4JFJA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with compound (1s,6r)-10-(1,3-benzothiazol-6-ylsulfonyl)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jfjA00
4TNSA 2MLYA 3JXVA 3KZ7A 2LGOA 2RQSA 3O5OA 2RUDA 1ROUA 2ZR4A 2ZQVA 3CGMA 1J4RA 2PBCA 2ZQTA 1NMVA 4DRNA 3IHZA 2K8IA 3KACA 3O5LA 2PPNA 2MLXA 5DIVA 2DG9A 3UQBA 2VCDA 3KAFA 3O5EA 1FKBA 5B8IC 2KR7A 1PBKA 4DZ2A 2MLZA 3UF8A 2OFNA 4IQ2A 2F4EA 4JFLA 4QIBA 4TW6A 1FKKA 4GIVA 1FKIA 1R9HA 1J4IA 4ODPA 2PV3A 5HUAA 2LKNA 2MF9A 5HW8A 2UZ5A 1JNTA 2XP8A 3KAIA 3LUOA 3MDYB 2PV1A 3PRBA 4G2PA 3UI4A 5HWBA 2ITKA 3JYJA 5HW6A 3I6CA 4G50A 1EQ3A 2RUQA 2Y78A 4LAYA 2PPPA 3O5RA 4W9PA 4DIPA 4DROA 1F40A 2MPHA 5GPGA 4TW8A 1NSGA 2DG4A 2IF4A 2KFWA 1D7JA 1P5QA 1F8AB 1ZCNA 2ZQSA 5I98A 2PV2A 3NI6A 5DIUA 3NTPA 1J6YA 4FN2A 3JYMA 1U79A 1N1AA 1FKLA 5HTGA 1W26A 3O5DA 4J4OA 3UQAA 4LAXA 2XP9A 2D9FA 5DITA 2XP3A 4JFKA 4DT4A 3KAHA 1BL4A 4BF8A 2F21A 3VAWA 1Y0OA 1FKHA 2XP7A 1TCOC 1ROTA 2L2SA 1FKJA 4DRKA 5J6EA 4GGQA 3KAGA 1D7HA 2KGJA 1Q6UA 4JYSA 2XP4A 4MSPA 4O2TA 3O5FA 1FKTA 2RSEA 3H9RB 2KO7A 1M5YA 4IQCA 3O5QA 2XPAA 1Q1CA 3O5IA 1D6OA 1EYMA 4J4NA 1B6CA 4LAWA 4TX0A 4DRMA 5HKGA 2ZQUA 2XP5A 2RURA 4MGVA 1FKFA 4JFMA 1KT1A 2AWGA 1Q6IA 4ODKA 4ODOA 4W9OA 3RFWA 4DRPA 3TDBA 4TYOA 5D75A 1QPFA 3TCZA 2KI3A 4ODQA 2M08A 1YATA 2Q5AA 2RUCA 4ODNA 2F2DA 1JNSA 4DZ3A 1QPLA 3KCEA 3O5GA 4N19A 1D7IA 3IKDA 5HT1A 4FAPA 4IPXA 2PPOA 2VN1A 3O5JA 5BXJA 1T11A 2KE0A 2XP6A 4C02B 3O5MA 2XPBA 3ODKA 1QZ2A 1ZK6A 1JVWA 3PA7A 1FKSA 3UI6A 2FKEA 1L1PA 4DRQA 3NRKA 4ODMA 2ZR6A 4W9QA 4U84A 2M2AA 2MNTA 4U85A 4ODRA 3UI5A 4DRHA 1J4HA 4QT3A 2JZVA 3IKGA 4JFIA 5HWCA 3EY6A 4NNRA 3PRDA 1NMWA 1YW5A 3GPKA 1A7XA 1C9HA 1FD9A 3CGNA 4ODLA 1FKDA 3KABA 4TW7A 3TC5A 4ITZA 1FKGA 5HW7A 1FKRA 1Q6HA 3OOBA 2N87A 2M1IA 3B7XA 4QT2A 4DRJA 2LPVA 3O5KA 4R0XA 4U86A 1HXVA 3RGCA 1FJDA 4DRIA 1FAPA 3O5PA 3IK8A 3FAPA 3WH0A 2DG3A 1PINA 3KADA 2ZR5A 1KT0A 2FAPA 4JFJA 3UQIA 4LAVA 2LJ4A 4DH0A 1BKFA
chains in the Genus database with same CATH superfamily
4TNSA 3JXVA 3RMEA 4NSBA 1ROUA 2ZR4A 4DRNA 2ZQTA 1NMVA 1JCHB 3IHZA 3BXWA 2KR7A 1ZBWA 4DZ2A 2OFNA 4WJXA 1FKIA 4ODPA 3B9DA 5HW8A 1ZU8A 3LUOA 4G2PA 3B9EA 4G50A 2RUQA 4DROA 1FFRA 4S3KA 2PN0A 1D7JA 1ZCNA 2O9OA 2OLHA 5GQBA 1KFWA 1W9PA 3UQAA 2XP3A 3KAHA 3B8SA 1ROTA 2L2SA 3KAGA 2PI6A 4MNKA 2KGJA 4JYSA 3O5FA 1FKTA 3WD4A 4DRMA 2DSWA 1B6CA 4QZVB 2RURA 4JFMA 4ODOA 4W9OA 1EIBA 1GRJA 5DEZA 3TCZA 4ODQA 4AY1A 4ZPVR 1QPLA 4MTVA 4FAPA 1WB0A 2PPOA 5BXJA 2KE0A 1QZ2A 1ZK6A 3PA7A 1FKSA 3ARPA 3UI6A 2B5UB 1L1PA 5HBFA 4URIA 2M2AA 4WKAA 4XAKA 1W1YA 3UI5A 4JFIA 4NNRA 4DWSC 1YW5A 3GPKA 4TW7A 4Z2LA 1FD9A 3TC5A 1FKDA 3KABA 2DSUA 1WAWA 3OOBA 3ARVA 3AS0A 2LPVA 3CHEA 3O5KA 3ARSA 4U86A 3WH0A 1VF8A 3IK8A 4R5EA 2ZR5A 2DT1A 2G8ZA 1FKRA 3KZ7A 1JNDA 2LGOA 4MPKA 2RUDA 2ZQVA 3CGMA 2PBCA 3GTYX 4IT6A 1EHNA 1IX5A 1ZL1A 4P8UA 3KACA 2A3AA 2DG9A 2VCDA 3B9AA 3UF8A 4JFLA 2F4EA 1FKKA 5HUAA 1HJWA 3KAIA 3MDYB 1LG1A 3UI4A 4HBEA 2A3EA 5HWBA 1OGBA 3ARWA 3OA5A 3RM8A 4LAYA 1LQ0A 4W9PA 1NWSA 4TW8A 3WD0A 2DG4A 2IF4A 3WIJA 4Z2IA 5I98A 5DIUA 1LL6A 3AS1A 4Z2KA 3W4RA 1J6YA 1N1AA 3O5DA 4J4OA 3RM9A 2XP9A 4WKFA 1BL4A 4BF8A 2F21A 4GGQA 1X6LA 3WQWA 4O2TA 1M5YA 2XPAA 1Q1CA 4TX0A 4LAWA 1NWRA 4Q22A 5HKGA 1HKKA 1FKFA 3RFWA 1KT1A 2AWGA 4ODKA 1X6NA 4TYOA 5D75A 1QPFA 2KI3A 2YBTA 2Q5AA 3WD3A 2F2DA 4N19A 1SR0A 1ZBCA 3IKDA 1XRVA 1E9LA 4IPXA 2VN1A 2XP6A 4C02B 2AOSA 2XPBA 2G41A 2WLZA 1UR8A 4P8XA 3CZ8A 1E6NA 2FKEA 5JH8A 4DWSB 4U84A 3CHDA 4DWSD 4DRHA 2YBUA 3EY6A 1C9HA 1JNEA 1W9VA 1Q6HA 4LGXA 2N87A 1SYTA 4DRJA 1HXVA 4DRIA 4DWSA 1FAPA 2P4VA 1KT0A 2FAPA 4L3NA 3FXYA 2MLYA 4IT4A 1ZBVA 3O5OA 1J4RA 1H0GA 1W1TA 1XHGA 4HARA 1CTNA 2DT3A 2K8IA 4S3JA 5DIVA 3O5EA 5B8IC 2QF8A 3CHFA 1PBKA 2ETNA 2MLZA 4IQ2A 4QIBA 3ALGA 4TW6A 3BMBA 4GIVA 1LG2A 1R9HA 3ARQA 2UZ5A 1JNTA 1FFQA 4L72B 3CH9A 2ITKA 3JYJA 5GPRA 1EQ3A 1E44A 1E6ZA 4P8WA 2PPPA 3WQVA 1NSGA 4ZPTR 2KFWA 2F23A 2WK2A 2B31A 1P5QA 2PV2A 3CHCA 1LJYA 3NTPA 4PTMA 4FN2A 1U79A 2WM0A 1D2KA 3GU0A 4WK9A 2DT2A 4JFKA 1HJVA 4DT4A 1GPFA 4W5UA 1RD6A 2FDMA 1Y0OA 2XP7A 1TCOC 1FKJA 1EDQA 4Z2JA 1Q6UA 2XP4A 4MSPA 2RSEA 3H9RB 4IQCA 5DF0A 3O5QA 1LL4A 3O5IA 1D6OA 4J4NA 4KR0B 1ITXA 2ZQUA 4DRPA 1GOIA 1NWUA 3TDBA 1JNSA 1OGGA 1YATA 2RUCA 4ODNA 3KCEA 5HT1A 3EIPA 3O5JA 1T11A 3O5MA 3ODKA 3FY1A 1JVWA 3QOKA 1E6RA 3NRKA 2WLYA 2O92A 2ZR6A 4W9QA 4ZPWR 4U85A 3ALFA 4ODRA 1TFVA 4QT3A 1NH6A 2JZVA 4Z2GA 3ARUA 1W1PA 3PRDA 1A7XA 4ODLA 3CGNA 4ITZA 4ZS6A 3B7XA 1ZB5A 4QT2A 2ESCA 4R0XA 3RGCA 1FJDA 3FAPA 1PINA 1K9TA 4JFJA 2A3BA 2LJ4A 1BKFA 2RQSA 4P8VA 1E15A 3O5LA 2PPNA 2MLXA 1W9UA 3UQBA 4UDMA 3KAFA 1FKBA 1WNOA 4ML4A 3AS2A 3AS3A 1J4IA 3ARRA 2PV3A 3ARYA 5DO2A 2LKNA 2MF9A 3PRAA 2XP8A 2PV1A 3PRBA 3WD2A 5HW6A 3I6CA 2EULA 2DPEA 2Y78A 1LL7A 3O5RA 1F40A 4DIPA 2MPHA 5GPGA 1HKMA 1F8AB 2ZQSA 3NI6A 3AQUA 4MAVA 1HKIA 3JYMA 5HTGA 1FKLA 1W26A 4Q7NA 4LAXA 1E6PA 1NWTA 3RM4A 2D9FA 5DITA 4Z2HA 1W1VA 1OWQA 3VAWA 2DSZA 1FKHA 2IUZA 4DRKA 3G6MA 5J6EA 1D7HA 4MNLA 2KO7A 2DT0A 1EYMA 2XP5A 4MGVA 3WL0A 1Q6IA 1UR9A 2A3CA 4WKHA 2M08A 4DZ3A 3O5GA 3ARTA 1D7IA 2DSVA 3ARXA 4MNJA 3AROA 3WD1A 3G6LA 4DRQA 1O6IA 4ODMA 2MNTA 3PR9A 3WKZA 3ARZA 1J4HA 1H0IA 3IKGA 5HWCA 4MNMA 1NMWA 4NZCA 3WL1A 1HJXA 5HW7A 1FKGA 4HBOA 2M1IA 4KQZA 1ZBKA 3O5PA 2DG3A 3KADA 4WIWA 3UQIA 4LAVA 1HKJA 4DH0A 1GUVA
chains in the Genus database with same CATH topology
4TNSA 3JXVA 3RMEA 4NSBA 1ROUA 2ZR4A 4DRNA 2ZQTA 1NMVA 3IHZA 3BXWA 2KR7A 1ZBWA 4DZ2A 2OFNA 4WJXA 1FKIA 4ODPA 3B9DA 5HW8A 1ZU8A 3LUOA 4G2PA 3B9EA 4G50A 2RUQA 4DROA 1FFRA 4S3KA 1D7JA 1ZCNA 2O9OA 2OLHA 5GQBA 1KFWA 1W9PA 3UQAA 2XP3A 3KAHA 3B8SA 1ROTA 2L2SA 3KAGA 2PI6A 4MNKA 2KGJA 4JYSA 3O5FA 1FKTA 3WD4A 4DRMA 2DSWA 1B6CA 4QZVB 2RURA 4JFMA 4ODOA 4W9OA 1EIBA 5DEZA 3TCZA 4ODQA 4AY1A 4ZPVR 1QPLA 4MTVA 4FAPA 1WB0A 2PPOA 5BXJA 2KE0A 1QZ2A 1ZK6A 3PA7A 1FKSA 3ARPA 3UI6A 1L1PA 5HBFA 4URIA 2M2AA 4WKAA 4XAKA 1W1YA 3UI5A 4JFIA 4NNRA 4DWSC 1YW5A 3GPKA 4TW7A 4Z2LA 1FD9A 3TC5A 1FKDA 3KABA 2DSUA 1WAWA 3OOBA 3ARVA 3AS0A 2LPVA 3CHEA 3O5KA 3ARSA 4U86A 3WH0A 1VF8A 3IK8A 4R5EA 2ZR5A 2DT1A 2G8ZA 1FKRA 3KZ7A 1JNDA 2LGOA 4MPKA 2RUDA 2ZQVA 3CGMA 2PBCA 4IT6A 1EHNA 1IX5A 1ZL1A 4P8UA 3KACA 2A3AA 2DG9A 2VCDA 3B9AA 3UF8A 4JFLA 2F4EA 1FKKA 5HUAA 1HJWA 3KAIA 3MDYB 1LG1A 3UI4A 4HBEA 2A3EA 5HWBA 1OGBA 3ARWA 3OA5A 3RM8A 4LAYA 1LQ0A 4W9PA 1NWSA 4TW8A 3WD0A 2DG4A 2IF4A 3WIJA 4Z2IA 5I98A 5DIUA 1LL6A 3AS1A 4Z2KA 3W4RA 1J6YA 1N1AA 3O5DA 4J4OA 3RM9A 2XP9A 4WKFA 1BL4A 4BF8A 2F21A 4GGQA 1X6LA 3WQWA 4O2TA 1M5YA 2XPAA 1Q1CA 4TX0A 4LAWA 1NWRA 4Q22A 5HKGA 1HKKA 1FKFA 3RFWA 1KT1A 2AWGA 4ODKA 1X6NA 4TYOA 5D75A 1QPFA 2KI3A 2YBTA 2Q5AA 3WD3A 2F2DA 4N19A 1SR0A 1ZBCA 3IKDA 1XRVA 1E9LA 4IPXA 2VN1A 2XP6A 4C02B 2AOSA 2XPBA 2G41A 2WLZA 1UR8A 4P8XA 3CZ8A 1E6NA 2FKEA 5JH8A 4DWSB 4U84A 3CHDA 4DWSD 4DRHA 2YBUA 3EY6A 1C9HA 1JNEA 1W9VA 1Q6HA 4LGXA 2N87A 1SYTA 4DRJA 1HXVA 4DRIA 4DWSA 1FAPA 1KT0A 2FAPA 4L3NA 3FXYA 2MLYA 4IT4A 1ZBVA 3O5OA 1J4RA 1H0GA 1W1TA 1XHGA 4HARA 1CTNA 2DT3A 2K8IA 4S3JA 5DIVA 3O5EA 5B8IC 2QF8A 3CHFA 1PBKA 2MLZA 4IQ2A 4QIBA 3ALGA 4TW6A 4GIVA 1LG2A 1R9HA 3ARQA 2UZ5A 1JNTA 1FFQA 4L72B 3CH9A 2ITKA 3JYJA 5GPRA 1EQ3A 1E6ZA 4P8WA 2PPPA 3WQVA 1NSGA 4ZPTR 2KFWA 2WK2A 2B31A 1P5QA 2PV2A 3CHCA 1LJYA 3NTPA 4PTMA 4FN2A 1U79A 2WM0A 1D2KA 4WK9A 2DT2A 4JFKA 1HJVA 4DT4A 1GPFA 4W5UA 1RD6A 2FDMA 1Y0OA 2XP7A 1TCOC 1FKJA 1EDQA 4Z2JA 1Q6UA 2XP4A 4MSPA 2RSEA 3H9RB 4IQCA 5DF0A 3O5QA 1LL4A 3O5IA 1D6OA 4J4NA 4KR0B 1ITXA 2ZQUA 4DRPA 1GOIA 1NWUA 3TDBA 1JNSA 1OGGA 1YATA 2RUCA 4ODNA 3KCEA 5HT1A 3O5JA 1T11A 3O5MA 3ODKA 3FY1A 1JVWA 3QOKA 1E6RA 3NRKA 2WLYA 2O92A 2ZR6A 4W9QA 4ZPWR 4U85A 3ALFA 4ODRA 1TFVA 4QT3A 1NH6A 2JZVA 4Z2GA 3ARUA 1W1PA 3PRDA 1A7XA 4ODLA 3CGNA 4ITZA 4ZS6A 3B7XA 1ZB5A 4QT2A 2ESCA 4R0XA 3RGCA 1FJDA 3FAPA 1PINA 1K9TA 4JFJA 2A3BA 2LJ4A 1BKFA 2RQSA 4P8VA 1E15A 3O5LA 2PPNA 2MLXA 1W9UA 3UQBA 3KAFA 1FKBA 1WNOA 4ML4A 3AS2A 3AS3A 1J4IA 3ARRA 2PV3A 3ARYA 5DO2A 2LKNA 2MF9A 3PRAA 2XP8A 2PV1A 3PRBA 3WD2A 5HW6A 3I6CA 2DPEA 2Y78A 1LL7A 3O5RA 1F40A 4DIPA 2MPHA 5GPGA 1HKMA 1F8AB 2ZQSA 3NI6A 3AQUA 4MAVA 1HKIA 3JYMA 5HTGA 1FKLA 1W26A 4Q7NA 4LAXA 1E6PA 1NWTA 3RM4A 2D9FA 5DITA 4Z2HA 1W1VA 1OWQA 3VAWA 2DSZA 1FKHA 2IUZA 4DRKA 3G6MA 5J6EA 1D7HA 4MNLA 2KO7A 2DT0A 1EYMA 2XP5A 4MGVA 3WL0A 1Q6IA 1UR9A 2A3CA 4WKHA 2M08A 4DZ3A 3O5GA 3ARTA 1D7IA 2DSVA 3ARXA 4MNJA 3AROA 3WD1A 3G6LA 4DRQA 1O6IA 4ODMA 2MNTA 3PR9A 3WKZA 3ARZA 1J4HA 1H0IA 3IKGA 5HWCA 4MNMA 1NMWA 4NZCA 3WL1A 1HJXA 5HW7A 1FKGA 4HBOA 2M1IA 4KQZA 1ZBKA 3O5PA 2DG3A 3KADA 4WIWA 3UQIA 4LAVA 1HKJA 4DH0A 1GUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TNS A;  2MLY A;  3JXV A;  3KZ7 A;  2LGO A;  2RQS A;  3O5O A;  2RUD A;  1ROU A;  2ZR4 A;  2ZQV A;  3CGM A;  1J4R A;  2PBC A;  2ZQT A;  1NMV A;  4DRN A;  3IHZ A;  2K8I A;  3KAC A;  3O5L A;  2PPN A;  2MLX A;  5DIV A;  2DG9 A;  3UQB A;  2VCD A;  3KAF A;  3O5E A;  1FKB A;  5B8I C;  2KR7 A;  1PBK A;  4DZ2 A;  2MLZ A;  3UF8 A;  2OFN A;  4IQ2 A;  2F4E A;  4JFL A;  4QIB A;  4TW6 A;  1FKK A;  4GIV A;  1FKI A;  1R9H A;  1J4I A;  4ODP A;  2PV3 A;  5HUA A;  2LKN A;  2MF9 A;  5HW8 A;  2UZ5 A;  1JNT A;  2XP8 A;  3KAI A;  3LUO A;  3MDY B;  2PV1 A;  3PRB A;  4G2P A;  3UI4 A;  5HWB A;  2ITK A;  3JYJ A;  5HW6 A;  3I6C A;  4G50 A;  1EQ3 A;  2RUQ A;  2Y78 A;  4LAY A;  2PPP A;  3O5R A;  4W9P A;  4DIP A;  4DRO A;  1F40 A;  2MPH A;  5GPG A;  4TW8 A;  1NSG A;  2DG4 A;  2IF4 A;  2KFW A;  1D7J A;  1P5Q A;  1F8A B;  1ZCN A;  2ZQS A;  5I98 A;  2PV2 A;  3NI6 A;  5DIU A;  3NTP A;  1J6Y A;  4FN2 A;  3JYM A;  1U79 A;  1N1A A;  1FKL A;  5HTG A;  1W26 A;  3O5D A;  4J4O A;  3UQA A;  4LAX A;  2XP9 A;  2D9F A;  5DIT A;  2XP3 A;  4JFK A;  4DT4 A;  3KAH A;  1BL4 A;  4BF8 A;  2F21 A;  3VAW A;  1Y0O A;  1FKH A;  2XP7 A;  1TCO C;  1ROT A;  2L2S A;  1FKJ A;  4DRK A;  5J6E A;  4GGQ A;  3KAG A;  1D7H A;  2KGJ A;  1Q6U A;  4JYS A;  2XP4 A;  4MSP A;  4O2T A;  3O5F A;  1FKT A;  2RSE A;  3H9R B;  2KO7 A;  1M5Y A;  4IQC A;  3O5Q A;  2XPA A;  1Q1C A;  3O5I A;  1D6O A;  1EYM A;  4J4N A;  1B6C A;  4LAW A;  4TX0 A;  4DRM A;  5HKG A;  2ZQU A;  2XP5 A;  2RUR A;  4MGV A;  1FKF A;  4JFM A;  1KT1 A;  2AWG A;  1Q6I A;  4ODK A;  4ODO A;  4W9O A;  3RFW A;  4DRP A;  3TDB A;  4TYO A;  5D75 A;  1QPF A;  3TCZ A;  2KI3 A;  4ODQ A;  2M08 A;  1YAT A;  2Q5A A;  2RUC A;  4ODN A;  2F2D A;  1JNS A;  4DZ3 A;  1QPL A;  3KCE A;  3O5G A;  4N19 A;  1D7I A;  3IKD A;  5HT1 A;  4FAP A;  4IPX A;  2PPO A;  2VN1 A;  3O5J A;  5BXJ A;  1T11 A;  2KE0 A;  2XP6 A;  4C02 B;  3O5M A;  2XPB A;  3ODK A;  1QZ2 A;  1ZK6 A;  1JVW A;  3PA7 A;  1FKS A;  3UI6 A;  2FKE A;  1L1P A;  4DRQ A;  3NRK A;  4ODM A;  2ZR6 A;  4W9Q A;  4U84 A;  2M2A A;  2MNT A;  4U85 A;  4ODR A;  3UI5 A;  4DRH A;  1J4H A;  4QT3 A;  2JZV A;  3IKG A;  4JFI A;  5HWC A;  3EY6 A;  4NNR A;  3PRD A;  1NMW A;  1YW5 A;  3GPK A;  1A7X A;  1C9H A;  1FD9 A;  3CGN A;  4ODL A;  1FKD A;  3KAB A;  4TW7 A;  3TC5 A;  4ITZ A;  1FKG A;  5HW7 A;  1FKR A;  1Q6H A;  3OOB A;  2N87 A;  2M1I A;  3B7X A;  4QT2 A;  4DRJ A;  2LPV A;  3O5K A;  4R0X A;  4U86 A;  1HXV A;  3RGC A;  1FJD A;  4DRI A;  1FAP A;  3O5P A;  3IK8 A;  3FAP A;  3WH0 A;  2DG3 A;  1PIN A;  3KAD A;  2ZR5 A;  1KT0 A;  2FAP A;  4JFJ A;  3UQI A;  4LAV A;  2LJ4 A;  4DH0 A;  1BKF A; 
#chains in the Genus database with same CATH topology
 4TNS A;  3JXV A;  3RME A;  4NSB A;  1ROU A;  2ZR4 A;  4DRN A;  2ZQT A;  1NMV A;  1JCH B;  3IHZ A;  3BXW A;  2KR7 A;  1ZBW A;  4DZ2 A;  2OFN A;  4WJX A;  1FKI A;  4ODP A;  3B9D A;  5HW8 A;  1ZU8 A;  3LUO A;  4G2P A;  3B9E A;  4G50 A;  2RUQ A;  4DRO A;  1FFR A;  4S3K A;  2PN0 A;  1D7J A;  1ZCN A;  2O9O A;  2OLH A;  5GQB A;  1KFW A;  1W9P A;  3UQA A;  2XP3 A;  3KAH A;  3B8S A;  1ROT A;  2L2S A;  3KAG A;  2PI6 A;  4MNK A;  2KGJ A;  4JYS A;  3O5F A;  1FKT A;  3WD4 A;  4DRM A;  2DSW A;  1B6C A;  4QZV B;  2RUR A;  4JFM A;  4ODO A;  4W9O A;  1EIB A;  1GRJ A;  5DEZ A;  3TCZ A;  4ODQ A;  4AY1 A;  4ZPV R;  1QPL A;  4MTV A;  4FAP A;  1WB0 A;  2PPO A;  5BXJ A;  2KE0 A;  1QZ2 A;  1ZK6 A;  3PA7 A;  1FKS A;  3ARP A;  3UI6 A;  2B5U B;  1L1P A;  5HBF A;  4URI A;  2M2A A;  4WKA A;  4XAK A;  1W1Y A;  3UI5 A;  4JFI A;  4NNR A;  4DWS C;  1YW5 A;  3GPK A;  4TW7 A;  4Z2L A;  1FD9 A;  3TC5 A;  1FKD A;  3KAB A;  2DSU A;  1WAW A;  3OOB A;  3ARV A;  3AS0 A;  2LPV A;  3CHE A;  3O5K A;  3ARS A;  4U86 A;  3WH0 A;  1VF8 A;  3IK8 A;  4R5E A;  2ZR5 A;  2DT1 A;  2G8Z A;  1FKR A;  3KZ7 A;  1JND A;  2LGO A;  4MPK A;  2RUD A;  2ZQV A;  3CGM A;  2PBC A;  3GTY X;  4IT6 A;  1EHN A;  1IX5 A;  1ZL1 A;  4P8U A;  3KAC A;  2A3A A;  2DG9 A;  2VCD A;  3B9A A;  3UF8 A;  4JFL A;  2F4E A;  1FKK A;  5HUA A;  1HJW A;  3KAI A;  3MDY B;  1LG1 A;  3UI4 A;  4HBE A;  2A3E A;  5HWB A;  1OGB A;  3ARW A;  3OA5 A;  3RM8 A;  4LAY A;  1LQ0 A;  4W9P A;  1NWS A;  4TW8 A;  3WD0 A;  2DG4 A;  2IF4 A;  3WIJ A;  4Z2I A;  5I98 A;  5DIU A;  1LL6 A;  3AS1 A;  4Z2K A;  3W4R A;  1J6Y A;  1N1A A;  3O5D A;  4J4O A;  3RM9 A;  2XP9 A;  4WKF A;  1BL4 A;  4BF8 A;  2F21 A;  4GGQ A;  1X6L A;  3WQW A;  4O2T A;  1M5Y A;  2XPA A;  1Q1C A;  4TX0 A;  4LAW A;  1NWR A;  4Q22 A;  5HKG A;  1HKK A;  1FKF A;  3RFW A;  1KT1 A;  2AWG A;  4ODK A;  1X6N A;  4TYO A;  5D75 A;  1QPF A;  2KI3 A;  2YBT A;  2Q5A A;  3WD3 A;  2F2D A;  4N19 A;  1SR0 A;  1ZBC A;  3IKD A;  1XRV A;  1E9L A;  4IPX A;  2VN1 A;  2XP6 A;  4C02 B;  2AOS A;  2XPB A;  2G41 A;  2WLZ A;  1UR8 A;  4P8X A;  3CZ8 A;  1E6N A;  2FKE A;  5JH8 A;  4DWS B;  4U84 A;  3CHD A;  4DWS D;  4DRH A;  2YBU A;  3EY6 A;  1C9H A;  1JNE A;  1W9V A;  1Q6H A;  4LGX A;  2N87 A;  1SYT A;  4DRJ A;  1HXV A;  4DRI A;  4DWS A;  1FAP A;  2P4V A;  1KT0 A;  2FAP A;  4L3N A;  3FXY A;  2MLY A;  4IT4 A;  1ZBV A;  3O5O A;  1J4R A;  1H0G A;  1W1T A;  1XHG A;  4HAR A;  1CTN A;  2DT3 A;  2K8I A;  4S3J A;  5DIV A;  3O5E A;  5B8I C;  2QF8 A;  3CHF A;  1PBK A;  2ETN A;  2MLZ A;  4IQ2 A;  4QIB A;  3ALG A;  4TW6 A;  3BMB A;  4GIV A;  1LG2 A;  1R9H A;  3ARQ A;  2UZ5 A;  1JNT A;  1FFQ A;  4L72 B;  3CH9 A;  2ITK A;  3JYJ A;  5GPR A;  1EQ3 A;  1E44 A;  1E6Z A;  4P8W A;  2PPP A;  3WQV A;  1NSG A;  4ZPT R;  2KFW A;  2F23 A;  2WK2 A;  2B31 A;  1P5Q A;  2PV2 A;  3CHC A;  1LJY A;  3NTP A;  4PTM A;  4FN2 A;  1U79 A;  2WM0 A;  1D2K A;  3GU0 A;  4WK9 A;  2DT2 A;  4JFK A;  1HJV A;  4DT4 A;  1GPF A;  4W5U A;  1RD6 A;  2FDM A;  1Y0O A;  2XP7 A;  1TCO C;  1FKJ A;  1EDQ A;  4Z2J A;  1Q6U A;  2XP4 A;  4MSP A;  2RSE A;  3H9R B;  4IQC A;  5DF0 A;  3O5Q A;  1LL4 A;  3O5I A;  1D6O A;  4J4N A;  4KR0 B;  1ITX A;  2ZQU A;  4DRP A;  1GOI A;  1NWU A;  3TDB A;  1JNS A;  1OGG A;  1YAT A;  2RUC A;  4ODN A;  3KCE A;  5HT1 A;  3EIP A;  3O5J A;  1T11 A;  3O5M A;  3ODK A;  3FY1 A;  1JVW A;  3QOK A;  1E6R A;  3NRK A;  2WLY A;  2O92 A;  2ZR6 A;  4W9Q A;  4ZPW R;  4U85 A;  3ALF A;  4ODR A;  1TFV A;  4QT3 A;  1NH6 A;  2JZV A;  4Z2G A;  3ARU A;  1W1P A;  3PRD A;  1A7X A;  4ODL A;  3CGN A;  4ITZ A;  4ZS6 A;  3B7X A;  1ZB5 A;  4QT2 A;  2ESC A;  4R0X A;  3RGC A;  1FJD A;  3FAP A;  1PIN A;  1K9T A;  4JFJ A;  2A3B A;  2LJ4 A;  1BKF A;  2RQS A;  4P8V A;  1E15 A;  3O5L A;  2PPN A;  2MLX A;  1W9U A;  3UQB A;  4UDM A;  3KAF A;  1FKB A;  1WNO A;  4ML4 A;  3AS2 A;  3AS3 A;  1J4I A;  3ARR A;  2PV3 A;  3ARY A;  5DO2 A;  2LKN A;  2MF9 A;  3PRA A;  2XP8 A;  2PV1 A;  3PRB A;  3WD2 A;  5HW6 A;  3I6C A;  2EUL A;  2DPE A;  2Y78 A;  1LL7 A;  3O5R A;  1F40 A;  4DIP A;  2MPH A;  5GPG A;  1HKM A;  1F8A B;  2ZQS A;  3NI6 A;  3AQU A;  4MAV A;  1HKI A;  3JYM A;  5HTG A;  1FKL A;  1W26 A;  4Q7N A;  4LAX A;  1E6P A;  1NWT A;  3RM4 A;  2D9F A;  5DIT A;  4Z2H A;  1W1V A;  1OWQ A;  3VAW A;  2DSZ A;  1FKH A;  2IUZ A;  4DRK A;  3G6M A;  5J6E A;  1D7H A;  4MNL A;  2KO7 A;  2DT0 A;  1EYM A;  2XP5 A;  4MGV A;  3WL0 A;  1Q6I A;  1UR9 A;  2A3C A;  4WKH A;  2M08 A;  4DZ3 A;  3O5G A;  3ART A;  1D7I A;  2DSV A;  3ARX A;  4MNJ A;  3ARO A;  3WD1 A;  3G6L A;  4DRQ A;  1O6I A;  4ODM A;  2MNT A;  3PR9 A;  3WKZ A;  3ARZ A;  1J4H A;  1H0I A;  3IKG A;  5HWC A;  4MNM A;  1NMW A;  4NZC A;  3WL1 A;  1HJX A;  5HW7 A;  1FKG A;  4HBO A;  2M1I A;  4KQZ A;  1ZBK A;  3O5P A;  2DG3 A;  3KAD A;  4WIW A;  3UQI A;  4LAV A;  1HKJ A;  4DH0 A;  1GUV A; 
#chains in the Genus database with same CATH homology
 4TNS A;  3JXV A;  3RME A;  4NSB A;  1ROU A;  2ZR4 A;  4DRN A;  2ZQT A;  1NMV A;  3IHZ A;  3BXW A;  2KR7 A;  1ZBW A;  4DZ2 A;  2OFN A;  4WJX A;  1FKI A;  4ODP A;  3B9D A;  5HW8 A;  1ZU8 A;  3LUO A;  4G2P A;  3B9E A;  4G50 A;  2RUQ A;  4DRO A;  1FFR A;  4S3K A;  1D7J A;  1ZCN A;  2O9O A;  2OLH A;  5GQB A;  1KFW A;  1W9P A;  3UQA A;  2XP3 A;  3KAH A;  3B8S A;  1ROT A;  2L2S A;  3KAG A;  2PI6 A;  4MNK A;  2KGJ A;  4JYS A;  3O5F A;  1FKT A;  3WD4 A;  4DRM A;  2DSW A;  1B6C A;  4QZV B;  2RUR A;  4JFM A;  4ODO A;  4W9O A;  1EIB A;  5DEZ A;  3TCZ A;  4ODQ A;  4AY1 A;  4ZPV R;  1QPL A;  4MTV A;  4FAP A;  1WB0 A;  2PPO A;  5BXJ A;  2KE0 A;  1QZ2 A;  1ZK6 A;  3PA7 A;  1FKS A;  3ARP A;  3UI6 A;  1L1P A;  5HBF A;  4URI A;  2M2A A;  4WKA A;  4XAK A;  1W1Y A;  3UI5 A;  4JFI A;  4NNR A;  4DWS C;  1YW5 A;  3GPK A;  4TW7 A;  4Z2L A;  1FD9 A;  3TC5 A;  1FKD A;  3KAB A;  2DSU A;  1WAW A;  3OOB A;  3ARV A;  3AS0 A;  2LPV A;  3CHE A;  3O5K A;  3ARS A;  4U86 A;  3WH0 A;  1VF8 A;  3IK8 A;  4R5E A;  2ZR5 A;  2DT1 A;  2G8Z A;  1FKR A;  3KZ7 A;  1JND A;  2LGO A;  4MPK A;  2RUD A;  2ZQV A;  3CGM A;  2PBC A;  4IT6 A;  1EHN A;  1IX5 A;  1ZL1 A;  4P8U A;  3KAC A;  2A3A A;  2DG9 A;  2VCD A;  3B9A A;  3UF8 A;  4JFL A;  2F4E A;  1FKK A;  5HUA A;  1HJW A;  3KAI A;  3MDY B;  1LG1 A;  3UI4 A;  4HBE A;  2A3E A;  5HWB A;  1OGB A;  3ARW A;  3OA5 A;  3RM8 A;  4LAY A;  1LQ0 A;  4W9P A;  1NWS A;  4TW8 A;  3WD0 A;  2DG4 A;  2IF4 A;  3WIJ A;  4Z2I A;  5I98 A;  5DIU A;  1LL6 A;  3AS1 A;  4Z2K A;  3W4R A;  1J6Y A;  1N1A A;  3O5D A;  4J4O A;  3RM9 A;  2XP9 A;  4WKF A;  1BL4 A;  4BF8 A;  2F21 A;  4GGQ A;  1X6L A;  3WQW A;  4O2T A;  1M5Y A;  2XPA A;  1Q1C A;  4TX0 A;  4LAW A;  1NWR A;  4Q22 A;  5HKG A;  1HKK A;  1FKF A;  3RFW A;  1KT1 A;  2AWG A;  4ODK A;  1X6N A;  4TYO A;  5D75 A;  1QPF A;  2KI3 A;  2YBT A;  2Q5A A;  3WD3 A;  2F2D A;  4N19 A;  1SR0 A;  1ZBC A;  3IKD A;  1XRV A;  1E9L A;  4IPX A;  2VN1 A;  2XP6 A;  4C02 B;  2AOS A;  2XPB A;  2G41 A;  2WLZ A;  1UR8 A;  4P8X A;  3CZ8 A;  1E6N A;  2FKE A;  5JH8 A;  4DWS B;  4U84 A;  3CHD A;  4DWS D;  4DRH A;  2YBU A;  3EY6 A;  1C9H A;  1JNE A;  1W9V A;  1Q6H A;  4LGX A;  2N87 A;  1SYT A;  4DRJ A;  1HXV A;  4DRI A;  4DWS A;  1FAP A;  1KT0 A;  2FAP A;  4L3N A;  3FXY A;  2MLY A;  4IT4 A;  1ZBV A;  3O5O A;  1J4R A;  1H0G A;  1W1T A;  1XHG A;  4HAR A;  1CTN A;  2DT3 A;  2K8I A;  4S3J A;  5DIV A;  3O5E A;  5B8I C;  2QF8 A;  3CHF A;  1PBK A;  2MLZ A;  4IQ2 A;  4QIB A;  3ALG A;  4TW6 A;  4GIV A;  1LG2 A;  1R9H A;  3ARQ A;  2UZ5 A;  1JNT A;  1FFQ A;  4L72 B;  3CH9 A;  2ITK A;  3JYJ A;  5GPR A;  1EQ3 A;  1E6Z A;  4P8W A;  2PPP A;  3WQV A;  1NSG A;  4ZPT R;  2KFW A;  2WK2 A;  2B31 A;  1P5Q A;  2PV2 A;  3CHC A;  1LJY A;  3NTP A;  4PTM A;  4FN2 A;  1U79 A;  2WM0 A;  1D2K A;  4WK9 A;  2DT2 A;  4JFK A;  1HJV A;  4DT4 A;  1GPF A;  4W5U A;  1RD6 A;  2FDM A;  1Y0O A;  2XP7 A;  1TCO C;  1FKJ A;  1EDQ A;  4Z2J A;  1Q6U A;  2XP4 A;  4MSP A;  2RSE A;  3H9R B;  4IQC A;  5DF0 A;  3O5Q A;  1LL4 A;  3O5I A;  1D6O A;  4J4N A;  4KR0 B;  1ITX A;  2ZQU A;  4DRP A;  1GOI A;  1NWU A;  3TDB A;  1JNS A;  1OGG A;  1YAT A;  2RUC A;  4ODN A;  3KCE A;  5HT1 A;  3O5J A;  1T11 A;  3O5M A;  3ODK A;  3FY1 A;  1JVW A;  3QOK A;  1E6R A;  3NRK A;  2WLY A;  2O92 A;  2ZR6 A;  4W9Q A;  4ZPW R;  4U85 A;  3ALF A;  4ODR A;  1TFV A;  4QT3 A;  1NH6 A;  2JZV A;  4Z2G A;  3ARU A;  1W1P A;  3PRD A;  1A7X A;  4ODL A;  3CGN A;  4ITZ A;  4ZS6 A;  3B7X A;  1ZB5 A;  4QT2 A;  2ESC A;  4R0X A;  3RGC A;  1FJD A;  3FAP A;  1PIN A;  1K9T A;  4JFJ A;  2A3B A;  2LJ4 A;  1BKF A;  2RQS A;  4P8V A;  1E15 A;  3O5L A;  2PPN A;  2MLX A;  1W9U A;  3UQB A;  3KAF A;  1FKB A;  1WNO A;  4ML4 A;  3AS2 A;  3AS3 A;  1J4I A;  3ARR A;  2PV3 A;  3ARY A;  5DO2 A;  2LKN A;  2MF9 A;  3PRA A;  2XP8 A;  2PV1 A;  3PRB A;  3WD2 A;  5HW6 A;  3I6C A;  2DPE A;  2Y78 A;  1LL7 A;  3O5R A;  1F40 A;  4DIP A;  2MPH A;  5GPG A;  1HKM A;  1F8A B;  2ZQS A;  3NI6 A;  3AQU A;  4MAV A;  1HKI A;  3JYM A;  5HTG A;  1FKL A;  1W26 A;  4Q7N A;  4LAX A;  1E6P A;  1NWT A;  3RM4 A;  2D9F A;  5DIT A;  4Z2H A;  1W1V A;  1OWQ A;  3VAW A;  2DSZ A;  1FKH A;  2IUZ A;  4DRK A;  3G6M A;  5J6E A;  1D7H A;  4MNL A;  2KO7 A;  2DT0 A;  1EYM A;  2XP5 A;  4MGV A;  3WL0 A;  1Q6I A;  1UR9 A;  2A3C A;  4WKH A;  2M08 A;  4DZ3 A;  3O5G A;  3ART A;  1D7I A;  2DSV A;  3ARX A;  4MNJ A;  3ARO A;  3WD1 A;  3G6L A;  4DRQ A;  1O6I A;  4ODM A;  2MNT A;  3PR9 A;  3WKZ A;  3ARZ A;  1J4H A;  1H0I A;  3IKG A;  5HWC A;  4MNM A;  1NMW A;  4NZC A;  3WL1 A;  1HJX A;  5HW7 A;  1FKG A;  4HBO A;  2M1I A;  4KQZ A;  1ZBK A;  3O5P A;  2DG3 A;  3KAD A;  4WIW A;  3UQI A;  4LAV A;  1HKJ A;  4DH0 A;  1GUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...