 4WKFA 4NZCA 1JNEA 1FKJA 4ODMA 3RMEA 1ZCNA 4MTVA 5DIUA 1X6LA 2QF8A 2WLYA 2G41A 4BF8A 1FKRA 1FKSA 3O5GA 1N1AA 4R0XA 4U86A 1P5QA 3BMBA 2XP6A 2RQSA 3B8SA 4IQCA 4LAYA 4P8UA 2K8IA 3CHDA 3O5FA 2XP3A 3OA5A 3CH9A 4S3JA 3ARZA 1NWRA 1W1VA 3EY6A 3WD3A 1FKIA 4TW7A 1FAPA 4J4OA 5DEZA 2PV2A 3WH0A 1HKJA 2VCDA 3AS0A 1LL7A 2XP9A 1WNOA 1FFRA 1F40A 2G8ZA 2DSWA 1E6PA 2KFWA 3WL0A 4TX0A 4DRIA 4DRKA 2A3BA 3IK8A 1QPFA 1UR8A 1J4HA 4TW8A 3PRBA 2ZR5A 4L3NA 2DT3A 1D7JA 1ZK6A 2ETNA 4Q7NA 1EYMA 3G6LA 4G50A 2M1IA 1WB0A 4MNKA 4WK9A 3AQUA 1EIBA 1LG2A 3WQWA 1Q1CA 3RGCA 1NH6A 3UI5A 2RUCA 3FAPA 4DZ3A 1IX5A 2FAPA 4MAVA 4QIBA 3I6CA 3IKDA 3QOKA 5DO2A 3UF8A 1GRJA 1YATA 4G2PA 4MSPA 1ZU8A 3WD4A 4DH0A 1NWSA 3ALFA 3AROA 4XAKA 1ITXA 2WLZA 4DRMA 2PI6A 1RD6A 2KR7A 2M08A 3ARQA 1K9TA 2FKEA 1W1YA 3WD1A 3ARRA 4DZ2A 4Z2GA 3AS3A 5HWCA 3KAHA 4QT3A 3UQAA 3KCEA 4DWSB 1JVWA 4MNMA 3O5IA 4Z2HA 2LJ4A 4W9PA 3CHCA 4KQZA 2KE0A 3CGNA 2ZQTA 1Q6HA 3NRKA 2XPAA 3NTPA
chains in the Genus database with same CATH topology
4ODPA 3WL1A 4GGQA 4NNRA 4DRPA 1KFWA 2XPBA 3ARPA 3B7XA 3BXWA 4P8XA 4WKAA 1W9UA 3KADA 5HUAA 2F21A 2PPOA 2RURA 4DWSD 5HW7A 3WD2A 4QZVB 4ZS6A 3O5MA 5DF0A 1BKFA 2A3AA 1CTNA 4JYSA 4O2TA 4ODOA 1H0IA 1ROUA 3LUOA 3ALGA 3IKGA 3KAIA 4PTMA 1FKHA 1KT1A 2YBUA 3ARTA 4JFMA 1E15A 2L2SA 1E6RA 3W4RA 3TCZA 2DT1A 4Z2IA 3O5OA 4FAPA 2PPNA 3WIJA 1SYTA 1TFVA 1HJXA 2XP7A 2KGJA 1E9LA 2LPVA 4ZPWR 3CHEA 1U79A 4P8VA 1SR0A 4ODKA 4DRHA 1GUVA 2AOSA 4WIWA 3RM8A 3RFWA 1M5YA 3CHFA 1ZBKA 2OLHA 3CZ8A 1ZB5A 4IT6A 1PBKA 2ESCA 1T11A 3ARXA 4LAVA 3KABA 4NSBA 4TNSA 5HBFA 4W5UA 4ZPVR 4MGVA 3O5DA 3O5KA 4AY1A 2DPEA 4ODNA 2OFNA 2DG9A 2MNTA 1HKKA 1FD9A 4LGXA 4HARA 1NSGA 3O5PA 1W1PA 2AWGA 2PPPA 1GOIA 4N19A 2A3CA 1FJDA 3O5RA 4ODLA 1FKTA 1W26A 3WKZA 4WKHA 5JH8A 4ODQA 4ZPTR 1E6NA 2ZR4A 1HKIA 5I98A 1X6NA 3JYMA 2ZR6A 4LAWA 4L72B 2F2DA 1TCOC 1ZBVA 3KACA 5DIVA 1J6YA 4ODRA 4W9QA 4Q22A 1NWUA 1FKDA 1YW5A 3AS1A 5GPRA 4MNJA 1FKKA 2WK2A 1LL4A 2MF9A 2B31A 1A7XA 1J4IA 1FKBA 1FKGA 2M2AA 1JNSA 2ZQVA 5GPGA 4KR0B 1XHGA 1VF8A 3B9DA 2FDMA 3KAGA 3ARUA 4JFIA 1QPLA 1L1PA 1EDQA 1B6CA 2N87A 3GPKA 4LAXA 1C9HA 5HW6A 3H9RB 3IHZA 3ARYA 1D2KA 4R5EA 3UI6A 3KAFA 2Q5AA 2LGOA 3PRAA 1ZL1A 2VN1A 4JFLA 4P8WA 2YBTA 1NMVA 4MNLA 1HXVA 2F4EA 1Q6IA 2DG4A 1OGBA 3PA7A 4Z2LA 1EHNA 1R9HA 4IQ2A 3UQBA 2DT0A 2IUZA 5GQBA 4DRNA 4HBEA 2DG3A 3PR9A 1Y0OA 2ZQSA 1JNDA 3NI6A 4W9OA 2PBCA 5HWBA 5HTGA 2WM0A 2DSZA 4Z2JA 1W9PA 4DROA 2MLXA 3O5QA 1QZ2A 2RUDA 5BXJA 1FFQA 4U84A 1F8AB 1FKLA 2D9FA 1BL4A 3B9EA 1WAWA 4FN2A 3WD0A 4C02B 3O5LA 3JYJA 1KT0A 3RM9A 1NWTA 1HKMA 2DSVA 4Z2KA 2O92A 2XP4A 1OGGA 3ARVA 1LJYA 2PV3A 3RM4A 1GPFA 4DWSA 3UI4A 2MLYA 3O5EA 2DT2A 2XP5A 3FXYA 4GIVA 2DSUA 3TC5A 1O6IA 4HBOA 2KI3A 3UQIA 2ITKA 1LQ0A 3MDYB 4TW6A 4TYOA 1XRVA 1ZBWA 3B9AA 3KZ7A 3AS2A 3G6MA 5HT1A 4ITZA 4J4NA 2KO7A 2RUQA 3VAWA 1FKFA 2A3EA 5D75A 3PRDA 3ARSA 1D7IA 1D6OA 1UR9A 4U85A 1W9VA 2IF4A 3O5JA 3ODKA 4IPXA 2UZ5A 5B8IC 3CGMA 1PINA 1LG1A 5DITA 2Y78A 1E6ZA 2MLZA 2XP8A 4DRQA 3WQVA 1ROTA 1OWQA 2RSEA 2PV1A 3OOBA 4WJXA 5HKGA 3ARWA 4JFJA 2ZQUA 3TDBA 1Q6UA 5HW8A 2O9OA 4DWSC 2JZVA 1HJVA 1HJWA 4S3KA 4DRJA 3FY1A 2MPHA 1H0GA 3JXVA 1EQ3A 1D7HA 1W1TA 4DT4A 1JNTA 1ZBCA 4DIPA 1LL6A 1J4RA 4IT4A 4MPKA 5J6EA 1NMWA 2LKNA 4QT2A 4URIA 4JFKA 4ML4A 4WKFA 4NZCA 1JNEA 1FKJA 4ODMA 3RMEA 1ZCNA 4MTVA 5DIUA 1X6LA 2QF8A 2WLYA 2G41A 4BF8A 1FKRA 1FKSA 3O5GA 1N1AA 4R0XA 4U86A 1P5QA 2XP6A 2RQSA 3B8SA 4IQCA 4LAYA 4P8UA 2K8IA 3CHDA 3O5FA 2XP3A 3OA5A 3CH9A 4S3JA 3ARZA 1NWRA 1W1VA 3EY6A 3WD3A 1FKIA 4TW7A 1FAPA 4J4OA 5DEZA 2PV2A 3WH0A 1HKJA 2VCDA 3AS0A 1LL7A 2XP9A 1WNOA 1FFRA 1F40A 2G8ZA 2DSWA 1E6PA 2KFWA 3WL0A 4TX0A 4DRIA 4DRKA 2A3BA 3IK8A 1QPFA 1UR8A 1J4HA 4TW8A 3PRBA 2ZR5A 4L3NA 2DT3A 1D7JA 1ZK6A 4Q7NA 1EYMA 3G6LA 4G50A 2M1IA 1WB0A 4MNKA 4WK9A 3AQUA 1EIBA 1LG2A 3WQWA 1Q1CA 3RGCA 1NH6A 3UI5A 2RUCA 3FAPA 4DZ3A 1IX5A 2FAPA 4MAVA 4QIBA 3I6CA 3IKDA 3QOKA 5DO2A 3UF8A 1YATA 4G2PA 4MSPA 1ZU8A 3WD4A 4DH0A 1NWSA 3ALFA 3AROA 4XAKA 1ITXA 2WLZA 4DRMA 2PI6A 1RD6A 2KR7A 2M08A 3ARQA 1K9TA 2FKEA 1W1YA 3WD1A 3ARRA 4DZ2A 4Z2GA 3AS3A 5HWCA 3KAHA 4QT3A 3UQAA 3KCEA 4DWSB 1JVWA 4MNMA 3O5IA 4Z2HA 2LJ4A 4W9PA 3CHCA 4KQZA 2KE0A 3CGNA 2ZQTA 1Q6HA 3NRKA 2XPAA 3NTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY6 A;  4TW6 A;  1TCO C;  4ODP A;  4TYO A;  3KAC A;  5DIV A;  4GGQ A;  3KZ7 A;  1FKI A;  4NNR A;  4ODR A;  4DRP A;  4TW7 A;  4W9Q A;  1J6Y A;  2XPB A;  1FAP A;  4J4O A;  3B7X A;  1FKD A;  2PV2 A;  1YW5 A;  5HT1 A;  3WH0 A;  1FKK A;  2VCD A;  4ITZ A;  4J4N A;  2KO7 A;  2RUQ A;  3VAW A;  2MF9 A;  1FKF A;  3KAD A;  1A7X A;  2XP9 A;  5HUA A;  1J4I A;  2F21 A;  2PPO A;  2RUR A;  5HW7 A;  5D75 A;  1FKB A;  1FKG A;  2M2A A;  3PRD A;  1JNS A;  2ZQV A;  1D7I A;  1D6O A;  5GPG A;  1F40 A;  2XPA A;  3O5M A;  4U85 A;  1BKF A;  4JYS A;  4O2T A;  2IF4 A;  2KFW A;  3KAG A;  3O5J A;  3ODK A;  4IPX A;  4TX0 A;  2UZ5 A;  4ODO A;  4DRI A;  4JFI A;  4DRK A;  5B8I C;  1ROU A;  3CGM A;  3LUO A;  1QPL A;  3IK8 A;  3IKG A;  3GPK A;  1B6C A;  2N87 A;  1PIN A;  1QPF A;  1C9H A;  1J4H A;  1FKH A;  3KAI A;  4LAX A;  4TW8 A;  5DIT A;  3H9R B;  2Y78 A;  3IHZ A;  3PRB A;  1KT1 A;  2ZR5 A;  2MLZ A;  4JFM A;  2L2S A;  1D7J A;  3UI6 A;  1ZK6 A;  2XP8 A;  3KAF A;  2Q5A A;  3TCZ A;  4DRQ A;  1EYM A;  2LGO A;  3O5O A;  4FAP A;  4G50 A;  1ROT A;  2M1I A;  2VN1 A;  4JFL A;  2RSE A;  2PPN A;  2PV1 A;  1NMV A;  3OOB A;  1HXV A;  2F4E A;  5HKG A;  1Q6I A;  2DG4 A;  3PA7 A;  4JFJ A;  1R9H A;  3UQB A;  2ZQU A;  4IQ2 A;  2KGJ A;  2XP7 A;  2LPV A;  1Q6U A;  3TDB A;  4DRN A;  2DG3 A;  5HW8 A;  2JZV A;  1U79 A;  1Q1C A;  3RGC A;  4ODK A;  4DRH A;  4DRJ A;  5HW6 A;  3UI5 A;  2MPH A;  3JXV A;  1Y0O A;  2RUC A;  2ZQS A;  3FAP A;  3NI6 A;  4DZ3 A;  3RFW A;  1EQ3 A;  4W9O A;  2PBC A;  1M5Y A;  2FAP A;  5HTG A;  5HWB A;  1D7H A;  4QIB A;  4DT4 A;  1JNT A;  3I6C A;  4DIP A;  3IKD A;  4DRO A;  1J4R A;  1PBK A;  2MLX A;  3O5Q A;  3UF8 A;  1QZ2 A;  1T11 A;  2RUD A;  4LAV A;  1NMW A;  3KAB A;  1YAT A;  5BXJ A;  4G2P A;  5J6E A;  4U84 A;  2LKN A;  1F8A B;  4MSP A;  4DH0 A;  1FKL A;  2D9F A;  1BL4 A;  4QT2 A;  4FN2 A;  4TNS A;  4JFK A;  4MGV A;  3O5D A;  3O5K A;  4C02 B;  4DRM A;  3O5L A;  2KR7 A;  4ODN A;  2OFN A;  2DG9 A;  2M08 A;  1FKJ A;  2MNT A;  3JYJ A;  1KT0 A;  2FKE A;  4ODM A;  1FD9 A;  2XP4 A;  4DZ2 A;  1ZCN A;  5DIU A;  5HWC A;  2PV3 A;  3KAH A;  4QT3 A;  3UQA A;  4BF8 A;  1NSG A;  1FKS A;  3KCE A;  3O5P A;  1FKR A;  3O5G A;  1N1A A;  4R0X A;  2AWG A;  4U86 A;  2MLY A;  1P5Q A;  2PPP A;  3O5E A;  4N19 A;  3UI4 A;  1L1P A;  2XP5 A;  1FJD A;  2XP6 A;  2RQS A;  3O5R A;  4IQC A;  4ODL A;  1FKT A;  4GIV A;  1JVW A;  4LAY A;  1W26 A;  2K8I A;  3TC5 A;  4ODQ A;  3O5F A;  2XP3 A;  3O5I A;  2ZR4 A;  2LJ4 A;  4W9P A;  5I98 A;  4LAW A;  3JYM A;  2ZR6 A;  2KE0 A;  3CGN A;  2KI3 A;  2ZQT A;  1Q6H A;  3UQI A;  3NRK A;  2ITK A;  2F2D A;  3NTP A;  3MDY B; 
#chains in the Genus database with same CATH topology
 4ODP A;  3WL1 A;  4GGQ A;  4NNR A;  4DRP A;  1KFW A;  2XPB A;  3ARP A;  3B7X A;  3BXW A;  4P8X A;  4WKA A;  1W9U A;  3KAD A;  5HUA A;  2F21 A;  2PPO A;  2RUR A;  4DWS D;  5HW7 A;  3WD2 A;  4QZV B;  4ZS6 A;  3O5M A;  5DF0 A;  1BKF A;  2A3A A;  1CTN A;  4JYS A;  4O2T A;  4ODO A;  1H0I A;  1ROU A;  3LUO A;  3ALG A;  3IKG A;  3KAI A;  4PTM A;  1FKH A;  1KT1 A;  2YBU A;  3ART A;  4JFM A;  1E15 A;  2L2S A;  1E6R A;  3W4R A;  3TCZ A;  2DT1 A;  4Z2I A;  3O5O A;  4FAP A;  2PPN A;  3WIJ A;  1SYT A;  1TFV A;  1HJX A;  2XP7 A;  2KGJ A;  1E9L A;  2LPV A;  4ZPW R;  3CHE A;  1U79 A;  4P8V A;  1SR0 A;  4ODK A;  4DRH A;  1GUV A;  2AOS A;  4WIW A;  3RM8 A;  2EUL A;  3RFW A;  1M5Y A;  3CHF A;  1ZBK A;  2OLH A;  3CZ8 A;  1ZB5 A;  1E44 A;  4IT6 A;  1PBK A;  2ESC A;  1T11 A;  3ARX A;  4LAV A;  3KAB A;  2PN0 A;  4NSB A;  4TNS A;  5HBF A;  4W5U A;  4ZPV R;  4MGV A;  3O5D A;  3O5K A;  4AY1 A;  2DPE A;  4ODN A;  2OFN A;  2DG9 A;  2MNT A;  1HKK A;  1FD9 A;  4LGX A;  4HAR A;  1NSG A;  3O5P A;  1W1P A;  2AWG A;  2PPP A;  1GOI A;  4N19 A;  2A3C A;  1FJD A;  3O5R A;  4ODL A;  1FKT A;  1W26 A;  3WKZ A;  4WKH A;  3GU0 A;  5JH8 A;  4ODQ A;  4ZPT R;  1E6N A;  2ZR4 A;  1HKI A;  5I98 A;  1X6N A;  3JYM A;  2ZR6 A;  4LAW A;  4L72 B;  2F2D A;  1TCO C;  1ZBV A;  3KAC A;  5DIV A;  1J6Y A;  4ODR A;  4W9Q A;  4Q22 A;  1NWU A;  1FKD A;  1YW5 A;  3AS1 A;  4UDM A;  4MNJ A;  1FKK A;  2WK2 A;  1LL4 A;  5GPR A;  2MF9 A;  2B31 A;  1A7X A;  1J4I A;  1FKB A;  1FKG A;  2M2A A;  1JNS A;  2ZQV A;  5GPG A;  4KR0 B;  1XHG A;  1VF8 A;  3B9D A;  2FDM A;  3KAG A;  3ARU A;  4JFI A;  1QPL A;  1L1P A;  1EDQ A;  1B6C A;  2N87 A;  3GPK A;  4LAX A;  1C9H A;  5HW6 A;  3H9R B;  3IHZ A;  3ARY A;  1D2K A;  4R5E A;  3UI6 A;  3KAF A;  2Q5A A;  2LGO A;  2B5U B;  3PRA A;  1ZL1 A;  2VN1 A;  4JFL A;  4P8W A;  2YBT A;  1NMV A;  4MNL A;  1HXV A;  2F4E A;  1Q6I A;  2DG4 A;  1OGB A;  3PA7 A;  4Z2L A;  1EHN A;  3EIP A;  1R9H A;  4IQ2 A;  3UQB A;  2DT0 A;  2IUZ A;  5GQB A;  4DRN A;  4HBE A;  2DG3 A;  3PR9 A;  1Y0O A;  2ZQS A;  1JND A;  3NI6 A;  4W9O A;  2PBC A;  5HWB A;  5HTG A;  2WM0 A;  2DSZ A;  4Z2J A;  1W9P A;  4DRO A;  2MLX A;  3O5Q A;  1QZ2 A;  2RUD A;  5BXJ A;  1FFQ A;  4U84 A;  1F8A B;  1FKL A;  2D9F A;  1BL4 A;  3B9E A;  1WAW A;  4FN2 A;  3WD0 A;  4C02 B;  3O5L A;  3JYJ A;  1KT0 A;  3RM9 A;  1NWT A;  1HKM A;  2DSV A;  4Z2K A;  2O92 A;  2XP4 A;  1OGG A;  3ARV A;  1LJY A;  2PV3 A;  3RM4 A;  1GPF A;  4DWS A;  3UI4 A;  2MLY A;  3O5E A;  2DT2 A;  2XP5 A;  3FXY A;  4GIV A;  2DSU A;  3TC5 A;  1O6I A;  4HBO A;  2KI3 A;  3UQI A;  2ITK A;  1LQ0 A;  3MDY B;  4TW6 A;  4TYO A;  1XRV A;  1ZBW A;  3B9A A;  3KZ7 A;  3AS2 A;  3G6M A;  5HT1 A;  4ITZ A;  4J4N A;  2KO7 A;  2RUQ A;  3VAW A;  1FKF A;  2A3E A;  5D75 A;  3PRD A;  3ARS A;  1D7I A;  1D6O A;  1JCH B;  1UR9 A;  4U85 A;  1W9V A;  2IF4 A;  3O5J A;  3ODK A;  4IPX A;  2UZ5 A;  5B8I C;  3CGM A;  1PIN A;  1LG1 A;  5DIT A;  2Y78 A;  1E6Z A;  2MLZ A;  2XP8 A;  4DRQ A;  3WQV A;  1ROT A;  1OWQ A;  2RSE A;  2PV1 A;  3OOB A;  4WJX A;  5HKG A;  3ARW A;  4JFJ A;  2ZQU A;  3TDB A;  1Q6U A;  5HW8 A;  2O9O A;  4DWS C;  2JZV A;  1HJV A;  1HJW A;  4S3K A;  4DRJ A;  3FY1 A;  2MPH A;  1H0G A;  3JXV A;  1EQ3 A;  1D7H A;  1W1T A;  3GTY X;  1JNT A;  1ZBC A;  4DIP A;  4DT4 A;  1LL6 A;  1J4R A;  4IT4 A;  4MPK A;  5J6E A;  1NMW A;  2P4V A;  2F23 A;  2LKN A;  4QT2 A;  4URI A;  4JFK A;  4ML4 A;  4WKF A;  4NZC A;  1JNE A;  1FKJ A;  4ODM A;  3RME A;  1ZCN A;  4MTV A;  5DIU A;  1X6L A;  2QF8 A;  2WLY A;  2G41 A;  4BF8 A;  1FKR A;  1FKS A;  3O5G A;  1N1A A;  4R0X A;  4U86 A;  1P5Q A;  3BMB A;  2XP6 A;  2RQS A;  3B8S A;  4IQC A;  4LAY A;  4P8U A;  2K8I A;  3CHD A;  3O5F A;  2XP3 A;  3OA5 A;  3CH9 A;  4S3J A;  3ARZ A;  1NWR A;  1W1V A;  3EY6 A;  3WD3 A;  1FKI A;  4TW7 A;  1FAP A;  4J4O A;  5DEZ A;  2PV2 A;  3WH0 A;  1HKJ A;  2VCD A;  3AS0 A;  1LL7 A;  2XP9 A;  1WNO A;  1FFR A;  1F40 A;  2G8Z A;  2DSW A;  1E6P A;  2KFW A;  3WL0 A;  4TX0 A;  4DRI A;  4DRK A;  2A3B A;  3IK8 A;  1QPF A;  1UR8 A;  1J4H A;  4TW8 A;  3PRB A;  2ZR5 A;  4L3N A;  2DT3 A;  1D7J A;  1ZK6 A;  2ETN A;  4Q7N A;  1EYM A;  3G6L A;  4G50 A;  2M1I A;  1WB0 A;  4MNK A;  4WK9 A;  3AQU A;  1EIB A;  1LG2 A;  3WQW A;  1Q1C A;  3RGC A;  1NH6 A;  3UI5 A;  2RUC A;  3FAP A;  4DZ3 A;  1IX5 A;  2FAP A;  4MAV A;  4QIB A;  3I6C A;  3IKD A;  3QOK A;  5DO2 A;  3UF8 A;  1GRJ A;  1YAT A;  4G2P A;  4MSP A;  1ZU8 A;  3WD4 A;  4DH0 A;  1NWS A;  3ALF A;  3ARO A;  4XAK A;  1ITX A;  2WLZ A;  4DRM A;  2PI6 A;  1RD6 A;  2KR7 A;  2M08 A;  3ARQ A;  1K9T A;  2FKE A;  1W1Y A;  3WD1 A;  3ARR A;  4DZ2 A;  4Z2G A;  3AS3 A;  5HWC A;  3KAH A;  4QT3 A;  3UQA A;  3KCE A;  4DWS B;  1JVW A;  4MNM A;  3O5I A;  4Z2H A;  2LJ4 A;  4W9P A;  3CHC A;  4KQZ A;  2KE0 A;  3CGN A;  2ZQT A;  1Q6H A;  3NRK A;  2XPA A;  3NTP A; 
#chains in the Genus database with same CATH homology
 4ODP A;  3WL1 A;  4GGQ A;  4NNR A;  4DRP A;  1KFW A;  2XPB A;  3ARP A;  3B7X A;  3BXW A;  4P8X A;  4WKA A;  1W9U A;  3KAD A;  5HUA A;  2F21 A;  2PPO A;  2RUR A;  4DWS D;  5HW7 A;  3WD2 A;  4QZV B;  4ZS6 A;  3O5M A;  5DF0 A;  1BKF A;  2A3A A;  1CTN A;  4JYS A;  4O2T A;  4ODO A;  1H0I A;  1ROU A;  3LUO A;  3ALG A;  3IKG A;  3KAI A;  4PTM A;  1FKH A;  1KT1 A;  2YBU A;  3ART A;  4JFM A;  1E15 A;  2L2S A;  1E6R A;  3W4R A;  3TCZ A;  2DT1 A;  4Z2I A;  3O5O A;  4FAP A;  2PPN A;  3WIJ A;  1SYT A;  1TFV A;  1HJX A;  2XP7 A;  2KGJ A;  1E9L A;  2LPV A;  4ZPW R;  3CHE A;  1U79 A;  4P8V A;  1SR0 A;  4ODK A;  4DRH A;  1GUV A;  2AOS A;  4WIW A;  3RM8 A;  3RFW A;  1M5Y A;  3CHF A;  1ZBK A;  2OLH A;  3CZ8 A;  1ZB5 A;  4IT6 A;  1PBK A;  2ESC A;  1T11 A;  3ARX A;  4LAV A;  3KAB A;  4NSB A;  4TNS A;  5HBF A;  4W5U A;  4ZPV R;  4MGV A;  3O5D A;  3O5K A;  4AY1 A;  2DPE A;  4ODN A;  2OFN A;  2DG9 A;  2MNT A;  1HKK A;  1FD9 A;  4LGX A;  4HAR A;  1NSG A;  3O5P A;  1W1P A;  2AWG A;  2PPP A;  1GOI A;  4N19 A;  2A3C A;  1FJD A;  3O5R A;  4ODL A;  1FKT A;  1W26 A;  3WKZ A;  4WKH A;  5JH8 A;  4ODQ A;  4ZPT R;  1E6N A;  2ZR4 A;  1HKI A;  5I98 A;  1X6N A;  3JYM A;  2ZR6 A;  4LAW A;  4L72 B;  2F2D A;  1TCO C;  1ZBV A;  3KAC A;  5DIV A;  1J6Y A;  4ODR A;  4W9Q A;  4Q22 A;  1NWU A;  1FKD A;  1YW5 A;  3AS1 A;  5GPR A;  4MNJ A;  1FKK A;  2WK2 A;  1LL4 A;  2MF9 A;  2B31 A;  1A7X A;  1J4I A;  1FKB A;  1FKG A;  2M2A A;  1JNS A;  2ZQV A;  5GPG A;  4KR0 B;  1XHG A;  1VF8 A;  3B9D A;  2FDM A;  3KAG A;  3ARU A;  4JFI A;  1QPL A;  1L1P A;  1EDQ A;  1B6C A;  2N87 A;  3GPK A;  4LAX A;  1C9H A;  5HW6 A;  3H9R B;  3IHZ A;  3ARY A;  1D2K A;  4R5E A;  3UI6 A;  3KAF A;  2Q5A A;  2LGO A;  3PRA A;  1ZL1 A;  2VN1 A;  4JFL A;  4P8W A;  2YBT A;  1NMV A;  4MNL A;  1HXV A;  2F4E A;  1Q6I A;  2DG4 A;  1OGB A;  3PA7 A;  4Z2L A;  1EHN A;  1R9H A;  4IQ2 A;  3UQB A;  2DT0 A;  2IUZ A;  5GQB A;  4DRN A;  4HBE A;  2DG3 A;  3PR9 A;  1Y0O A;  2ZQS A;  1JND A;  3NI6 A;  4W9O A;  2PBC A;  5HWB A;  5HTG A;  2WM0 A;  2DSZ A;  4Z2J A;  1W9P A;  4DRO A;  2MLX A;  3O5Q A;  1QZ2 A;  2RUD A;  5BXJ A;  1FFQ A;  4U84 A;  1F8A B;  1FKL A;  2D9F A;  1BL4 A;  3B9E A;  1WAW A;  4FN2 A;  3WD0 A;  4C02 B;  3O5L A;  3JYJ A;  1KT0 A;  3RM9 A;  1NWT A;  1HKM A;  2DSV A;  4Z2K A;  2O92 A;  2XP4 A;  1OGG A;  3ARV A;  1LJY A;  2PV3 A;  3RM4 A;  1GPF A;  4DWS A;  3UI4 A;  2MLY A;  3O5E A;  2DT2 A;  2XP5 A;  3FXY A;  4GIV A;  2DSU A;  3TC5 A;  1O6I A;  4HBO A;  2KI3 A;  3UQI A;  2ITK A;  1LQ0 A;  3MDY B;  4TW6 A;  4TYO A;  1XRV A;  1ZBW A;  3B9A A;  3KZ7 A;  3AS2 A;  3G6M A;  5HT1 A;  4ITZ A;  4J4N A;  2KO7 A;  2RUQ A;  3VAW A;  1FKF A;  2A3E A;  5D75 A;  3PRD A;  3ARS A;  1D7I A;  1D6O A;  1UR9 A;  4U85 A;  1W9V A;  2IF4 A;  3O5J A;  3ODK A;  4IPX A;  2UZ5 A;  5B8I C;  3CGM A;  1PIN A;  1LG1 A;  5DIT A;  2Y78 A;  1E6Z A;  2MLZ A;  2XP8 A;  4DRQ A;  3WQV A;  1ROT A;  1OWQ A;  2RSE A;  2PV1 A;  3OOB A;  4WJX A;  5HKG A;  3ARW A;  4JFJ A;  2ZQU A;  3TDB A;  1Q6U A;  5HW8 A;  2O9O A;  4DWS C;  2JZV A;  1HJV A;  1HJW A;  4S3K A;  4DRJ A;  3FY1 A;  2MPH A;  1H0G A;  3JXV A;  1EQ3 A;  1D7H A;  1W1T A;  4DT4 A;  1JNT A;  1ZBC A;  4DIP A;  1LL6 A;  1J4R A;  4IT4 A;  4MPK A;  5J6E A;  1NMW A;  2LKN A;  4QT2 A;  4URI A;  4JFK A;  4ML4 A;  4WKF A;  4NZC A;  1JNE A;  1FKJ A;  4ODM A;  3RME A;  1ZCN A;  4MTV A;  5DIU A;  1X6L A;  2QF8 A;  2WLY A;  2G41 A;  4BF8 A;  1FKR A;  1FKS A;  3O5G A;  1N1A A;  4R0X A;  4U86 A;  1P5Q A;  2XP6 A;  2RQS A;  3B8S A;  4IQC A;  4LAY A;  4P8U A;  2K8I A;  3CHD A;  3O5F A;  2XP3 A;  3OA5 A;  3CH9 A;  4S3J A;  3ARZ A;  1NWR A;  1W1V A;  3EY6 A;  3WD3 A;  1FKI A;  4TW7 A;  1FAP A;  4J4O A;  5DEZ A;  2PV2 A;  3WH0 A;  1HKJ A;  2VCD A;  3AS0 A;  1LL7 A;  2XP9 A;  1WNO A;  1FFR A;  1F40 A;  2G8Z A;  2DSW A;  1E6P A;  2KFW A;  3WL0 A;  4TX0 A;  4DRI A;  4DRK A;  2A3B A;  3IK8 A;  1QPF A;  1UR8 A;  1J4H A;  4TW8 A;  3PRB A;  2ZR5 A;  4L3N A;  2DT3 A;  1D7J A;  1ZK6 A;  4Q7N A;  1EYM A;  3G6L A;  4G50 A;  2M1I A;  1WB0 A;  4MNK A;  4WK9 A;  3AQU A;  1EIB A;  1LG2 A;  3WQW A;  1Q1C A;  3RGC A;  1NH6 A;  3UI5 A;  2RUC A;  3FAP A;  4DZ3 A;  1IX5 A;  2FAP A;  4MAV A;  4QIB A;  3I6C A;  3IKD A;  3QOK A;  5DO2 A;  3UF8 A;  1YAT A;  4G2P A;  4MSP A;  1ZU8 A;  3WD4 A;  4DH0 A;  1NWS A;  3ALF A;  3ARO A;  4XAK A;  1ITX A;  2WLZ A;  4DRM A;  2PI6 A;  1RD6 A;  2KR7 A;  2M08 A;  3ARQ A;  1K9T A;  2FKE A;  1W1Y A;  3WD1 A;  3ARR A;  4DZ2 A;  4Z2G A;  3AS3 A;  5HWC A;  3KAH A;  4QT3 A;  3UQA A;  3KCE A;  4DWS B;  1JVW A;  4MNM A;  3O5I A;  4Z2H A;  2LJ4 A;  4W9P A;  3CHC A;  4KQZ A;  2KE0 A;  3CGN A;  2ZQT A;  1Q6H A;  3NRK A;  2XPA A;  3NTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...