4JFJA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with compound (1s,6r)-10-(1,3-benzothiazol-6-ylsulfonyl)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfjA00
2M08A 3NI6A 2M2AA 1PINA 2N87A 4U85A 4DRNA 2AWGA 1FJDA 4TX0A 1YW5A 2PV1A 4JFMA 4TW8A 4DRHA 3O5OA 1JNTA 4O2TA 1FAPA 3O5LA 3UF8A 3JYMA 4LAWA 3GPKA 2RSEA 5HT1A 2F2DA 4ODNA 3PA7A 4TNSA 1FKKA 4GIVA 1L1PA 2F21A 2Y78A 4JFKA 3VAWA 4QIBA 4R0XA 1D7IA 2PV3A 4TW6A 4ODQA 5B8IC 3UQAA 3UQBA 1JNSA 5J6EA 1FKJA 2ZR5A 4W9OA 5I98A 2PV2A 2FKEA 3B7XA 1D6OA 1U79A 1EYMA 1C9HA 2K8IA 2UZ5A 2LKNA 2ZQTA 4ODKA 5GPGA 4QT3A 2MLZA 1A7XA 2XP7A 1F8AB 3CGNA 3IKGA 3TC5A 4DT4A 1ROTA 3O5RA 1NMWA 1YATA 3RFWA 3LUOA 1QPLA 2LGOA 1T11A 1Q6UA 1D7HA 1NSGA 3EY6A 1B6CA 1M5YA 3CGMA 1KT0A 3O5MA 4G50A 4N19A 4ODRA 3TDBA 2MLYA 1FKIA 5HW6A 2XP3A 3I6CA 2ITKA 3JXVA 3UQIA 2XP5A 1EQ3A 1FKBA 4IQ2A 2ZR4A 3NRKA 4TW7A 3IKDA 2F4EA 1FKRA 2DG4A 1BL4A 5BXJA 2XP6A 1FD9A 2MLXA 1FKTA 4W9PA 2XP9A 3KAGA 2ZQSA 1KT1A 2KFWA 2VN1A 2KR7A 1PBKA 4W9QA 2MF9A 2MNTA 4JYSA 4DIPA 2XP8A 3MDYB 1Q6HA 4DH0A 4JFIA 2RUCA 1N1AA 1ZK6A 3O5DA 4ITZA 4BF8A 3KCEA 2KO7A 2M1IA 5D75A 3IHZA 3O5IA 4JFJA 4DZ2A 4ODPA 4J4OA 5DIVA 2DG3A 2MPHA 2KGJA 1HXVA 5HUAA 3UI4A 4DRQA 1FKLA 2Q5AA 3O5GA 3UI5A 4IPXA 1W26A 1FKHA 4IQCA 4LAXA 1J4IA 4FN2A 4DRIA 1JVWA 1ZCNA 4FAPA 4DRMA 3ODKA 1FKDA 1QPFA 2L2SA 2JZVA 3O5EA 5DITA 3O5KA 3O5PA 1Q6IA 4DRKA 5HW8A 4QT2A 4TYOA 2D9FA 2PPOA 4MGVA 5DIUA 1F40A 3WH0A 4LAVA 2VCDA 1FKSA 1Q1CA 2LJ4A 3KZ7A 1ROUA 2KI3A 5HTGA 1BKFA 1Y0OA 4NNRA 2XP4A 3KACA 3KABA 3FAPA 3RGCA 1J6YA 2RUQA 4MSPA 4DROA 3O5JA 4U86A 2IF4A 3KAFA 3O5QA 1P5QA 2OFNA 2RURA 3KAIA 2XPBA 4GGQA 5HKGA 4DRJA 4DZ3A 1FKFA 3KADA 2PPNA 5HW7A 4DRPA 1QZ2A 3IK8A 1J4RA 2PBCA 1J4HA 4ODMA 3H9RB 3JYJA 2PPPA 4LAYA 4J4NA 1D7JA 2ZQVA 3NTPA 1FKGA 4ODOA 1NMVA 4U84A 2FAPA 2KE0A 2XPAA 3OOBA 4JFLA 4ODLA 2ZR6A 3UI6A 2LPVA 1TCOC 3PRBA 2ZQUA 4G2PA 5HWBA 2RUDA 3O5FA 3KAHA 3TCZA 5HWCA 2DG9A 4C02B 1R9HA 2RQSA 3PRDA
chains in the Genus database with same CATH superfamily
2M08A 4U85A 1NWTA 2PV1A 4JFMA 1ZBVA 4TW8A 4P8WA 4O2TA 4DWSB 1WNOA 3JYMA 4LAWA 2DT0A 3B9AA 2PN0A 3PA7A 4GIVA 2Y78A 3CHFA 1LG1A 2PV3A 3UQBA 1GRJA 1FKJA 4Z2GA 2UZ5A 2ZQTA 1ZL1A 2DT3A 5GPGA 4QT3A 2MLZA 1F8AB 4DT4A 4PTMA 1ROTA 3FXYA 2LGOA 1D7HA 4R0XA 4N19A 3CGMA 1M5YA 4ODRA 3ARUA 3WKZA 3AS3A 1XHGA 3RM9A 1CTNA 5DEZA 4MAVA 3NRKA 4TW7A 4P8UA 2F4EA 1NWUA 1H0GA 5BXJA 1K9TA 4Z2JA 3RMEA 2ZQSA 1KT1A 1GUVA 2KFWA 2VN1A 4MNLA 4W9QA 2ESCA 4DIPA 3RM8A 1N1AA 4S3KA 3KCEA 2KO7A 2M1IA 4ODPA 2DG3A 2MPHA 5HUAA 1W9UA 4ZPTR 3O5GA 3WD0A 4IPXA 2O92A 4LAXA 1JVWA 1ZCNA 4LGXA 3ODKA 3WH0A 1Q1CA 3KZ7A 3ARRA 1ROUA 2KI3A 4WK9A 1X6NA 1E6PA 4U86A 1LL7A 3KAFA 3KAIA 4GGQA 2DSVA 4HBEA 3JYJA 4L3NA 1D7JA 1SYTA 2ZQVA 1FKGA 4HARA 4U84A 2XPAA 1TCOC 2A3EA 2ZQUA 2RUDA 3ARPA 1E9LA 3CH9A 3WQVA 2DG9A 4NZCA 2O9OA 1ZBKA 3B9DA 3NI6A 1HKKA 1E6NA 1W9VA 2M2AA 4DRNA 2AWGA 1FJDA 1YW5A 2IUZA 1JNTA 1FAPA 3UF8A 1W1PA 5DO2A 2F2DA 4ODNA 4DWSA 3AS1A 4TNSA 2F21A 3UQAA 1JNSA 5J6EA 3B9EA 3BMBA 2PV2A 3CZ8A 1D6OA 1GPFA 2A3AA 2LKNA 1GOIA 1A7XA 1FFRA 3QOKA 1NMWA 1YATA 3RFWA 3WD4A 1T11A 1Q6UA 3O5MA 3TDBA 5HW6A 4R5EA 2MLYA 1FKIA 3ARXA 3UQIA 1LG2A 1ZBCA 3OA5A 3CHDA 2XP5A 1JCHB 4IQ2A 1IX5A 1NH6A 1VF8A 4MNMA 1FD9A 2MLXA 1FKTA 1RD6A 1WB0A 5HBFA 1PBKA 3WD1A 1Q6HA 4JFIA 1UR9A 1ZK6A 4JFJA 4DZ2A 5DIVA 1E6RA 3ARYA 2WK2A 4WKAA 3UI4A 3AS2A 3UI5A 1FKHA 4IQCA 4Z2HA 1J4IA 1SR0A 4DRMA 2L2SA 3O5EA 5DITA 3O5KA 1Q6IA 4ZPVR 4QT2A 2PPOA 5DIUA 1F40A 3ALGA 4LAVA 1ZB5A 2VCDA 4MPKA 4MNJA 3CHEA 1BKFA 1LQ0A 2WM0A 2RUQA 3PRAA 1JNEA 4L72B 4DROA 4AY1A 2IF4A 1P5QA 2XPBA 4HBOA 1FKFA 4WJXA 5HW7A 3WQWA 2G41A 3PR9A 3ARVA 1J4HA 4ODMA 3GU0A 2PPPA 1LL6A 4ODOA 1NMVA 3OOBA 4JFLA 2ZR6A 3UI6A 2QF8A 4KQZA 1R9HA 3PRDA 1EHNA 1PINA 4TX0A 2WLYA 3O5OA 2WLZA 5HT1A 5GQBA 1L1PA 1FKKA 3VAWA 4QIBA 4TW6A 5B8IC 4ODQA 2FKEA 1E15A 1C9HA 2K8IA 1HKJA 2B5UB 3CGNA 3IKGA 3LUOA 3EY6A 1QPLA 1B6CA 2XP3A 3I6CA 3ARSA 3JXVA 1FKBA 3IKDA 1ZU8A 3AQUA 2YBUA 1X6LA 2DG4A 1BL4A 2XP6A 3B8SA 4MTVA 4W9PA 2XP9A 3KAGA 2ETNA 4JYSA 2XP8A 2RUCA 3FY1A 3O5DA 4ITZA 3WD3A 1ITXA 2A3BA 5D75A 3IHZA 3O5IA 4J4OA 2B31A 2KGJA 1NWSA 4DRQA 1FKLA 2Q5AA 1FFQA 4DRIA 4FAPA 1QPFA 2JZVA 3O5PA 1D2KA 1E6ZA 4TYOA 5JH8A 4MGVA 3CHCA 4DWSC 1Y0OA 2XP4A 3WD2A 1EDQA 4P8XA 4UDMA 5GPRA 3FAPA 1J6YA 2DPEA 4NSBA 4QZVB 3BXWA 4Z2KA 2P4VA 3ARWA 4ZS6A 3O5JA 4WKFA 4S3JA 2AOSA 4DWSD 4DRJA 4DZ3A 4DRPA 1QZ2A 1J4RA 2PBCA 1WAWA 1W9PA 5HW8A 2FDMA 4ODLA 4URIA 2LPVA 4ZPWR 3PRBA 3ARZA 1W1YA 3KAHA 4MNKA 1HJWA 1HJVA 4IT4A 2RQSA 1TFVA 4NNRA 4Q22A 2N87A 2A3CA 2F23A 1NWRA 4W5UA 4DRHA 3O5LA 4WKHA 3WIJA 3GPKA 2RSEA 3ALFA 3G6LA 2DSZA 4JFKA 3WL1A 1D7IA 4Z2IA 2DSUA 2ZR5A 4W9OA 5I98A 3B7XA 1U79A 1EYMA 4ODKA 3ARQA 2XP7A 3RM4A 3TC5A 3O5RA 1E44A 1ZBWA 1JNDA 1NSGA 1KT0A 2EULA 4G50A 2ITKA 2G8ZA 1EQ3A 2OLHA 3AS0A 1W1VA 2ZR4A 1FKRA 1OGGA 4IT6A 3GTYX 3WL0A 3G6MA 2KR7A 2MF9A 2MNTA 3MDYB 4DH0A 3AROA 1H0IA 4ML4A 3EIPA 4BF8A 1LJYA 1HXVA 1XRVA 1W26A 4FN2A 1FKDA 4P8VA 1KFWA 4DRKA 1HKIA 2D9FA 1FKSA 2LJ4A 2YBTA 1O6IA 4XAKA 4KR0B 5HTGA 2DSWA 3KACA 3ARTA 3KABA 3RGCA 4Z2LA 4MSPA 3O5QA 2RURA 2OFNA 5DF0A 1HJXA 5HKGA 2DT2A 3KADA 2PPNA 3W4RA 3IK8A 1W1TA 3H9RB 1HKMA 1OWQA 1OGBA 1LL4A 4J4NA 4LAYA 3NTPA 1UR8A 2FAPA 2KE0A 2PI6A 2DT1A 4Q7NA 4G2PA 5HWBA 3O5FA 1EIBA 3TCZA 5HWCA 4C02B 4WIWA
chains in the Genus database with same CATH topology
2M08A 4U85A 1NWTA 2PV1A 4JFMA 1ZBVA 4TW8A 4P8WA 4O2TA 4DWSB 1WNOA 3JYMA 4LAWA 2DT0A 3B9AA 3PA7A 4GIVA 2Y78A 3CHFA 1LG1A 2PV3A 3UQBA 1FKJA 4Z2GA 2UZ5A 2ZQTA 1ZL1A 2DT3A 5GPGA 4QT3A 2MLZA 1F8AB 4DT4A 4PTMA 1ROTA 3FXYA 2LGOA 1D7HA 4R0XA 4N19A 3CGMA 1M5YA 4ODRA 3ARUA 3WKZA 3AS3A 1XHGA 3RM9A 1CTNA 5DEZA 4MAVA 3NRKA 4TW7A 4P8UA 2F4EA 1NWUA 1H0GA 5BXJA 1K9TA 4Z2JA 3RMEA 2ZQSA 1KT1A 1GUVA 2KFWA 2VN1A 4MNLA 4W9QA 2ESCA 4DIPA 3RM8A 1N1AA 4S3KA 3KCEA 2KO7A 2M1IA 4ODPA 2DG3A 2MPHA 5HUAA 1W9UA 4ZPTR 3O5GA 3WD0A 4IPXA 2O92A 4LAXA 1JVWA 1ZCNA 4LGXA 3ODKA 3WH0A 1Q1CA 3KZ7A 3ARRA 1ROUA 2KI3A 4WK9A 1X6NA 1E6PA 4U86A 1LL7A 3KAFA 3KAIA 4GGQA 2DSVA 4HBEA 3JYJA 4L3NA 1D7JA 1SYTA 2ZQVA 1FKGA 4HARA 4U84A 2XPAA 1TCOC 2A3EA 2ZQUA 2RUDA 3ARPA 1E9LA 3CH9A 3WQVA 2DG9A 4NZCA 2O9OA 1ZBKA 3B9DA 3NI6A 1HKKA 1E6NA 1W9VA 2M2AA 4DRNA 2AWGA 1FJDA 1YW5A 2IUZA 1JNTA 1FAPA 3UF8A 1W1PA 5DO2A 2F2DA 4ODNA 4DWSA 3AS1A 4TNSA 2F21A 3UQAA 1JNSA 5J6EA 3B9EA 2PV2A 3CZ8A 1D6OA 1GPFA 2A3AA 2LKNA 1GOIA 1A7XA 1FFRA 3QOKA 1NMWA 1YATA 3RFWA 3WD4A 1T11A 1Q6UA 3O5MA 3TDBA 5HW6A 4R5EA 2MLYA 1FKIA 3ARXA 3UQIA 1LG2A 1ZBCA 3OA5A 3CHDA 2XP5A 4IQ2A 1IX5A 1NH6A 1VF8A 4MNMA 1FD9A 2MLXA 1FKTA 1RD6A 1WB0A 5HBFA 1PBKA 3WD1A 1Q6HA 4JFIA 1UR9A 1ZK6A 4JFJA 4DZ2A 5DIVA 1E6RA 3ARYA 2WK2A 4WKAA 3UI4A 3AS2A 3UI5A 1FKHA 4IQCA 4Z2HA 1J4IA 1SR0A 4DRMA 2L2SA 3O5EA 5DITA 3O5KA 1Q6IA 4ZPVR 4QT2A 2PPOA 5DIUA 1F40A 3ALGA 4LAVA 1ZB5A 2VCDA 4MPKA 4MNJA 3CHEA 1BKFA 1LQ0A 2WM0A 2RUQA 3PRAA 1JNEA 4L72B 4DROA 4AY1A 2IF4A 1P5QA 2XPBA 4HBOA 1FKFA 4WJXA 5HW7A 3WQWA 2G41A 3PR9A 3ARVA 1J4HA 4ODMA 2PPPA 1LL6A 4ODOA 1NMVA 3OOBA 4JFLA 2ZR6A 3UI6A 2QF8A 4KQZA 1R9HA 3PRDA 1EHNA 1PINA 4TX0A 2WLYA 3O5OA 2WLZA 5HT1A 5GQBA 1L1PA 1FKKA 3VAWA 4QIBA 4TW6A 5B8IC 4ODQA 2FKEA 1E15A 1C9HA 2K8IA 1HKJA 3CGNA 3IKGA 3LUOA 3EY6A 1QPLA 1B6CA 2XP3A 3I6CA 3ARSA 3JXVA 1FKBA 3IKDA 1ZU8A 3AQUA 2YBUA 1X6LA 2DG4A 1BL4A 2XP6A 3B8SA 4MTVA 4W9PA 2XP9A 3KAGA 4JYSA 2XP8A 2RUCA 3FY1A 3O5DA 4ITZA 3WD3A 1ITXA 2A3BA 5D75A 3IHZA 3O5IA 4J4OA 2B31A 2KGJA 1NWSA 4DRQA 1FKLA 2Q5AA 1FFQA 4DRIA 4FAPA 1QPFA 2JZVA 3O5PA 1D2KA 1E6ZA 4TYOA 5JH8A 4MGVA 3CHCA 4DWSC 1Y0OA 2XP4A 3WD2A 1EDQA 4P8XA 5GPRA 3FAPA 1J6YA 2DPEA 4NSBA 4QZVB 3BXWA 4Z2KA 3ARWA 4ZS6A 3O5JA 4WKFA 4S3JA 2AOSA 4DWSD 4DRJA 4DZ3A 4DRPA 1QZ2A 1J4RA 2PBCA 1WAWA 1W9PA 5HW8A 2FDMA 4ODLA 4URIA 2LPVA 4ZPWR 3PRBA 3ARZA 1W1YA 3KAHA 4MNKA 1HJWA 1HJVA 4IT4A 2RQSA 1TFVA 4NNRA 4Q22A 2N87A 2A3CA 1NWRA 4W5UA 4DRHA 3O5LA 4WKHA 3WIJA 3GPKA 2RSEA 3ALFA 3G6LA 2DSZA 4JFKA 3WL1A 1D7IA 4Z2IA 2DSUA 2ZR5A 4W9OA 5I98A 3B7XA 1U79A 1EYMA 4ODKA 3ARQA 2XP7A 3RM4A 3TC5A 3O5RA 1ZBWA 1JNDA 1NSGA 1KT0A 4G50A 2ITKA 2G8ZA 1EQ3A 2OLHA 3AS0A 1W1VA 2ZR4A 1FKRA 1OGGA 4IT6A 3WL0A 3G6MA 2KR7A 2MF9A 2MNTA 3MDYB 4DH0A 3AROA 1H0IA 4ML4A 4BF8A 1LJYA 1HXVA 1XRVA 1W26A 4FN2A 1FKDA 4P8VA 1KFWA 4DRKA 1HKIA 2D9FA 1FKSA 2LJ4A 2YBTA 1O6IA 4XAKA 4KR0B 5HTGA 2DSWA 3KACA 3ARTA 3KABA 3RGCA 4Z2LA 4MSPA 3O5QA 2RURA 2OFNA 5DF0A 1HJXA 5HKGA 2DT2A 3KADA 2PPNA 3W4RA 3IK8A 1W1TA 3H9RB 1HKMA 1OWQA 1OGBA 1LL4A 4J4NA 4LAYA 3NTPA 1UR8A 2FAPA 2KE0A 2PI6A 2DT1A 4Q7NA 4G2PA 5HWBA 3O5FA 1EIBA 3TCZA 5HWCA 4C02B 4WIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M08 A;  3NI6 A;  2M2A A;  1PIN A;  2N87 A;  4U85 A;  4DRN A;  2AWG A;  1FJD A;  4TX0 A;  1YW5 A;  2PV1 A;  4JFM A;  4TW8 A;  4DRH A;  3O5O A;  1JNT A;  4O2T A;  1FAP A;  3O5L A;  3UF8 A;  3JYM A;  4LAW A;  3GPK A;  2RSE A;  5HT1 A;  2F2D A;  4ODN A;  3PA7 A;  4TNS A;  1FKK A;  4GIV A;  1L1P A;  2F21 A;  2Y78 A;  4JFK A;  3VAW A;  4QIB A;  4R0X A;  1D7I A;  2PV3 A;  4TW6 A;  4ODQ A;  5B8I C;  3UQA A;  3UQB A;  1JNS A;  5J6E A;  1FKJ A;  2ZR5 A;  4W9O A;  5I98 A;  2PV2 A;  2FKE A;  3B7X A;  1D6O A;  1U79 A;  1EYM A;  1C9H A;  2K8I A;  2UZ5 A;  2LKN A;  2ZQT A;  4ODK A;  5GPG A;  4QT3 A;  2MLZ A;  1A7X A;  2XP7 A;  1F8A B;  3CGN A;  3IKG A;  3TC5 A;  4DT4 A;  1ROT A;  3O5R A;  1NMW A;  1YAT A;  3RFW A;  3LUO A;  1QPL A;  2LGO A;  1T11 A;  1Q6U A;  1D7H A;  1NSG A;  3EY6 A;  1B6C A;  1M5Y A;  3CGM A;  1KT0 A;  3O5M A;  4G50 A;  4N19 A;  4ODR A;  3TDB A;  2MLY A;  1FKI A;  5HW6 A;  2XP3 A;  3I6C A;  2ITK A;  3JXV A;  3UQI A;  2XP5 A;  1EQ3 A;  1FKB A;  4IQ2 A;  2ZR4 A;  3NRK A;  4TW7 A;  3IKD A;  2F4E A;  1FKR A;  2DG4 A;  1BL4 A;  5BXJ A;  2XP6 A;  1FD9 A;  2MLX A;  1FKT A;  4W9P A;  2XP9 A;  3KAG A;  2ZQS A;  1KT1 A;  2KFW A;  2VN1 A;  2KR7 A;  1PBK A;  4W9Q A;  2MF9 A;  2MNT A;  4JYS A;  4DIP A;  2XP8 A;  3MDY B;  1Q6H A;  4DH0 A;  4JFI A;  2RUC A;  1N1A A;  1ZK6 A;  3O5D A;  4ITZ A;  4BF8 A;  3KCE A;  2KO7 A;  2M1I A;  5D75 A;  3IHZ A;  3O5I A;  4JFJ A;  4DZ2 A;  4ODP A;  4J4O A;  5DIV A;  2DG3 A;  2MPH A;  2KGJ A;  1HXV A;  5HUA A;  3UI4 A;  4DRQ A;  1FKL A;  2Q5A A;  3O5G A;  3UI5 A;  4IPX A;  1W26 A;  1FKH A;  4IQC A;  4LAX A;  1J4I A;  4FN2 A;  4DRI A;  1JVW A;  1ZCN A;  4FAP A;  4DRM A;  3ODK A;  1FKD A;  1QPF A;  2L2S A;  2JZV A;  3O5E A;  5DIT A;  3O5K A;  3O5P A;  1Q6I A;  4DRK A;  5HW8 A;  4QT2 A;  4TYO A;  2D9F A;  2PPO A;  4MGV A;  5DIU A;  1F40 A;  3WH0 A;  4LAV A;  2VCD A;  1FKS A;  1Q1C A;  2LJ4 A;  3KZ7 A;  1ROU A;  2KI3 A;  5HTG A;  1BKF A;  1Y0O A;  4NNR A;  2XP4 A;  3KAC A;  3KAB A;  3FAP A;  3RGC A;  1J6Y A;  2RUQ A;  4MSP A;  4DRO A;  3O5J A;  4U86 A;  2IF4 A;  3KAF A;  3O5Q A;  1P5Q A;  2OFN A;  2RUR A;  3KAI A;  2XPB A;  4GGQ A;  5HKG A;  4DRJ A;  4DZ3 A;  1FKF A;  3KAD A;  2PPN A;  5HW7 A;  4DRP A;  1QZ2 A;  3IK8 A;  1J4R A;  2PBC A;  1J4H A;  4ODM A;  3H9R B;  3JYJ A;  2PPP A;  4LAY A;  4J4N A;  1D7J A;  2ZQV A;  3NTP A;  1FKG A;  4ODO A;  1NMV A;  4U84 A;  2FAP A;  2KE0 A;  2XPA A;  3OOB A;  4JFL A;  4ODL A;  2ZR6 A;  3UI6 A;  2LPV A;  1TCO C;  3PRB A;  2ZQU A;  4G2P A;  5HWB A;  2RUD A;  3O5F A;  3KAH A;  3TCZ A;  5HWC A;  2DG9 A;  4C02 B;  1R9H A;  2RQS A;  3PRD A; 
#chains in the Genus database with same CATH topology
 2M08 A;  4U85 A;  1NWT A;  2PV1 A;  4JFM A;  1ZBV A;  4TW8 A;  4P8W A;  4O2T A;  4DWS B;  1WNO A;  3JYM A;  4LAW A;  2DT0 A;  3B9A A;  2PN0 A;  3PA7 A;  4GIV A;  2Y78 A;  3CHF A;  1LG1 A;  2PV3 A;  3UQB A;  1GRJ A;  1FKJ A;  4Z2G A;  2UZ5 A;  2ZQT A;  1ZL1 A;  2DT3 A;  5GPG A;  4QT3 A;  2MLZ A;  1F8A B;  4DT4 A;  4PTM A;  1ROT A;  3FXY A;  2LGO A;  1D7H A;  4R0X A;  4N19 A;  3CGM A;  1M5Y A;  4ODR A;  3ARU A;  3WKZ A;  3AS3 A;  1XHG A;  3RM9 A;  1CTN A;  5DEZ A;  4MAV A;  3NRK A;  4TW7 A;  4P8U A;  2F4E A;  1NWU A;  1H0G A;  5BXJ A;  1K9T A;  4Z2J A;  3RME A;  2ZQS A;  1KT1 A;  1GUV A;  2KFW A;  2VN1 A;  4MNL A;  4W9Q A;  2ESC A;  4DIP A;  3RM8 A;  1N1A A;  4S3K A;  3KCE A;  2KO7 A;  2M1I A;  4ODP A;  2DG3 A;  2MPH A;  5HUA A;  1W9U A;  4ZPT R;  3O5G A;  3WD0 A;  4IPX A;  2O92 A;  4LAX A;  1JVW A;  1ZCN A;  4LGX A;  3ODK A;  3WH0 A;  1Q1C A;  3KZ7 A;  3ARR A;  1ROU A;  2KI3 A;  4WK9 A;  1X6N A;  1E6P A;  4U86 A;  1LL7 A;  3KAF A;  3KAI A;  4GGQ A;  2DSV A;  4HBE A;  3JYJ A;  4L3N A;  1D7J A;  1SYT A;  2ZQV A;  1FKG A;  4HAR A;  4U84 A;  2XPA A;  1TCO C;  2A3E A;  2ZQU A;  2RUD A;  3ARP A;  1E9L A;  3CH9 A;  3WQV A;  2DG9 A;  4NZC A;  2O9O A;  1ZBK A;  3B9D A;  3NI6 A;  1HKK A;  1E6N A;  1W9V A;  2M2A A;  4DRN A;  2AWG A;  1FJD A;  1YW5 A;  2IUZ A;  1JNT A;  1FAP A;  3UF8 A;  1W1P A;  5DO2 A;  2F2D A;  4ODN A;  4DWS A;  3AS1 A;  4TNS A;  2F21 A;  3UQA A;  1JNS A;  5J6E A;  3B9E A;  3BMB A;  2PV2 A;  3CZ8 A;  1D6O A;  1GPF A;  2A3A A;  2LKN A;  1GOI A;  1A7X A;  1FFR A;  3QOK A;  1NMW A;  1YAT A;  3RFW A;  3WD4 A;  1T11 A;  1Q6U A;  3O5M A;  3TDB A;  5HW6 A;  4R5E A;  2MLY A;  1FKI A;  3ARX A;  3UQI A;  1LG2 A;  1ZBC A;  3OA5 A;  3CHD A;  2XP5 A;  1JCH B;  4IQ2 A;  1IX5 A;  1NH6 A;  1VF8 A;  4MNM A;  1FD9 A;  2MLX A;  1FKT A;  1RD6 A;  1WB0 A;  5HBF A;  1PBK A;  3WD1 A;  1Q6H A;  4JFI A;  1UR9 A;  1ZK6 A;  4JFJ A;  4DZ2 A;  5DIV A;  1E6R A;  3ARY A;  2WK2 A;  4WKA A;  3UI4 A;  3AS2 A;  3UI5 A;  1FKH A;  4IQC A;  4Z2H A;  1J4I A;  1SR0 A;  4DRM A;  2L2S A;  3O5E A;  5DIT A;  3O5K A;  1Q6I A;  4ZPV R;  4QT2 A;  2PPO A;  5DIU A;  1F40 A;  3ALG A;  4LAV A;  1ZB5 A;  2VCD A;  4MPK A;  4MNJ A;  3CHE A;  1BKF A;  1LQ0 A;  2WM0 A;  2RUQ A;  3PRA A;  1JNE A;  4L72 B;  4DRO A;  4AY1 A;  2IF4 A;  1P5Q A;  2XPB A;  4HBO A;  1FKF A;  4WJX A;  5HW7 A;  3WQW A;  2G41 A;  3PR9 A;  3ARV A;  1J4H A;  4ODM A;  3GU0 A;  2PPP A;  1LL6 A;  4ODO A;  1NMV A;  3OOB A;  4JFL A;  2ZR6 A;  3UI6 A;  2QF8 A;  4KQZ A;  1R9H A;  3PRD A;  1EHN A;  1PIN A;  4TX0 A;  2WLY A;  3O5O A;  2WLZ A;  5HT1 A;  5GQB A;  1L1P A;  1FKK A;  3VAW A;  4QIB A;  4TW6 A;  5B8I C;  4ODQ A;  2FKE A;  1E15 A;  1C9H A;  2K8I A;  1HKJ A;  2B5U B;  3CGN A;  3IKG A;  3LUO A;  3EY6 A;  1QPL A;  1B6C A;  2XP3 A;  3I6C A;  3ARS A;  3JXV A;  1FKB A;  3IKD A;  1ZU8 A;  3AQU A;  2YBU A;  1X6L A;  2DG4 A;  1BL4 A;  2XP6 A;  3B8S A;  4MTV A;  4W9P A;  2XP9 A;  3KAG A;  2ETN A;  4JYS A;  2XP8 A;  2RUC A;  3FY1 A;  3O5D A;  4ITZ A;  3WD3 A;  1ITX A;  2A3B A;  5D75 A;  3IHZ A;  3O5I A;  4J4O A;  2B31 A;  2KGJ A;  1NWS A;  4DRQ A;  1FKL A;  2Q5A A;  1FFQ A;  4DRI A;  4FAP A;  1QPF A;  2JZV A;  3O5P A;  1D2K A;  1E6Z A;  4TYO A;  5JH8 A;  4MGV A;  3CHC A;  4DWS C;  1Y0O A;  2XP4 A;  3WD2 A;  1EDQ A;  4P8X A;  4UDM A;  5GPR A;  3FAP A;  1J6Y A;  2DPE A;  4NSB A;  4QZV B;  3BXW A;  4Z2K A;  2P4V A;  3ARW A;  4ZS6 A;  3O5J A;  4WKF A;  4S3J A;  2AOS A;  4DWS D;  4DRJ A;  4DZ3 A;  4DRP A;  1QZ2 A;  1J4R A;  2PBC A;  1WAW A;  1W9P A;  5HW8 A;  2FDM A;  4ODL A;  4URI A;  2LPV A;  4ZPW R;  3PRB A;  3ARZ A;  1W1Y A;  3KAH A;  4MNK A;  1HJW A;  1HJV A;  4IT4 A;  2RQS A;  1TFV A;  4NNR A;  4Q22 A;  2N87 A;  2A3C A;  2F23 A;  1NWR A;  4W5U A;  4DRH A;  3O5L A;  4WKH A;  3WIJ A;  3GPK A;  2RSE A;  3ALF A;  3G6L A;  2DSZ A;  4JFK A;  3WL1 A;  1D7I A;  4Z2I A;  2DSU A;  2ZR5 A;  4W9O A;  5I98 A;  3B7X A;  1U79 A;  1EYM A;  4ODK A;  3ARQ A;  2XP7 A;  3RM4 A;  3TC5 A;  3O5R A;  1E44 A;  1ZBW A;  1JND A;  1NSG A;  1KT0 A;  2EUL A;  4G50 A;  2ITK A;  2G8Z A;  1EQ3 A;  2OLH A;  3AS0 A;  1W1V A;  2ZR4 A;  1FKR A;  1OGG A;  4IT6 A;  3GTY X;  3WL0 A;  3G6M A;  2KR7 A;  2MF9 A;  2MNT A;  3MDY B;  4DH0 A;  3ARO A;  1H0I A;  4ML4 A;  3EIP A;  4BF8 A;  1LJY A;  1HXV A;  1XRV A;  1W26 A;  4FN2 A;  1FKD A;  4P8V A;  1KFW A;  4DRK A;  1HKI A;  2D9F A;  1FKS A;  2LJ4 A;  2YBT A;  1O6I A;  4XAK A;  4KR0 B;  5HTG A;  2DSW A;  3KAC A;  3ART A;  3KAB A;  3RGC A;  4Z2L A;  4MSP A;  3O5Q A;  2RUR A;  2OFN A;  5DF0 A;  1HJX A;  5HKG A;  2DT2 A;  3KAD A;  2PPN A;  3W4R A;  3IK8 A;  1W1T A;  3H9R B;  1HKM A;  1OWQ A;  1OGB A;  1LL4 A;  4J4N A;  4LAY A;  3NTP A;  1UR8 A;  2FAP A;  2KE0 A;  2PI6 A;  2DT1 A;  4Q7N A;  4G2P A;  5HWB A;  3O5F A;  1EIB A;  3TCZ A;  5HWC A;  4C02 B;  4WIW A; 
#chains in the Genus database with same CATH homology
 2M08 A;  4U85 A;  1NWT A;  2PV1 A;  4JFM A;  1ZBV A;  4TW8 A;  4P8W A;  4O2T A;  4DWS B;  1WNO A;  3JYM A;  4LAW A;  2DT0 A;  3B9A A;  3PA7 A;  4GIV A;  2Y78 A;  3CHF A;  1LG1 A;  2PV3 A;  3UQB A;  1FKJ A;  4Z2G A;  2UZ5 A;  2ZQT A;  1ZL1 A;  2DT3 A;  5GPG A;  4QT3 A;  2MLZ A;  1F8A B;  4DT4 A;  4PTM A;  1ROT A;  3FXY A;  2LGO A;  1D7H A;  4R0X A;  4N19 A;  3CGM A;  1M5Y A;  4ODR A;  3ARU A;  3WKZ A;  3AS3 A;  1XHG A;  3RM9 A;  1CTN A;  5DEZ A;  4MAV A;  3NRK A;  4TW7 A;  4P8U A;  2F4E A;  1NWU A;  1H0G A;  5BXJ A;  1K9T A;  4Z2J A;  3RME A;  2ZQS A;  1KT1 A;  1GUV A;  2KFW A;  2VN1 A;  4MNL A;  4W9Q A;  2ESC A;  4DIP A;  3RM8 A;  1N1A A;  4S3K A;  3KCE A;  2KO7 A;  2M1I A;  4ODP A;  2DG3 A;  2MPH A;  5HUA A;  1W9U A;  4ZPT R;  3O5G A;  3WD0 A;  4IPX A;  2O92 A;  4LAX A;  1JVW A;  1ZCN A;  4LGX A;  3ODK A;  3WH0 A;  1Q1C A;  3KZ7 A;  3ARR A;  1ROU A;  2KI3 A;  4WK9 A;  1X6N A;  1E6P A;  4U86 A;  1LL7 A;  3KAF A;  3KAI A;  4GGQ A;  2DSV A;  4HBE A;  3JYJ A;  4L3N A;  1D7J A;  1SYT A;  2ZQV A;  1FKG A;  4HAR A;  4U84 A;  2XPA A;  1TCO C;  2A3E A;  2ZQU A;  2RUD A;  3ARP A;  1E9L A;  3CH9 A;  3WQV A;  2DG9 A;  4NZC A;  2O9O A;  1ZBK A;  3B9D A;  3NI6 A;  1HKK A;  1E6N A;  1W9V A;  2M2A A;  4DRN A;  2AWG A;  1FJD A;  1YW5 A;  2IUZ A;  1JNT A;  1FAP A;  3UF8 A;  1W1P A;  5DO2 A;  2F2D A;  4ODN A;  4DWS A;  3AS1 A;  4TNS A;  2F21 A;  3UQA A;  1JNS A;  5J6E A;  3B9E A;  2PV2 A;  3CZ8 A;  1D6O A;  1GPF A;  2A3A A;  2LKN A;  1GOI A;  1A7X A;  1FFR A;  3QOK A;  1NMW A;  1YAT A;  3RFW A;  3WD4 A;  1T11 A;  1Q6U A;  3O5M A;  3TDB A;  5HW6 A;  4R5E A;  2MLY A;  1FKI A;  3ARX A;  3UQI A;  1LG2 A;  1ZBC A;  3OA5 A;  3CHD A;  2XP5 A;  4IQ2 A;  1IX5 A;  1NH6 A;  1VF8 A;  4MNM A;  1FD9 A;  2MLX A;  1FKT A;  1RD6 A;  1WB0 A;  5HBF A;  1PBK A;  3WD1 A;  1Q6H A;  4JFI A;  1UR9 A;  1ZK6 A;  4JFJ A;  4DZ2 A;  5DIV A;  1E6R A;  3ARY A;  2WK2 A;  4WKA A;  3UI4 A;  3AS2 A;  3UI5 A;  1FKH A;  4IQC A;  4Z2H A;  1J4I A;  1SR0 A;  4DRM A;  2L2S A;  3O5E A;  5DIT A;  3O5K A;  1Q6I A;  4ZPV R;  4QT2 A;  2PPO A;  5DIU A;  1F40 A;  3ALG A;  4LAV A;  1ZB5 A;  2VCD A;  4MPK A;  4MNJ A;  3CHE A;  1BKF A;  1LQ0 A;  2WM0 A;  2RUQ A;  3PRA A;  1JNE A;  4L72 B;  4DRO A;  4AY1 A;  2IF4 A;  1P5Q A;  2XPB A;  4HBO A;  1FKF A;  4WJX A;  5HW7 A;  3WQW A;  2G41 A;  3PR9 A;  3ARV A;  1J4H A;  4ODM A;  2PPP A;  1LL6 A;  4ODO A;  1NMV A;  3OOB A;  4JFL A;  2ZR6 A;  3UI6 A;  2QF8 A;  4KQZ A;  1R9H A;  3PRD A;  1EHN A;  1PIN A;  4TX0 A;  2WLY A;  3O5O A;  2WLZ A;  5HT1 A;  5GQB A;  1L1P A;  1FKK A;  3VAW A;  4QIB A;  4TW6 A;  5B8I C;  4ODQ A;  2FKE A;  1E15 A;  1C9H A;  2K8I A;  1HKJ A;  3CGN A;  3IKG A;  3LUO A;  3EY6 A;  1QPL A;  1B6C A;  2XP3 A;  3I6C A;  3ARS A;  3JXV A;  1FKB A;  3IKD A;  1ZU8 A;  3AQU A;  2YBU A;  1X6L A;  2DG4 A;  1BL4 A;  2XP6 A;  3B8S A;  4MTV A;  4W9P A;  2XP9 A;  3KAG A;  4JYS A;  2XP8 A;  2RUC A;  3FY1 A;  3O5D A;  4ITZ A;  3WD3 A;  1ITX A;  2A3B A;  5D75 A;  3IHZ A;  3O5I A;  4J4O A;  2B31 A;  2KGJ A;  1NWS A;  4DRQ A;  1FKL A;  2Q5A A;  1FFQ A;  4DRI A;  4FAP A;  1QPF A;  2JZV A;  3O5P A;  1D2K A;  1E6Z A;  4TYO A;  5JH8 A;  4MGV A;  3CHC A;  4DWS C;  1Y0O A;  2XP4 A;  3WD2 A;  1EDQ A;  4P8X A;  5GPR A;  3FAP A;  1J6Y A;  2DPE A;  4NSB A;  4QZV B;  3BXW A;  4Z2K A;  3ARW A;  4ZS6 A;  3O5J A;  4WKF A;  4S3J A;  2AOS A;  4DWS D;  4DRJ A;  4DZ3 A;  4DRP A;  1QZ2 A;  1J4R A;  2PBC A;  1WAW A;  1W9P A;  5HW8 A;  2FDM A;  4ODL A;  4URI A;  2LPV A;  4ZPW R;  3PRB A;  3ARZ A;  1W1Y A;  3KAH A;  4MNK A;  1HJW A;  1HJV A;  4IT4 A;  2RQS A;  1TFV A;  4NNR A;  4Q22 A;  2N87 A;  2A3C A;  1NWR A;  4W5U A;  4DRH A;  3O5L A;  4WKH A;  3WIJ A;  3GPK A;  2RSE A;  3ALF A;  3G6L A;  2DSZ A;  4JFK A;  3WL1 A;  1D7I A;  4Z2I A;  2DSU A;  2ZR5 A;  4W9O A;  5I98 A;  3B7X A;  1U79 A;  1EYM A;  4ODK A;  3ARQ A;  2XP7 A;  3RM4 A;  3TC5 A;  3O5R A;  1ZBW A;  1JND A;  1NSG A;  1KT0 A;  4G50 A;  2ITK A;  2G8Z A;  1EQ3 A;  2OLH A;  3AS0 A;  1W1V A;  2ZR4 A;  1FKR A;  1OGG A;  4IT6 A;  3WL0 A;  3G6M A;  2KR7 A;  2MF9 A;  2MNT A;  3MDY B;  4DH0 A;  3ARO A;  1H0I A;  4ML4 A;  4BF8 A;  1LJY A;  1HXV A;  1XRV A;  1W26 A;  4FN2 A;  1FKD A;  4P8V A;  1KFW A;  4DRK A;  1HKI A;  2D9F A;  1FKS A;  2LJ4 A;  2YBT A;  1O6I A;  4XAK A;  4KR0 B;  5HTG A;  2DSW A;  3KAC A;  3ART A;  3KAB A;  3RGC A;  4Z2L A;  4MSP A;  3O5Q A;  2RUR A;  2OFN A;  5DF0 A;  1HJX A;  5HKG A;  2DT2 A;  3KAD A;  2PPN A;  3W4R A;  3IK8 A;  1W1T A;  3H9R B;  1HKM A;  1OWQ A;  1OGB A;  1LL4 A;  4J4N A;  4LAY A;  3NTP A;  1UR8 A;  2FAP A;  2KE0 A;  2PI6 A;  2DT1 A;  4Q7N A;  4G2P A;  5HWB A;  3O5F A;  1EIB A;  3TCZ A;  5HWC A;  4C02 B;  4WIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...