4S3KA

Crystal structure of the bacillus megaterium qm b1551 spore cortex-lytic enzyme slel
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
433
structure length
429
Chain Sequence
GGFAQIYTVKAGDSIYSIAKQFRIDAGKIIRANELPNPNQLVIGQSMVIPINGTYYTVKAGDTIWKVGRKLGVSYQAIANANNVSVTAPLTPGRRILIPPSPNKRNGEFLGYVETSNRKITPQTEKMINQNAKYLTYLGPANFEVQKDGSLKAPPLNNLGSIAKENDVIFLMVLANIENGAFSDEVGRAILNNKDVQDTLLNNIVKTAKEQNFRDIHFDFEFLRPADKEAYIAFLQKAKKRLQDEQLLMSVALAPKTSRDQKGKWYEAHDYKAIGEIANFVVPMTYEGGPPMAVSPIGPVRDVLEYAVSEIPSSKIIMGQNLYGYDWTLPYKPGGEYAKAISPQRAIELAARYKVAIQYDNKAQAPFFRYKDEQQRTHEVWFEDARSIQAKFDLIKELKLRGMAYWKLGLDFPQNWLLIEDNFKITKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Spore germination protein YaaH
publication title Structural and functional analysis of SleL, a peptidoglycan lysin involved in germination of Bacillus spores.
pubmed doi rcsb
source organism Bacillus megaterium
total genus 142
structure length 429
sequence length 433
ec nomenclature ec 3.2.1.-:
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01476 LysM LysM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4s3kA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4s3kA02
2WAGA 1E6QM 4BA0A 1W1PA 3U57A 3AXIA 3SUTA 3GDBA 4QCFA 1BPLB 3WBAA 3PN8A 3N12A 1XYFA 1G9HA 1QNPA 3CO4A 1JNDA 4IPNB 3U5YA 1J01A 2WBGA 1LL6A 3WEZA 1Q6DA 1E55A 2VZOA 1FFQA 2Y5EA 4QP0A 1JL8A 4PMVA 5CZKA 2DSVA 3D5HA 1PIGA 5E0FA 1UWTA 2DT0A 4PTVA 4D72A 3TTQA 2XSBA 1QOXA 3TTSA 5I78A 4L4PA 4PMUA 4AEFA 4JCLA 4U5IA 1H0IA 3A3HA 5AC4A 2OSXA 3VKKA 4J28A 1E15A 1EDTA 4UZUA 3CUJA 4ATWA 2E4TA 5I24A 4W5ZA 3RJYA 2PF0A 1TZ7A 3WF1A 3NUKA 3IK2A 5JBEA 4A3HA 3W6LA 4OOZA 3ARQA 1M04A 1GQJA 1QNQA 1VEOA 1E3XA 5FOOA 1E5JA 3VU2A 1W1YA 2C8NA 2WMJA 2XWEA 5EFDA 1C3FA 2GK1A 2XPKA 3F4VA 2WMKA 3CUGA 1ZL1A 4JKKA 1ZB5A 1GZJA 3SUSA 3THCA 4TOQA 2GVYA 1GPFA 1J11A 1Q6GA 5A1AA 5DEZA 3AIRA 3RO8A 2YLAA 3MUY1 4FLRA 3NSMA 4UZSA 1UD5A 3VD4A 4GI6A 1UH3A 3IJ7A 3VTRA 3PZUA 2XGBA 1FH8A 4PTMA 1CYGA 2G3NA 4M1RA 2PWGA 4MDOA 1QI0A 4P7OA 4M82A 3BMVA 3ZQ9A 3ARPA 4AEEA 1JAKA 1U33A 4J3VA 4CD7A 3BSGA 2NT1A 2CPUA 4U3AA 3M7SA 4JFTA 4CD4A 4MAVA 4J7RA 1R8LA 2OWWA 5BROA 2GJPA 2WVUA 3O9NA 4MB4A 1UQZA 2ZUNA 3N11A 3VUPA 2VRJA 1J0KA 3AHYA 1E4MM 3CGTA 2ZICA 4NF7A 2GDUA 5ABFB 3ARYA 1AQHA 5GNXA 5ECUA 1HJVA 5F7UA 1CXLA 1HIZA 2YJQA 1BSIA 1E70M 3K4DA 1TMQA 2CXGA 4TTUA 3FY1A 4UOJA 1W9VA 4B9YA 3VDCA 1JZ7A 2OYMA 5M3WA 1VJSA 1UR9A 1EA9C 4J27A 4M8UA 3NSNA 3WUEA 1CTNA 4D6CA 3AMCA 3MV01 2YDSA 4YHEA 1HN1A 1C7TA 2WLZA 2WZHA 3OLIA 4H2CA 3MS8A 1K9TA 1XCXA 1DEDA 5D9OA 2WMIB 1V3IA 2QF8A 3PZTA 1E6RA 4FLQA 1G0CA 3WH5A 4HOXA 4MDPA 4X0VA 2XVGA 3AZRA 4HPHA 2CETA 2XM2A 1HJUA 1SR0A 3WH8A 3MANA 3GH5A 1O6IA 2E9LA 2EJ1A 1XD1A 3AMKA 3MUIA 2DSUA 1OSEA 2J25A 4C7FA 3W26A 1NM9A 4KGJA 1JZ5A 3HU7A 3JUGA 1JZ3A 4XUYA 4AYSA 1OB0A 5C8BB 2JF7A 4P8XA 5HPCA 2XTKA 2VQTA 4B16A 3PZOA 1W2VA 4A3YA 4B3LA 1HJWA 1KXHA 4JAWA 1XH1A 5HOSA 2OLHA 2E3ZA 1JZ8A 1HT6A 3BLPX 1ZJBA 2ZX7A 5A6SA 3MSGA 1ISVA 2CESA 2EBNA 1XCWA 1M01A 3AZSA 1HF6A 4V27A 3WQ5A 4V2XA 1V02E 3UERA 3WMSA 3GNPA 1B3ZA 4BF7A 2VR5A 3CPUA 1PX8A 4BQ4A 4JHOA 4AMCA 2DSKA 1D2KA 4ML4A 5GNZA 2EPLX 3AIUA 4L4OA 4P7QA 1W9PA 3OZPA 3OA5A 3OBAA 3VPLA 2VCCA 3W82A 3GNRA 1VFMA 3ARRA 3DHUA 3FN9A 4W8AA 1JD7A 2Y24A 4UOZA 4X0NA 3PTQA 4NSBA 1OD8A 1PIFA 5AYIA 2D24A 1EO5A 2EO7A 1DHKA 2JFEX 3WMCA 3GXFA 3MMWA 4UFKA 4LYRA 1XSIA 4F9DA 1ZBCA 2VOTA 3MUZ1 4GO9A 3W27A 1EDGA 4J3SA 5D8ZA 2J8FA 4WK9A 1KXVA 3EMQA 1BYDA 4GIAA 4AIEA 5BCAA 3RDKA 1C90A 3S2CA 4W7VA 2WMGA 1W32A 3VIHA 1R85A 3OZOA 4LX4A 4B9ZA 2VC9A 3FHAA 5FIPA 4A4AA 3ARZA 4JFUA 5GQBA 4NZCA 1UOKA 2FHBA 1UWUA 3OLEA 1M7XA 2FH6A 1TA3B 1P6WA 4P7LA 1B90A 3ZJKA 1NOWA 2DQXA 3WF2A 3WQ8A 2BS9A 1UR1A 2W92A 4UR9A 1UZ4A 3ARVA 2AAAA 4U33A 4ACZA 1VIWA 2J75A 4QLLA 4D6FA 4JKLA 5A6MA 2GSJA 1OGBA 3NIYA 1X6LA 1FH7A 2ZUTA 1KXQA 1R87A 5I23A 3RMEA 1KCLA 3VGEA 4GQQA 1EIBA 6TAAA 2X05A 3E1F1 3B9DA 1CGWA 1E0VA 2VRQA 1V0KA 2V3DA 5BXRA 2CERA 3A4WA 3GM8A 3S6TA 2A3EA 2V3FA 2O9OA 1B1YA 3WQWA 4RL3A 2O9PA 3AYSA 4GPNA 1HKMA 2WKGA 3ALFA 2QHAA 1H1NA 2PWHA 4MTVA 3IAPA 1GOMA 1PX3A 2XM1A 1ODZA 7TAAA 1A47A 1WAWA 1GORA 4IUGA 4AD3A 4HZ7A 2EPMX 1H0GA 3UG3A 1JI1A 2CHOA 1SMDA 1QW9A 3LPFA 1V0NA 3GH4A 2DPEA 1MFUA 4F8XA 3VM5A 1FHLA 5JBDA 2IXUA 5JUVA 5JH8A 3ZO9A 3MKKA 4C7DA 5LA2A 2CYGA 4BCEA 1JI2A 2VX6A 2CBJA 1GQIA 2A3BA 2JF6A 4GKLA 1XC6A 2F8QA 2DEPA 2ZWZA 1JYXA 2VX4A 4IISA 3M46A 1HL8A 4CKQA 3VD3A 2A3CA 4M80A 4PN2A 2GJXA 1OIFA 2Q8XA 5E9AA 1BTCA 5FD0A 2QV4A 3FAXA 3F5KA 4QAWA 4UFIA 4J3TA 4F66A 3SURA 1J12A 4WF7A 3F5JA 4ACZB 1MFVA 3PZQA 5CGMA 2WC7A 4PMOA 1ISZA 3LPGA 1ZBVA 2BVTA 3NYDA 1GNXA 4YHGA 2WSKA 4S3JA 5GNYA 2XIBA 4W84A 1CENA 1KCKA 1NP2A 2BHZA 1EHNA 3GYCA 1E6NA 1IT0A 3BH4A 1LG2A 1GOKA 3WH7A 3AS3A 1V0MA 2ZE0A 4Q7NA 1XSJA 3AHZA 3PBGA 5CPSA 4MJ4A 2JIEA 3W24A 4IM4A 5IHRA 1ZU8A 1A3HA 3VD7A 1U30A 3WNLA 3OIHA 4AD5A 4ZE5A 5IXEA 4KGLA 1TE1A 1KFWA 1QPKA 3AIQA 4PUEA 1UD6A 1GOWA 4M29A 2W91A 4E4PA 2VQUA 2WVTA 2E8ZA 1I1XA 2DT2A 4LQ1A 3FAWA 2VI0A 1U2YA 3L4VA 2WWCA 4J3UA 2CBVA 2Y2WA 4OJYA 1JYWA 1PBGA 1LWJA 3RCNA 4UOQA 2YL5A 3W29A 4CU8A 3OGVA 2JEPA 4D1JA 2WMHA 1E1FA 4PCSA 1S46A 4JFVA 2ZOXA 2XWDA 3RM4A 4PUDA 2PI6A 4QLKA 8CGTA 3IANA 4XB3A 1AQMA 2VO5A 1BAGA 5CSYA 4GI9A 2ZXAA 5DT5A 2XGIA 4DWSA 2V3GA 5JIWA 1GQLA 1CEOA 1E6XM 5CLTA 4UQDA 4AISA 5E6YA 1B9ZA 3WEOA 1H49A 2G3IA 1J0JA 3IJ8A 4CUCA 2YBTA 3T2OA 3ZM8A 1BVNP 4W8LA 3I3DA 3N1AA 4H8UA 3WKZA 1HJSA 1RH9A 3A4AA 3VGFA 1I75A 4PMXA 4E2OA 3O2LA 1JGIA 4ZFMA 1TG7A 5C71A 2VT0A 1V03A 2VX7A 3UG4A 7CGTA 4ATLA 1FP8A 4E8CA 4AC1X 5TD4A 2XFYA 1KR0A 1UKQA 3VO0A 3M07A 1B3WA 1CGTA 1H41A 1K9EA 4V28A 4JL1A 1EO7A 1VBUA 2B31A 1QI5A 4W8BA 2CKSA 1UKPA 3MV11 5FL0A 3W28A 1VRXA 4P8UA 2WC4A 4PMZA 4HOWA 1W3JA 3DHPA 3EMCA 1V6YA 2D0GA 4AIOA 4FMVA 4H8HA 3WBEA 3VGBA 1PAMA 1TUXA 5DMYA 4H8VA 3T0AA 4X9YA 2WHKA 4ZEPA 1DP0A 3T0BA 1FH9A 1VEPA 3B8SA 3OG2A 1R86A 5A6AA 5JIPA 1J9YA 1FHDA 1MW1A 4W87A 1JFXA 2WPGA 1UH2A 1FP9A 4XV0A 4Y7EA 3PTMA 1AQ0A 2YL6A 4Z2IA 1HJXA 1H4PA 4LPCA 2C7FA 1L8NA 2D0HA 4CD8A 4PMYA 1MYRA 2YDQA 2XG9A 4UQAA 5I2UA 2XVNA 4HMCA 1VFOA 2PBOA 3VINA 2WVVA 1HVXA 3BMWA 2FGLA 4GO8A 4PMNA 2DSWA 1H2JA 3AS2A 2PC8A 2FHFA 3AI0A 1E4NA 2W67A 3ZJ7A 5IFTA 1UD3A 1UG6A 3FNDA 1J18A 1AVAA 2QMJA 3K1DA 1RP9A 2WK2A 4TVDA 4CU6A 4R27A 1E4IA 3CZGA 3QGVA 3CIVA 1ECEA 1B0IA 1GHRA 1KB3A 1JG9A 2QLYA 1QW8A 4HA1A 3LPOA 4UCFA 2Y8VA 1CGUA 2WHLA 1VENA 1MVYA 2UY3A 5DO8A 3EDFA 1LG1A 3NDZA 1W1TA 3A47A 3TP4A 1J0HA 3IAQA 1E72M 3CZJA 2GK1B 2J7CA 1EGZA 4QCEA 1E6SM 2J7FA 4W86A 2BHYA 3WN6A 3VDBA 4JFWA 1CNVA 3TTYA 3DECA 1HL9A 1CGXA 3THDA 1UA3A 1UD8A 3UCQA 2IXVA 3N18A 4AZ5A 4ZXLA 3AZTA 2EEXA 1GW1A 1QI4A 4PMDA 5I0DA 4URIA 1OBAA 3TA9A 1ZBKA 1CXKA 1V02A 1NQ6A 1J0ZA 1LLOA 3AXXA 3U7BA 3VX1A 3RPMA 2V5DA 4CGTA 4HMEA 3TOPA 3AJ7A 3AICA 3ZR6A 4AZ7A 2GUYA 3U7VA 2YDRA 5CLWA 1US2A 5A2BA 3AS0A 2ZUSA 1XRVA 1B2YA 4D71A 5GPRA 1UR0A 4KRUA 3AQUA 1ODUA 3MU7A 1F4AA 1VEMA 3SCWA 5IHSA 2VTFA 3WENA 1B3YA 4R5EA 1YQ2A 2OSYA 2WW5A 1KBKA 1NWRA 3QOKA 3VNYA 1J10A 4DWSD 2O9TA 2ZX6A 3AMGA 4PBGA 3ARTA 3L4TA 1MW3A 1XYZA 4DUXA 3ARWA 2XUCA 4H04A 1HKKA 1CPUA 2XVPA 1UYQA 1V6WA 3SIMA 3WUFA 1TVPA 1OIMA 2J74A 4NRSA 4GZIA 2ESCA 3WNOA 3BC9A 1MQPA 2D23A 4DM2A 5BXTA 2E9MA 3N17A 4PCTA 4PSPA 4D6HA 5FKYA 2ZWYA 1QI3A 1GJWA 2X0YA 3OGSA 3EDDA 1FFRA 2VR4A 2VRKA 4JZ5A 3RM8A 4AD4A 5A69A 3AHTA 2TAAA 1W1VA 3GBDA 1DWIM 1DWHM 1CXEA 2WZIA 3CZEA 4AZCA 4FK9A 1NOFA 2IUZA 4PSRA 4TTGA 1GONA 1V6VA 2J7GA 2XJ7A 3AMDA 2WHMA 4UQBA 2J77A 3WDJA 4P8WA 5M17A 2XFFA 4FF5A 1QHZA 1W91A 1FA2A 2J78A 2W66A 1GHSA 2WB5A 1JXKA 5LA1A 3ARUA 4AZ6A 1JAEA 2EPKX 1OM0A 4JCMA 4D1IA 2GFTA 1CXHA 1HXJA 1CXIA 2XYLA 3BAWA 3ECQA 4MPKA 4U5KA 3SUWA 3W0KA 2AOSA 1H5VA 3ZIZA 2F61A 3KWXA 3T2PA 5EB8A 4D6DA 3T0DA 4D6GA 3CHFA 1LL4A 3WL0A 1MWOA 4CCDA 3K8LA 4ACYA 4P7NA 1PJ9A 3OLGA 4D6EA 4UQEA 1ITCA 4AZGA 2J4GA 3W4RA 1ISWA 5CPTA 3QHOA 2EXOA 4GZJA 5CXPA 3ARXA 1W3KA 1B3XA 5HDRA 4AZIA 3SCUA 2WMFA 3SUUA 2VJXA 3WSUA 2X8RA 3VIIA 4CD6A 1R7OA 5KEZA 2Y4SA 2G3JA 1BHGA 1IZJA 2O9RA 4Z2LA 3RILA 4UNIA 2DH3A 2PB1A 4HP5A 1E71M 1W3HA 1JIBA 5A8QA 1JXJA 2W4XA 3RM9A 2DIJA 3VIFA 4HA3A 1I1WA 2CBUA 2VZTA 5E0CA 3WF0A 3WDRA 1TVNA 3WDIA 2WBKA 3CUFA 1TFVA 2BVYA 3VVGA 4LXFA 1R7AA 4AD1A 3VMPA 2ZX5A 9CGTA 2BNJA 2O92A 3FW6A 2UY4A 3WH6A 1GQKA 1WKYA 3HN3A 4RE3A 3WD2A 1UR4A 1WE5A 3POCA 4W5UA 3GNOA 5D9PA 1C93A 5FL1A 1KXTA 3UR8A 2BY0A 1W3LA 4E8DA 5KZ6A 3VNZA 1ZS2A 2Z1KA 4AZCB 5I77A 2XIIA 4GI8A 1VF8A 2J79A 2ZX9A 3WD4A 2E0PA 3CUHA 3AHVA 3SCSA 3IJ9A 2W5FA 3SCTA 1HKJA 4BQ5A 3CZ8A 4PEEA 2WYSA 5JBFA 6A3HA 3PZGA 4ZENA 1VAHA 5ABGA 3WFLA 1CGYA 1UWIA 1QNRA 1YHTA 1QHOA 2J7DA 2BXZA 1CXFA 1Z32X 2A3HA 4BZYA 2OWXA 4HZ8A 3T2QA 4Q22A 3QHNA 3WL1A 5DT7A 2PBGA 1W9XA 3L4UA 3ZOAA 2UWFA 4AZHA 2DT1A 2G8ZA 4QLJA 1SFSA 4ZXOA 1NP0A 4CN4A 2DGAA 2W61A 2WWDA 2ZXQA 5E6ZA 4M56A 3ZR5A 1UKSA 1VBRA 1KWKA 4DUVA 1BVZA 4AD2A 5HBFA 1MQQA 1JF6A 3CMJA 4WSJA 2V38A 1HVQA 3WNNA 2X2YA 3PZ9A 1C91A 1JF5A 2YIHA 3MMUA 3MUAA 4OKDA 3VMOA 5E70A 5A8MA 2BVDA 2ZXDA 3AYRA 4UFHA 1JDDA 3AFBA 4CVWA 2WLYA 2F2HA 3KL3A 3ZJ8A 4PYSA 1CDGA 2FDMA 2VURA 1PPIA 4EK7A 1DWJM 5CPQA 5A6JA 3WD0A 2NT0A 4MADA 3VX0A 1C8YA 4OZOA 3NSXA 4CU7A 3ZSTA 1IV8A 1E0XA 5A8NA 2BY2A 3MSDA 4N42A 2D1ZA 5DF0A 1V3KA 1RP8A 2J47A 1WP6A 4CD5A 1XH0A 1HJQA 3VM7A 1N82A 3AISA 1G5AA 1UUQA 3I3BA 1KWGA 5A6LA 2J7BA 2ZUWA 3G6MA 2WCAA 1Q4NX 1V08A 4MNJA 4K68A 1BFNA 4KMQA 1JZ4A 2D3NA 2ZXBA 1OD0A 3ARSA 4M24A 4FLSA 2BHUA 5I6SA 3PZNA 2X1IA 3N15A 2WNWA 1K9DA 4PMQA 1E1EA 2WANA 3OB8A 3VGDA 4C7GA 5AY7A 2DIEA 1HKIA 2HVMA 3CH9A 1GOQA 1WB0A 2JE8A 2WKLA 4B3KA 1RPKA 1SMAA 4FLOA 4JHZA 1QNOA 3EMZA 3VOCA 2EPOA 2Y8KA 4MNKA 1KGUA 1VJZA 2GJXB 3ZT7A 1W9BM 1X1NA 5CSUA 3VIOA 2PWDA 3I3EA 1WNOA 4ATDA 1WZLA 4U3CA 1WDRA 4WKAA 2PWEA 1OCQA 2D3LA 5BXPA 1UKTA 3BXWA 1V6XA 3BCDA 1GCYA 4MAZA 4EKJA 2CBIA 1B3VA 4JFSA 1WCGA 1L0PA 4IPLA 4QDMA 4EANA 2EPNA 3SCQA 4F9JA 2FH8A 4CCEA 3ZSSA 1V6UA 5ABFA 1DWGM 3OGRA 1C8QA 3VILA 2YA0A 1BQCA 3UESA 3WD3A 2HISA 3ALGA 1V3JA 4TXEA 3SEPA 3N9KA 3VIJA 2D2OA 3WNMA 3UR7A 4B15A 4DM1A 3AXHA 2VCAA 1UD2A 1K6AA 3A6OA 3TTOA 3L2LA 1XHGA 1ISYA 2RGMA 3VDAA 2VMFA 3AIBA 4NI3A 3T09A 1J0YA 4OBRA 1UWRA 1ESWA 2WMIA 4UFJA 1EQCA 1D3CA 3BAYA 3NDYA 3GBEA 1KGWA 2NSXA 3L4WA 4W7WA 5E09A 1UR2A 3G6LA 3B9AA 4QFUA 4GQRA 1EQPA 2NW0A 1V3HA 3L2MA 3II1A 1QBAA 1Q6EA 4GXPA 3WUGA 1CLXA 1NWSA 1NWTA 1G1YA 2BFGA 4W88A 4KRTA 4LYQA 5AC5A 5A95A 3DYPA 3APGA 4DWSB 1UA7A 1KQYA 2J7HA 4GINA 3AROA 1E0WA 4WKFA 3SUVA 5BRPA 1PZ2A 3GH7A 4NRRA 2VX5A 1OGSA 4WLCA 4YPJA 1BF2A 5CJ5A 1G94A 2D20A 2DDXA 4AD0A 3WFZA 3WIJA 4HOZA 3HJEA 1WZAA 1TR1A 3CTTA 1CBGA 4CVUA 4Z2HA 2WCSA 3ZMRA 2D0FA 2DSZA 3CLWA 2J8GA 4W85A 1WDPA 5EMYA 1QI2A 1K9FA 3K46A 1W2PA 2V3EA 1WDSA 2VZUA 1DTUA 4Z2JA 2E8YA 1JD9A 2WC3A 4HZ6A 4PRWA 3CMGA 1H3GA 5A8OA 2QPSA 3RJXA 3CBWA 1KGXA 1LWHA 3SCPA 2EQDA 4M81A 1E5NA 3WMBA 4H41A 3GXIA 3N13A 3NJ3A 1GVIA 4AY1A 4UQ9A 4EAMA 1NOUA 1JZ2A 2VZVA 1JDAA 2G3MA 3KZSA 4JKMA 5ABEA 1EOKA 3D3AA 2FGZA 1LJYA 3SCNA 1QBBA 3AIVA 3W53A 4AW7A 4P8VA 3M6DA 2XVKA 2WZEA 2BY1A 3AS1A 1HX0A 4RE2A 4TUFA 4PMRA 1JFHA 3LPPA 3VD5A 1XH2A 5D4YA 3PHAA 2E9BA 1Q6FA 5ABHA 1V3MA 3UETA 4OOUA 1B30A 1UQYA 5A8PA 1E3ZA 3KE0A 5A94A 4P7RA 1QNSA 1E43A 3PTKA 4CN1A 1B31A 1O7AA 2BXYA 5BWFA 3WH9A 1BG4A 4CN6A 3K8KA 3WD1A 1UHVA 4YN5A 3BAIA 2XFRA 2V5CA 2OWCA 4AIUA 4AXNA 1EOMA 3MMDA 1CECA 3EDEA 1TA3A 2WVVB 3EYPA 1Y7VA 2YA1A 1LQ0A 2G41A 4GZEA 1Q6CA 5BXSA 2JALA 4BS0A 1NWUA 2CIPA 4MB1A 3L4ZA 4ZE4A 1W9DM 3W38A 5AYBA 3WQVA 2BV9A 1MXDA 5A2CA 1OT2A 3LMYA 5HPOA 1AMYA 4OBSA 3WF4A 4HU8A 1HP4A 5EBAA 2ZUMA 4W89A 4RE4A 3WDHA 3VMNA 3POHA 3PZVA 4HU0A 4H7VA 4HTYA 5DFAA 2C0HA 2UY2A 2CEQA 4XZBA 1M03A 3EBVA 4PTXA 1UWSA 2JEQA 4JL2A 2WM0A 1JDCA 3HMCA 2QMKA 1DWAM 1CWYA 1OINA 2XSAA 2WVSA 1UKOA 2VVNA 2YOCA 1E6PA 3VIKA 3FHQA 1BGGA 2J62A 3KL5A 4U2YA 4AWEA 1HP5A 3OLDA 3BSHA 4BQ2A 1CIUA 1XV8A 3WNPA 3BAXA 2OYLA 5A6BA 3L4XA 1JYVA 3W81A 2WSPA 4J3XA 2WCGA 3KEHA 3O6AA 3BCFA 4F79A 2YL9A 3DC0A 4UTFA 2E40A 2GDVA 3L4YA 4TVUA 5C70A 2W63A 3A4XA 1NARA 3WDQA 4HPGA 1TCMA 2DH2A 4J3WA 1UD4A 3CZLA 1NH6A 1PX4A 4HMDA 3AMLA 1ZBWA 3B9EA 2YBUA 1E40A 3FXYA 2OYKA 1E4LA 1GOIA 4JIEA 3U5UA 3J7HA 1OWQA 3GXDA 5EFFA 1WO2A 1GOOA 3ZT5A 1C8XA 1XD0A 7A3HA 1UH4A 3W37A 3WDPP 3CHEA 3K8MA 1EDQA 5LA0A 3EDJA 4MB5A 2YLLA 5CQ1A 1E56A 4TVCA 4KWUA 4Z2KA 2DT3A 5FCZA 3VDHA 3AIEA 3EDKA 2X0HA 2VVSA 1LF1A 4HA4A 1US3A 4TX8A 1LL7A 2BY3A 4UFMA 1MXGA 1MW0A 4WSKA 1WZMA 3PZMA 2X09A 3DYOA 4BQ3A 2JIWA 3KL0A 4UQCA 1IZKA 2CITA 5IFPA 2FHCA 1QVBA 1H11A 2CHNA 4N0RA 4W93A 1J0IA 3QR3A 3WEMA 1E9LA 5D8WA 1BGAA 3GXMA 5BRQA 1CGVA 4AZBA 3TONA 4PTWA 3VIMA 1WDQA 3BAJA 2VL4A 1BLIA 2XHYA 1ZJAA 4MJ2A 1GVYA 2WXDM 4MNMA 1V0LA 1JNEA 3WELA 3ZJ6A 1HNYA 1VFFA 4U2ZA 3AHXA 3GZAA 2D22A 3BGAA 2VUYA 3F5LA 3SCVA 2QPUA 2Z1SA 5D9NA 5I79A 4LGXA 3VIGA 4U31A 1SYTA 4S3KA 8A3HA 2CKRA 3WF3A 1WPCA 3VD9A 4MNLA 1E6ZA 2ZX8A 1ITXA 3T08A 3MO4A 5I5RA 1CLVA 1BG9A 1XSKA 1UZ1A 3N04A 4TX6A 1GUVA 3VGGA 1BYCA 2WHJA 1M53A 2RGLA 3PZIA 1JYNA 4MB3A 1EXPA 4WKHA 5CG0A 1ISXA 3W6MA 4CCCA 1QHPA 2J7EA 5A2AA 1E73M 2VCBA 2AMGA 1KBBA 6CGTA 4WIWA 4LYPA 5IDIA 1OGGA 1XGZA 3QHMA 2W62A 1BYBA 4D6JA 4XZWA 1C7SA 2YKKA 3UEQA 4WJXA 3GTNA 5CGTA 3NCOA 3VGHA 2A3AA 1DWFM 1RD6A 1KR1A 5A3HA 4DUWA 5LYRA 1BYAA 2YL8A 2GJRA 3WNKA 3AIWA 1OT1A 1VFUA 3DYMA 3CHDA 2VZSA 4W7UA 3WUBA 1WZKA 3W25A 1H09A 1W9UA 1UR8A 3AOFA 3QOMA 2CNCA 1VB9A 5A6KA 2YA2A 1C92A 2PWFA 4OIFA 4UFLA 5M03A 5D9MA 2UY5A 5M5DA 1KQZA 1CZ1A 3BAKA 5HXMA 2MANA 1MQRA 1GJUA 2XVLA 1PEZA 3UG5A 3SCOA 2G4FA 1UWQA 5I3DA 2ZIDA 2ZUUA 4KH2A 5BYWA 1EHAA 1EH9A 4Z2GA 2CCRA 5HNNA 1V3LA 2OSWA 3WQ6A 1D7FA 3WY1A 2VNCA 3K4AA 4D6IA 4EE9A 1FOBA 3ZT6A 4OUEA 3CUIA 1PZ3A 1G01A 3WQ4A 2ZUVA 3BLKA 5A6BD 3SCRA 3VIPA 4DWSC 1X6NA 1JZ6A 3CHCA 1F4HA 4XX6A 3RIKA 1MW2A 3CZKA
chains in the Genus database with same CATH superfamily
2WAGA 3CAKA 3WBWA 3TYZA 3WJYA 3M16A 2FAPA 2GUUA 4MY1A 1Q2RA 1X6UA 4NNAA 3EWZA 3CO4A 4CQCA 1J01A 1ZAHA 3P93A 2E5DA 3WEZA 2I7GA 3FAPA 2Y5EA 5LIWX 3A3WA 3DUGA 5JQ9A 3D5HA 2PGRA 5E0FA 2X2GA 3BMXA 3KABA 3ABOA 3TTQA 3C0QA 1WOAA 4JCLA 1H0IA 1R3YA 2OOGA 2OSXA 4K1GA 1E15A 3M0LA 1ZP3A 4LV9A 4ATWA 2QXWA 5I07A 2BGNE 3CL6A 3STCA 1S2WA 5JBEA 4HU4A 3ARQA 1M04A 4O1EA 4Y8FA 1H7WA 2IQDA 1OEPA 1DJNA 2C8NA 2WMJA 4DBEA 1C3FA 4DT4A 2XPKA 2J27A 1ZL1A 4HHLA 4TOQA 3VUSA 2ASHA 1GPFA 1J11A 2JKEA 2DJLA 4EXBA 3DIPA 3W01A 1MEIA 3MUY1 4DZ3A 2YW3A 4GI6A 2PWUA 5AKQA 3VTRA 3LHUA 3QR1A 1PKLA 4KIRA 5BU6A 4QJ4B 3OA3A 3KRSA 4MDOA 3RFAA 4M82A 4MZ1A 3ZLFA 4A3UA 4KCTA 3ZQ9A 3ARPA 3BQ6A 3JZEA 1TJ0A 3VNMA 4J3VA 1F6YA 3OQEA 3SDOA 3M7SA 2WSRA 1LQAA 2OWWA 5BROA 2WVUA 5BW6A 3NPWA 6ALDA 4GCXA 4DWDA 2R8WA 2WNZA 4I6KA 3EX1A 2GDUA 1O60A 1VFSA 4K7YA 5F7UA 1QXLA 2QDEA 3RLVA 1J8VA 2YJQA 3OHIA 4Q8MA 3M43A 6XIAA 3FY1A 4UOJA 3VDCA 1JZ7A 2I1OA 2O7QA 2NXGA 1FWTA 3W7EA 4J27A 1HG3A 2OZ8A 1WYIA 3WUEA 3GIYA 4D6CA 4UMBA 2G5WA 5J8LA 1E9IA 4CQDA 1RSCA 1C7TA 3EPNA 3WLLA 1XCXA 1ITQA 2KAUC 4AVNA 1FKIA 3QLLA 2HWGA 1V3IA 3M0HA 5JH1A 4AY7A 4QGCA 3WH5A 4IXHA 2GQ3A 4O8RA 4AF0A 1EX1A 2XM2A 1HJUA 1SR0A 1LOSA 3IJQA 1M7OA 3AMKA 1GTEA 2IQTA 1JZ5A 3HU7A 4TU1A 4XUYA 1KCZA 2VFIA 1R3TA 5CZJA 5EMMA 4A3RA 3O05A 4I90A 1AH3A 5IOBA 3GDMA 2VQTA 3UR5A 5CPMA 1S2UA 4LUYA 4B3LA 3OODA 2OLHA 2HSAA 3WQFA 4DJEA 2ZX7A 3CK5A 1ISVA 3IHZA 2I9UA 1RLCL 1H1YA 1BWLA 4E8GA 1HF6A 1TX0A 1THFD 2ANUA 3QH2A 4RZ6A 3TJXA 1B3ZA 2VR5A 2AGTA 1UOZA 4ODPA 4WHBA 4BQ4A 3ITOA 3W7IA 2DORA 3M6YA 1J5SA 2RURA 1OYAA 1PTGA 4IQEA 3O15A 4L4OA 4P7QA 5CSRA 2ACRA 3OZPA 3OA5A 3OBAA 4KRZA 4PUUA 5HW7A 3DFHA 5F2LA 4TMCA 4Q6JA 3UZWA 1YMYA 5AYZA 1EGVA 1OADA 5AYIA 1EO5A 2EO7A 3THUA 1DVJA 3BG9A 1GQNA 3GXFA 3H4GA 3MMWA 4GUJA 2Y6ZA 3CV7A 1O5KA 4GO9A 5CBBA 4GCAA 3W27A 3KTXA 4C1KA 2NV2A 3C4UA 3BOFA 3RDKA 1KRAC 3S2CA 3VOHA 3O07A 4K8HA 3RUBL 1W32A 1R85A 3NZ1A 3DBPA 3OZOA 1VPYA 2DJXA 3URBA 3LZ5A 3O5OA 1A4LA 1F6PA 4LVBA 3JXVA 3UQNA 1XLHA 2GGIA 4A4AA 1E9YB 2FZ9A 3SN0A 4JFKA 1UOKA 3W2LA 1UWUA 2E09A 3EWXA 1M7XA 4B2DA 3P74A 3TUUA 2Y85A 1P6WA 1B90A 3GTFA 3ZJKA 2ZTJA 4UTKA 5LNVA 2J6XA 3FOKA 1TWWA 2F84A 4ZQCA 2GVJA 3M5XA 3WQ8A 2MNRA 7TIMA 2BS9A 4C6PA 4QX4A 3F4NA 4IL0A 4H9YA 2W92A 4UR9A 3ARVA 2AAAA 4ACZA 2TRSA 3GY1A 2J75A 4YTRA 2HVNA 4TO8A 2KE0A 2BXVA 1X6LA 3IRSA 1KXQA 4J2MA 3C2VA 5I23A 2DUZA 3IWPA 4NU7A 2P0IA 1W5PA 6TAAA 2QGYA 2BLEA 2X05A 3P2VA 3B9DA 4FOUA 4UNLA 3WCZA 3Q37A 2W9MA 3DENA 2GDQA 3RLHA 3S6TA 3WK1A 4B4HA 1PINA 3WQWA 1ITUA 3AYSA 2QAFA 4OQVA 4S3AA 1Z8AA 4UR8A 3M5ZA 3ALFA 1H1NA 3B9OA 1QUMA 2PWHA 3IAPA 2FVMA 1OHLA 4IG2B 4DYJA 7TAAA 1A47A 1WAWA 3MWCA 3MP3A 4DRNA 1P4CA 4QSHA 2RH9A 1F8IA 5CZ0A 4FSAA 3TXVA 1QW9A 4NAFA 2DPEA 5LNRA 4JIQA 4BI7A 2ABAA 1MFUA 2GGGA 3E38A 3VM5A 3PBYA 4HVXA 2QYGA 4J4NA 1E1CA 3IJDA 2IXUA 5JUVA 1FKFA 4C7DA 1FVPA 5LA2A 3D6NA 3NQVA 3CV6A 1Z41A 3LXAA 4ADSA 3BLFA 4BCEA 3W23A 3GZ3A 1Q6HA 1QK2A 2ZDRA 4HB7A 5KTLA 4FZIA 1XPGA 2A3BA 2F8QA 5CZTA 3R10A 3W85A 3QTGA 4PFHA 4MG4A 1H7XA 3M46A 1MXSA 5DBTA 4A2RA 1OK6A 4CKQA 3VD3A 5TBOA 4PN2A 1NY1A 4JN8A 5B80A 1OIFA 2Q8XA 3PNZA 1TJPA 3ELFA 4DBSA 4QAWA 4O10A 4F66A 6REQA 2B4GA 3F5JA 1UPPA 4ACZB 3QFWA 1ISZA 1L2QA 4N19A 2PN0A 1ZBVA 1HKWA 1GNXA 3NL5A 4S3JA 4W84A 1CENA 2V5KA 3NYZA 1E0TA 2VFDA 5CPNA 2BHZA 3ANYA 1H60A 1E6NA 3KRZA 5SWUA 3T6CA 4FB7A 4DRSA 3BH4A 2NWRA 3DERA 3EWWA 4GD0A 2NWSA 3U0HA 3V5FA 3AS3A 1EZWA 3HTWA 3PBGA 4MJ4A 2Q01A 1NFPA 1A3HA 1VZWA 3OIHA 2R9RA 5IXEA 4CQBA 3O5IA 3CQIA 1DXFA 3OVRA 3HQPA 4PUEA 3BGJA 3NR0A 4IICA 1RCOB 3PBUA 3S1WA 4QG6A 3WLRA 4QE1A 4CNPA 3H4WA 3L4VA 1W1IE 3AJXA 2QJJA 1GTHA 2PTXA 2QJNA 2CBVA 3NM1A 5I3IA 5F2GA 4QT2A 1E1CB 1LWJA 3MUCA 3RCNA 3WQPA 1N8WA 2PFHA 3O5MA 1EF2A 4LAWA 1S46A 1TWZA 4JFVA 1MZRA 4AC7C 1K8YA 1SO6A 2PI6A 3LCLA 4A22A 3IANA 5DCDA 2VO5A 4O17A 4MJMA 4NZJA 4GI9A 2ZXAA 4AVOA 5DT5A 2V3GA 5JIWA 1GQLA 4QHRA 1FWBC 3GYEA 1E6XM 3QKEA 5HW6A 4WEVX 1XYAA 5LGZA 1B9ZA 3P3BA 2B7PA 4O4WA 5H8UA 1C9HA 3GVGA 1BL4A 2OX1A 4GUIA 3H2CA 1BVNP 4W8LA 1BWVA 4Y96A 4H8UA 3N2TA 1RH9A 3A4AA 4PMXA 3TYEA 4HYRA 1TJRA 4E2OA 1V6TA 3VA8A 4YMZA 1EC8A 1C9DA 1TG7A 3UG4A 7CGTA 1OYBA 2BODX 4IL2A 4ATLA 2IQ0A 3EGJA 5I3HA 4NL1A 1UKQA 3RX3A 1TRDA 3TC6A 4DF2A 2OZ0A 1K9EA 3TN5A 4H9ZA 4NNBA 1SZRA 3SRKA 2XIQA 2V2HA 4N9CA 4NZ4A 2V6AA 3MV11 5EMJA 2Q3RA 1VHCA 1EEXA 3HFTA 3LX9A 4S3EA 5D2VA 3DKJA 4PMZA 4HOWA 1K77A 1VYSX 2D0GA 1S5NA 1PAMA 4MFDA 5I09A 1UB3A 3TMLA 2M1IA 2GLKA 5FA5A 1KFKA 4PTNA 3TAOA 5FESA 1R86A 3BW3A 3O1NA 1J9YA 4DX3A 2WNQA 1FHDA 1W17A 2WJEA 4LAYA 3LBCA 5E5CA 4FXJA 4DZ5A 3VABA 4YTQA 2YL6A 5FSEC 1HJXA 3QPYA 3BO9A 3CM4A 1L8NA 5C9XA 4CD8A 5FEPA 2XG9A 3SAZA 4LANA 4V1XA 2C1GA 3S9IA 4C6OA 4GO8A 2FGLA 4MYXA 1CCWB 1E4NA 4UWMA 4I9JA 1UD3A 4LCQA 1FWGC 2WK2A 4QT3A 1EWDA 3N25A 4R27A 1QO2A 5BMXA 4DRPA 3QGVA 5D75A 5FACA 3E02A 2X7WA 2VENA 4C5ZA 1QW8A 5DY3A 4BEQA 1J93A 1UUOA 3KBJA 5J5RA 1XG3A 3O6DA 3KCOA 4JIIX 3EDFA 1KC7A 1E72M 3CZJA 1HUVA 3V1PA 2GK1B 5M1TA 2BHYA 3WN6A 1OX4A 3W7KA 5FI8A 5HQMA 2R1MA 3ZYZA 4HD5A 1UA3A 3B8DA 1UD8A 1T96A 3HM7A 3SR7A 2D9FA 4HK7A 3URAA 1DXEA 4EOUA 1PYMA 3AZTA 2VC7A 3TYAA 1GW1A 4PMDA 2QUNA 4DBWA 2Y0FA 1XIDA 3RK8A 2OG9A 4AZ7A 2GUYA 3IACA 5CLWA 3GNXA 3KP1A 1A5OC 2EGZA 3B03A 3P6LA 4D71A 1O95A 1A53A 2OZTA 4TQTA 3FJLA 1MRAA 4XKYA 5REQB 1UR3M 1F4AA 1VEMA 3WENA 1B3YA 1NWRA 3UI6A 4NXKA 1Q7MA 1F5ZA 2W6RA 3XISA 4RV8A 1XLAA 4LRTA 3L4TA 3ARWA 1LORA 1HKKA 4JN6A 3VZYA 4KEZA 2MLXA 2C16A 1TMLA 4AHQA 3WNOA 3BC9A 5TQLA 4ZFCA 5G2HA 2DZXA 1R38A 1MQPA 2YXOA 3U48A 2MLZA 2OQHA 3ERPA 3QSRA 4D6HA 2Y61A 1F2JA 3OGSA 4JQ1A 2W3ZA 3RM8A 2WSYA 2IMRA 2TAAA 2F6KA 2V0TA 3MQTA 1DWHM 2GGJA 4J4KA 2MF9A 4O1DA 4JTKA 2MPHA 1RV8A 1XGDA 1TTPA 3SGUA 3CV2A 2B0MA 2PV2A 3IGHX 2XJ7A 1R9XA 1XQKA 5JXQA 5M17A 4JTUA 1W91A 2J8TA 3RRAA 4L61A 1WUEA 2W66A 2WB5A 1JXKA 1O1HA 4AZ6A 1EL3A 2EPKX 4DROA 1A5NC 1TTJA 3S47A 3DG6A 3G1SA 1HXJA 2XYLA 3BAWA 3VFLA 4MPKA 4JTAA 3W0KA 4D8LA 3LDVA 1H5VA 1TRIA 1TPWA 3KWXA 3T2PA 5EB8A 1V5XA 4M5PA 4P7NA 1PJ9A 3OLGA 1I2RA 4N4QA 3W1TA 2J4GA 3LQGA 1T5AA 4XZLX 5CPTA 2EXOA 5CXPA 1B3XA 3ABRA 1XLLA 3SCUA 2WMFA 4TR9A 3WJSA 3VIIA 4ICCX 1A49A 5KZMA 5BRBA 4QNEA 2O9RA 4QR6A 1JCJA 1M7PA 1EP1A 1LUCA 2E6FA 3VIFA 1Z9AA 3NQFA 3KACA 4HA3A 1I1WA 3JYJA 1SFJA 2CBUA 3N9SA 5E0CA 1TVNA 1L6SA 2WBKA 3BV7A 4LAOA 1IIGA 3E12A 1R7AA 2CZDA 3VMPA 9CGTA 4FN2A 3BZJA 3ORWA 3AAMA 2O92A 1D8WA 1V77A 4EF8A 4XSLA 1PTDA 1GQKA 2ALRA 2JBMA 4GFSA 3POCA 1R3QA 5D9PA 3UA4A 1C93A 3M0MA 2BY0A 4B91A 4DO7A 5KZ6A 3VNZA 5A8GA 2Z1KA 1VF8A 3N6HA 3AXKA 3CUHA 3SCSA 3SCTA 5FEWA 4BQ5A 1RY8A 4U10A 3V1HA 1P0EA 1J4EA 4XZ9A 6A3HA 4YYCA 1YNQA 1UC4A 4Q7IA 4UMCA 2VGBA 4JTIA 4BK9A 1QHOA 2BBFA 5E93A 4HZ8A 3IS4A 3WL1A 4D9PA 3S5NA 1MDRA 1XCFA 2PGEA 4ZXOA 1NP0A 2PLKA 5E6ZA 4M56A 3ZR5A 2P4VA 1YBQA 4DUVA 1RBOB 5CC7A 1JCLA 1JF6A 3A64A 3KBVA 3LRLA 4W9QA 3GKFA 3INPA 1HVQA 4AVFA 4TW6A 4RX0A 1C91A 1JF5A 2YIHA 5AHNA 2C19A 5A8MA 5AVNA 3AFBA 1PWMA 3CB8A 4J4OA 2X1UA 3KOXA 2QCDA 3S1XA 3GVRA 3IEBA 1IXOA 3U4FA 2YGYA 4JR5A 4CNUA 1DWJM 1FCVA 1JCXA 5A6JA 1XLBA 1R3RA 2NT0A 1LT8A 4H6EA 3VX0A 1C8YA 1QMLA 4CU7A 1IV8A 3TC3A 3EXTA 3W7MA 4LF2A 3MSDA 5AC8A 1RVKA 3BUVA 2QDDA 2WJZA 1EIXA 1Z69A 1UUQA 4ZO8A 5A6LA 3REQB 2WCAA 1DHPA 3O5EA 3FKRA 4N9BA 4PC8A 3BW2A 1BFNA 4KMQA 4H83A 2D3NA 1TV4A 3UPMA 2BHUA 4JTGA 1GG0A 5LGXA 3ZVHA 2WNWA 3NQBA 1JCHB 3CIWA 2WANA 5AY7A 4PCPA 4V15A 1N2VA 4QSFA 1S2TA 4Y8EA 3QF0A 3CH9A 4L65A 2JE8A 5LZLA 3GVVA 4GISA 4Q32A 2PA6A 1RPKA 4FLOA 1FAPA 1R9YA 4JHZA 1QNOA 2VHLA 3RN6A 3VOCA 4Q4RA 2EPOA 5HR7A 1RJQA 1F07A 2PD9A 2AQVA 2ZRVA 1KM6A 1SFTA 4GIEA 1TV3A 3GXTA 4GIYA 1WDRA 4J2PA 1L6YA 1OCQA 3NQDA 3P5YA 5BXPA 1TPB1 1ZENA 3BXWA 4Q8OA 3BCDA 4JFJA 1GCYA 1Q6UA 1ECQA 4EKJA 3MY9A 1WCGA 2ODOA 3DX5A 2BX7A 4C6EA 2EPNA 2FH8A 1EGMA 1V6UA 3GNDA 3S1VA 1D6OA 5ABFA 3OGRA 3H21A 4DRMA 1LBMA 2B7QA 4S3GA 3V5OA 1E44A 3PAJA 3ITLA 3QLDA 2HISA 2IKGA 4G6CA 2DV0A 4TXEA 4GXMA 4PL1A 3C5QA 3VIJA 2D2OA 3E3HA 3UR7A 5TNVA 3C0SA 3A6OA 3LM7A 3NZPA 3TTOA 5LIUX 2WZMA 3O7UA 4US6A 3F1QA 3VDAA 4S3BA 2VMFA 3T09A 2RUQA 3UJEA 2FYMA 4OBRA 1UWRA 3E9AA 2ZYFA 5FF2A 1D3CA 4UTTA 4XTIA 3VDGA 1XICA 4JFLA 3G0UA 1UR2A 4GBUA 4QISA 3B9AA 1M65A 2Y7DA 3T1GA 3VKCA 1DL3A 3HOJA 2BOEX 4OGZA 1Q6EA 4GXPA 1GG1A 3R6IA 3DCPA 4W88A 4ODNA 4KRTA 3RPTA 3OOBA 1KQYA 1R2SA 5BZAA 4GINA 3AROA 1YDYA 4WKFA 4ZZ9A 5BRPA 2VX5A 4A21A 4L56A 5B8IC 4WLCA 1BF2A 1BKHA 1RJRA 3TSMA 3NFUA 1IEQA 3TYCA 3VKDA 3WFZA 2PP1A 4DRIA 3WIJA 3KW3A 4HOZA 3AXMA 1TR1A 4DO6A 4QIBA 1CBGA 2POTA 3ZMRA 1T99A 1Q6IA 4O1FA 2D0FA 3GQYA 3NPVA 3CLWA 4W85A 5EMYA 1QI2A 3SFKA 3K46A 4ERGA 4Z2JA 1EP2A 1JD9A 4DO5A 4PRWA 1P43A 3CMGA 2QPSA 3H54A 3RJXA 2Z1WA 4H41A 3GXIA 4EAYA 4AY1A 4EAMA 1NOUA 3UPWA 2Z2UA 1JDAA 4Y9PA 3KZSA 2A1YA 3MHFA 2NUWA 1OVDA 3AIVA 3PR2A 1V4YA 4Z08A 2GGHA 2R14A 2IPGA 1HX0A 1KFLA 3WO8A 4C6IA 4PMRA 3N2MA 5T26A 3LPPA 3QC3A 1B6CA 4J3ZA 2JKPA 4OOUA 1UQYA 5A8PA 1E3ZA 1KNWA 4P7RA 2UZ9A 1NU5A 5G1MA 1F7BA 1O7AA 3NZQA 3TQKA 1GGOA 3RGTA 3TLQA 3K8KA 4NJIA 4AHOA 2YW4A 1L2UA 2KR7A 1UHVA 3VCNA 3DGBA 3G8EA 2V5CA 1TWIA 2OWCA 4ASTA 5HWNA 1LQ0A 4GZEA 3UBPC 2IS7A 5BXSA 4ZOCA 2JALA 2CIPA 3WBXA 1W9DM 1F61A 5KETA 3LHWA 2BV9A 1OT2A 4FOJA 3BARA 4HHHA 3UWWA 1B3OA 4NXSA 1AUSL 4OBSA 1XYCA 1HP4A 1T7LA 3G1FA 5PTDA 5EBAA 3WDHA 2NVCA 3VMNA 3OYXA 5DBUA 3TN4A 4HTYA 4LU0A 4LUSA 4XZBA 1M03A 3W2KA 4PTXA 1UWSA 1U5VA 1KFEA 3UGRA 1CWYA 1OINA 1FWFC 2XSAA 2WVSA 2PU1A 2CZVA 8RUCA 3EKZA 3WLNA 3DHFA 4CQ8A 2YOCA 1O12A 3PK7A 4NI8A 1NFGA 1BGGA 3UI4A 3KL5A 4U2YA 4AWEA 2C18A 4IFKA 4BQ2A 1ML1A 1SM9A 2A5HA 4G7EB 2OYLA 2AAMA 1U83A 3L4XA 4WXYA 4JGDA 3LM3A 3W81A 1ZGDA 2REQB 4E5TA 1U5JA 3BCFA 4E4UA 4RDVA 4GYJA 2C14A 2XP4A 1SFLA 5AHIA 1EPXA 4YNGA 3MKCA 4TVUA 3ABQA 1VHNA 1QOQA 3TU9A 5C0QA 4K8GA 3NQMA 2HE8A 3WDQA 1HTIA 3IVUA 1UD4A 4FIQA 2Z25A 3CZLA 4IMAA 2ZE3A 1V51A 2EHHA 1K1DA 3B9EA 2V2CA 3E74A 2X42A 3FXYA 3LI1A 3J7HA 1YYAA 3G22A 1RCXB 3ZT5A 4YXGA 1PCKA 4XBSA 3H55A 2FPYA 1TWDA 3K8MA 5H91A 1EDQA 5LA0A 1FY6A 4MB5A 1EJRC 4EPKA 2V81A 4TVCA 1PBKA 3AIEA 2X0HA 1IEWA 4TX8A 1LL7A 4L9XA 3VKBA 4UFMA 1L6GA 4B5SA 5C2GA 1L1PA 3LYEA 4BQ3A 3W71A 4MF4A 2FHCA 2FJKA 1H11A 4NX0A 2PGFA 1LLWA 5H6HA 3QR3A 3WEMA 1E9LA 1JGMA 2E77A 2HPIA 3TQ0A 4F2UA 1XLCA 1EEPA 3GXMA 2ZRZA 1FCQA 1EX5A 3TONA 3UJ2A 3FJNA 5DN1A 4DRJA 4YL2A 1BLIA 3KVLA 4LNYA 1QT1A 1VRDA 1R5YA 1V0LA 1JNEA 4OTKA 4S3FA 2GUBA 4E2DA 1VFFA 2YSWA 4GVFA 1Q6RA 1VP5A 5C7HA 4L4LA 4LS1A 4JFMA 1XLEA 1PHQA 3SCVA 5BOOA 2PCEA 3E49A 4ZCWA 4GWEA 4XAFA 2INEA 4DXXA 4U31A 1YTDA 4Q8UA 3WF3A 4DZIA 3I65A 3ZVIA 2O56A 2PDIA 4PTDA 3T08A 3KP0A 5I5RA 3N04A 3WYZA 1ALDA 2I56A 1L6FA 4YU1A 1GYNA 4HHMA 2WHJA 4JX6A 1JYNA 1EXPA 2H9AA 5CG0A 1DQXA 5CJMA 3W6MA 1QHPA 4HSOA 4WIWA 3IUHA 1EJUC 4LYPA 1LBFA 3FIGA 5KITA 3B0XA 3KX6A 2JK2A 3UWEA 1XYMA 1C7SA 2J13A 1UP0A 2A21A 4WJXA 4C6FA 4X2RA 3VGHA 3LXBA 1OG0A 3FDGA 4MM1A 1F8AB 5TF0A 4L4MA 4LAUA 4DUWA 2GJRA 3WNKA 3M0KA 3CHDA 3L2IA 1ROUA 4NAEA 3WUBA 2CZEA 3QOMA 4O18A 4TW8A 2YA2A 4DJDA 2H3BA 5GJNA 4UTWA 2INZA 3G18A 2I17A 4L1XA 4ZTYA 3GK0A 1EJTC 5F1UA 1XLIA 3OP2A 4R85A 1UWQA 2ADAA 1PIIA 1X1OA 1L6WA 1XRTA 1EHAA 3F2CA 2FDSA 3T8QA 4TX9A 2OSWA 1D7FA 2PDFA 1ZALA 3WY1A 2VNCA 5FAJA 4EWJA 4D6IA 4DRQA 4GY7A 2OT0A 4ERAA 3LNPA 5ENLA 3BLKA 3TJLA 1N8IA 1ZNNA 3H2AA 1X6NA 2CLOA 3R5EA 5DX7A 3URQA 4FNPA 1W1PA 3U57A 2Z6JA 4WJEA 4QCFA 1YXDA 2Z2AA 1BPLB 1SPQA 3WBAA 3V75A 2E6YA 3N12A 1XYFA 2XIMA 3D0CA 2NXIA 3U5YA 1LL6A 3UQBA 5AOUA 3MJMA 1JL8A 4HNVA 4PMVA 4XAYA 4S2BA 1KT1A 1PIGA 4ZQPA 1D3GA 5K2ZA 1QOXA 5I78A 4PMUA 2B7NA 4AEFA 4U5IA 3A3HA 5AC4A 3MPGA 3CQ0A 1EDTA 4IGNA 5D05A 4UZUA 3CUJA 1X7IA 4AIBA 2E4TA 1QO5A 5I24A 3O6CA 3IKDA 2I16A 3R0KA 3BZGA 4Y6GA 3IK2A 4A3HA 1QATA 1VEOA 5FOOA 4QJ5B 2XFWA 3DESA 5HA7A 2QF7A 4UTTC 1LP6A 5EFDA 4GYPA 3F4VA 4DJFA 2YB1A 3S9YA 2OO0A 2CLIA 4Y2WA 2GVYA 3PTDA 3QQ0A 3I6RA 3IIOA 3UPBA 3G77A 3VC5A 5JU6A 3U3HA 4TW7A 4TYOA 1JQXA 5DEZA 5CGQA 3AIRA 1P7TA 4UC5A 4UZSA 1UP3A 3MZ2A 1XKJA 2BMBA 3OO2A 4RV3A 3DH7A 1FH8A 4F0KA 5L6UA 1CYGA 2PWGA 3GC5A 3HO8A 1QI0A 1U5HA 4P7OA 2ZDSA 4A8IA 2F23A 3EWCA 1IWBA 1JAKA 5T8GA 3OHMB 1U33A 3BSGA 4WOQA 4UBPC 4CD4A 3M9YA 4C91A 4MAVA 3W83A 3LTPA 3S2MA 3CYJA 2GJPA 1KTNA 4LOCA 2CWNA 4MB4A 3LCFA 3TSBA 5HWJA 3SGGA 4ZSTA 1M6JA 3VUPA 1KM4A 1J0KA 5KSWA 3F03K 1E4MM 1FUYA 3S8HA 4NF7A 4ENLA 3ARYA 4FS9A 2XGZA 1FXPA 4EWND 1TSIA 1HIZA 1FJDA 1BSIA 1TMQA 4TTUA 2J66A 4Q4QA 1IGWA 2OYMA 5M3WA 1BRLB 1UR9A 4IZGA 2Z28A 3NSNA 5JH2A 1CTNA 2HROA 1PE1A 1Q13A 1S5VA 3AMCA 3MV01 2YDSA 1YDOA 3BLLA 4LAKA 4YHEA 2VGFA 3WLMA 3OLIA 3A12A 1DQWA 4JY8A 4H2CA 4WZHA 3MS8A 1K9TA 1DEDA 1XX1A 3IGXA 3RXZA 4O50A 4I5XA 3NGFA 1UZDA 4EX4A 2WMIB 2ONEA 5FJRA 3S9ZA 3ES8A 3BLOA 4XAGA 2ACSA 3PZTA 2PSNA 1G0CA 5DRCA 4M19A 1GRJA 4UTJA 3LB0A 2OEMA 4LCRA 4YYFA 2XVGA 2CETA 1W31A 3GHRA 2G4JA 3MANA 1O6IA 1XD1A 3P67A 3MUIA 1K8ZA 1ADDA 4RR4A 2ZFAA 1OSEA 3TVAA 4KGJA 4QM1A 4ZQMA 5C8BB 2VP8A 2BGQA 2HDJA 4O14A 3W70A 5C5YA 4R53A 4P8XA 4IJBA 4EP8C 1M41A 3PZOA 3PWGA 1HJWA 3B0VC 5HOSA 3BLPX 3COTA 3XINA 1PKMA 4FOKA 2CESA 2EBNA 3SADA 2KFWA 4RKAA 1G69A 1AA1B 1TPVA 2BGSA 4LY8A 4JICA 2KX9A 4POCA 4MZ8A 4OE7A 3PJWA 4ZO9A 4AXKA 2WJDA 3CQHA 1TIWA 3MZNA 1XDLA 4BF8A 3G1HA 3IIPA 4YVXA 1D2KA 4FXFA 5GNZA 1YLVA 3Q2DA 3AIUA 4UTUA 4KEMA 4DEFA 4P61A 1KKRA 4LF1A 3UVIA 2C15A 1YTEA 2A3LA 4DPPA 3GNRA 4Q8QA 1VFMA 2ZZ4A 3FN9A 1T8QA 5BMWA 4UOZA 4X0NA 1Q7QA 1OD8A 5AC6A 2HNEA 2QKFA 3AU6A 2C13A 3MO7A 1DHKA 1HXVA 2XP6A 3LSBA 3CEPA 3GPKA 3QZEA 4C6DA 4JYEA 4F9DA 1X8FA 1EDGA 2PRHA 1K8CA 3NM3A 3EMQA 3N2OA 2VFGA 4P2VA 3Q94A 5BCAA 1I2OA 1FTXA 1KM3A 2C3ZA 3MTWA 3PPGA 3MDYB 3TN6A 3P8JA 4IX0A 2G50A 4NYYA 1FKLA 4CNOA 4LX4A 3WJXA 1L9WA 2Y70A 4U4MA 1K02A 3TXZA 1TB3A 2ABBA 3BJSA 3IPWA 3V5CA 5KINA 1WAUA 2PZNA 4K6AA 1S39A 4MWAB 5H8MA 4OECA 1FQ0A 1TA3B 4P7LA 3AUJA 2R6OA 2PTWA 1NOWA 2X1SA 2DQXA 3WF2A 2A2IA 4L5ZA 3N2XA 1RBLA 1UZ4A 3TEVA 1VIWA 1ZFJA 4KWWA 1PKNA 4D6FA 4JKLA 5A6MA 3W7DA 2ZUTA 2FZ8A 1R87A 3IARA 3SSJA 3HJZA 3VGEA 4IMDA 3JU2A 4GQQA 3HQNA 1EIBA 2P10A 1VBHA 3NQEA 3EA3A 3W1AA 2VC5A 3E1F1 3FEQA 3QYQA 1E0VA 1T0OA 1EA0A 2V3DA 2Y78A 2CERA 4FAMA 4ZGYA 2UZ5A 5HQLA 2A3EA 2DQWA 2ZRWA 2O9OA 3B3DA 1GJPA 2ETNA 4GPNA 3E2RA 3L5AA 1QNVA 2N87A 5HMSA 1FCUA 4GMEA 4JIRA 1GOMA 5KZEA 2XM1A 2Q8LA 1ODZA 3CQKA 4LFYA 4U85A 4IUGA 2RAGA 2PP3A 4HSHA 2CHOA 2ZC1A 1PS9A 3GH4A 3CPGA 4RUBA 2GOUA 1RUSA 5JH8A 1EQ3A 2V9DA 3NQ8A 4YCPA 1OZMA 2DFAA 4MPQA 4N9EA 2VX6A 3KAOA 4KCVA 3UNDA 2JF6A 2DEPA 1T6MA 1XM3A 2A7PA 3NL3A 4IISA 1MO0A 4CNTA 2HXUA 1P5QA 4M80A 3S4TA 3TMQA 2NV9A 5E9AA 1BTCA 1TCDA 5FD0A 2J9XA 4LH8A 2E6AA 1J12A 5EKYA 4WF7A 4N7QA 4DJED 1WX0A 3PZQA 3MKVA 3WLJA 2WC7A 4PMOA 3EWYA 4RE0A 2BVTA 3NYDA 4YHGA 3MCOA 1JRBA 2D2GA 3P82A 1RK5A 1NP2A 2PE4A 4LT9A 2RKXA 1U1JA 3DGRA 1EHNA 3GYCA 3SRDA 4DJDC 3UYCA 4UTWC 4MHBA 4O52A 4Q7NA 5CPSA 2FB2A 1OFDA 3A9BA 1YRRA 4O4VA 1ZU8A 3VD7A 3WNLA 2NV1A 3PM6A 4J40A 1DIDA 1UASA 4KGLA 1TE1A 1KFWA 4ODOA 3V36A 2JQXA 4RDZA 3FGCA 1QPKA 4M29A 2W91A 3DFNA 2WVTA 2FTWA 2HBXA 1ZP4A 1X97A 4Q8PA 1I1XA 1TKKA 1R46A 4GQBA 1EBGA 2VI0A 1U2YA 2DVUA 4UUIA 2WV8A 4J3UA 2Y2WA 2M08A 2DZAA 2YL5A 4WDUA 5FEZA 3U8GA 4J9JA 4CU8A 3G1VA 1KKOA 3TDFA 2HXTA 1XINA 2XWDA 4PUDA 8CGTA 3C0LA 3URNA 2PZ0A 2FPVA 1GVRA 1BAGA 5CSYA 2ON3A 3IJ6A 4I8YA 2IKHA 4DWSA 4MSSA 1C9WA 5AC7A 2O55A 2NQ9A 3TR2A 3NQGA 4UQDA 3ZFHA 3WEOA 2G3IA 1SJAA 1J0JA 2GQ8A 4B2DD 2YBTA 3ZM8A 3BJFA 2QT3A 4HGXA 4ADTA 4H9UA 3UZ5A 3RYSA 1I75A 1YIXA 1MZHA 2F6XA 4KR0B 4EVZA 2F21A 1JGIA 2O0TA 1XJBA 2F38A 4F40A 3BLIA 3RLUA 1V03A 3W07A 4WUIA 1FP8A 1DJQA 4M1BA 3C2YA 4IHCA 4AC1X 1ZPTA 4QE4A 3WMLA 1KR0A 4Q4KA 2RUDA 4DXKA 3KVMA 9RUBA 3VO0A 4RXFA 1ZQ5A 3V4BA 3JW7A 4PULA 1GKRA 3WJWA 4GYPC 1AW1A 6PTDA 1QRQA 1QI5A 1UKPA 3ZLHA 3WZ0E 1VRXA 4P8UA 2WC4A 3GXPA 4KFOA 1OFAA 3U6WA 1RBAA 3DHPA 3EMCA 1UJPA 3STPA 1EP3A 3PF3A 3VGBA 4LSBA 3ATYA 3GG1A 5AHLA 3T0AA 1QJWA 4ODQA 1XRSA 4ZEPA 1RAKA 1FH9A 2HZGA 1JNSA 3W1XA 4CNNA 2VEKA 1OJXA 5JIPA 4Q33A 5HJXA 2RDWA 3MA8A 1QPOA 4GC3A 3L0KA 3I7SA 4ZO7A 1VS1A 4MGGA 2QS8A 2OEKA 3WK0A 4JTCA 1TUFA 4WDWA 2V5LA 3UZYA 1POJA 4XV0A 4B92A 1AQ0A 4NQ1A 1H4PA 4LPCA 3PRBA 1YNYA 2FGBA 1MYRA 1T41A 4LY4A 2YDQA 3DZ1A 2A4AA 5FJJA 3H7RA 1UC5A 3HMJG 2HTMA 2VUNA 3VINA 1QTWA 4G5DA 5BOEA 2WVVA 3ISIX 2NVDA 2PC8A 3AC0A 2FHFA 5H2ZA 1UG6A 1J18A 3MJYA 1XDMA 4H3DA 5FJUA 2EF9A 2PDUA 4TVDA 4CU6A 1E4IA 4ODMA 3CIVA 1GHRA 1B0IA 1KB3A 3LY0A 2E1DA 1AK5A 4FPSA 1JG9A 2QLYA 6XIMA 4LW7A 3H24A 2WHLA 2YX0A 1VENA 1Z3NA 3NDZA 4Y9AA 3A47A 3C61A 2HE5A 1UW9A 4Q4MA 4XZHA 2J7CA 3QGAC 3EY6A 4JFWA 1CNVA 5D32A 4IT6A 3E2VA 4BKNA 4ZXLA 2EEXA 1NF0A 4JTHA 1QI4A 4URIA 4DZ2A 1OC5A 2E68A 1V02A 4GACA 4JNYA 4QQ3A 4NASA 3AXXA 4DHGA 3S5ZA 5BWAA 3RPMA 2V5DA 4O19A 4MWAC 3TOPA 3AJ7A 3AICA 2PLCA 3A23A 3N6JA 4E6MA 1PVNA 2POZA 3EPMA 4XVEA 4JY9A 5A2BA 3AS0A 2ZUSA 4WR3A 2ALDA 3WQGA 1XRVA 1B2YA 5GPRA 1FWJC 3APTA 1RXOB 4PUKA 1X96A 3M0YA 1NQKA 4XO7A 1AD4A 4FF7A 1TO3A 4JDBA 3TTEA 1JR1A 3S1UA 2OSYA 2NLYA 2WW5A 5M2FX 1J10A 3HF3A 1EJSC 3AMGA 1EKOA 4RW5A 3C2RA 5DXXA 2XUCA 2XVPA 1Q66A 1OFEA 3A3XA 3SIMA 3WUFA 2ZQSA 1TVPA 1SZEA 2J74A 2FTPA 3ZWTA 1UWAA 2ESCA 3KFTA 4QDWA 3TX9A 5AFDA 2XN0A 2Y89A 2RDUA 5CBIA 2D23A 4DM2A 1AJZA 3WLOA 4PSPA 1TPUA 3TN3A 2JGQA 1QI3A 2X0YA 3A9IA 3EDDA 1FFRA 4A8RA 2VR4A 4PEKA 4JZ5A 5A69A 2R94A 3AHTA 4XTDA 3GBDA 2CC0A 3R4IA 1CXEA 4GH3A 4FK9A 1S2VA 1NOFA 2IUZA 3M0XA 3CNYA 1XC4A 4PSRA 1OX6A 4MFEA 1GONA 2DZPA 1V6VA 2J7GA 1TPFA 1DJHA 2AGKA 3AMDA 2WHMA 4UQBA 3WDJA 4P8WA 1YDNA 3PPCA 4Z0SA 4FF5A 1QHZA 3QMSA 4I7WA 5LA1A 3ARUA 1ZK6A 1JAEA 5C9ZA 1TR9A 3I6CA 4JCMA 4D1IA 1CXHA 4YIWA 4ORIA 3ZIZA 2GWGA 3W74A 4PZVA 3L65A 4R7WA 4D6DA 3T0DA 3H70A 4D6GA 1G7VA 4ACYA 3VZZA 4PUNA 4REQB 4W9TA 1ITCA 4AZGA 1Q6OA 4EXQA 1YPFA 3W4RA 3OZYA 3ARXA 4L7ZA 3UP8A 3H22A 3C2EA 3SUUA 2TYSA 4R33A 3QY6A 4KEVA 2Y4SA 1IZJA 4B5WA 4F2TA 3RILA 1TJ1A 4DBUA 2DH3A 4RK8A 1XL9A 1POKA 4GQGA 3KVKA 4Y90A 4RNFA 3R25A 3RGCA 1M7JA 3MSRA 3SQLA 2MLYA 2CU0A 1RHCA 2ATSA 3CUFA 1TFVA 4IIDA 4H6KA 4M6UA 5C55A 5I3GA 2VD9A 1JCYA 3DI0A 3GLCA 3FW6A 4NJKA 2UY4A 3WH6A 2DY3A 3WD2A 4LJ3A 4W5UA 2C1IA 3L67A 1PYFA 1P0BA 1SSGA 3LHZA 1GEQA 1W3LA 4R88A 4QJ3B 2VM8A 3LEPA 4GI8A 2E0PA 2BG5A 3AHVA 1QCWA 1HKJA 4GBDA 3GR4A 5HQEA 3CZ8A 5EPDA 5JBFA 3R43A 4BJHA 4PB3A 1JPKA 4ZOEA 1XIBA 4LUIA 1VAHA 4KKXA 4ROQA 3NVTA 2XP3A 3AYVA 5ABGA 3WFLA 3QM3A 4AB4A 1P6BA 3LA4A 2BXZA 4BZYA 4HYWA 2OWXA 3T2QA 4L80A 4Q22A 8TIMA 4G56A 1W54A 2PBGA 1XFBA 2OODA 4AZHA 2XINA 4MSPA 4ITZA 2OMAA 4H6QA 4ZS6A 4HPNA 2JKAA 2DGAA 3LCXA 3LQLA 2W61A 2GJNA 3VNJA 4MIMA 1VBRA 2ZQVA 5CAHA 3ITCA 4ALDA 1WBJA 2X2YA 3MMUA 1AL8A 3MUAA 1RVGA 3AALA 2BVDA 1D7IA 3TFXA 1J6OA 7REQB 4S2CA 5LSMA 1Y5VA 1JDDA 2WLYA 1H51A 3FVMA 4PYSA 3O16A 2VURA 4PB4A 1PPIA 4WY0B 2Z26A 3O06A 3WD0A 1P5BA 1KRBC 3AYTA 4Q8NA 4Z42C 2BY2A 2PDCA 4JPGA 4E4FA 2D1ZA 4PRRA 1V3KA 2OT1A 1VBGA 1J2BA 1WP6A 1XH0A 4GLEA 1N82A 1G5AA 3I3BA 3KVJA 1KWGA 3G6MA 2VDHA 1V08A 1GVQA 1NAL1 1R0MA 1JZ4A 1SVDA 1OD0A 3TWBA 4FLSA 2CW6A 3L21A 5I6SA 3TK7A 4FP1A 3N15A 2WOQA 2GQAA 1K9DA 4PMQA 1E1EA 3W1NA 4C7GA 4FR6A 1XYLA 1TZ9A 2HS8A 1HKIA 4XK2A 4RXGA 4B5TA 1WB0A 3V3WA 4B3KA 1Y5WA 3ZLGA 5LIXX 5FF0A 3OTRA 1NDZA 5AYYA 3BK0A 1DORA 2GJXB 1W9BM 9XIAA 2PWDA 4ATDA 2F2DA 4U3CA 2PWEA 4PL2A 3UXKA 2D3LA 4RDYA 3USZA 4DRKA 1V6XA 4KW2A 2J9YA 4JEJA 4MAZA 1B3VA 4NT0A 1BKSA 4IPLA 3SCQA 4F9JA 2E67A 4KS0A 5A6TC 3RR1A 1C8QA 2YA0A 1PWLA 4S3CA 1OQFA 4LAZA 5EL1A 5I7GA 1DBTA 3ALGA 1V3JA 3N9KA 1S1PA 3LLFA 2WO5A 3WNMA 3STFA 4FO4A 4DLMA 4JIHA 4I7UA 3ITTA 3AXHA 3MDUA 2VCAA 1K6AA 5FF3A 3IIXA 2PS2A 2CLFA 3F4WA 3M5VA 3FJ4A 2FKEA 3AIBA 4NI3A 1J4RA 1J0YA 1TV7A 3L7RA 4XAPA 4UFJA 1EQCA 3MUXA 1ONXA 3W7LA 3APYA 3GBEA 4DB7A 1FWEC 4EACA 3QV7A 3L4WA 5E09A 3G6LA 4AX7A 1RLDA 1WDWA 5D2XA 1DTNA 3L2MA 3STEA 5LHFA 3C8FA 4YWSA 3QGKC 1NWTA 1G1YA 5H8PA 3BL3A 3C56A 2XPBA 4B3ZA 4H9XA 3GIPA 2J7HA 3HURA 1E0WA 5HW8A 1RQEA 2R1LA 3SUVA 3SY5A 4QXIA 2XP8A 2GJLA 3N4AA 2BP1A 4YPJA 3GAKA 3KLLA 4LVDA 5DMNA 5CJ5A 1G94A 1P0DA 2DDXA 3NI6A 3TYDA 3R8HA 1LM1A 1JDEA 2NQHA 3CTTA 5HWMA 2AL2B 3RX2A 3KWSA 2V3EA 3IGSA 3P81A 3EIPA 1H3GA 2YCIX 3LCIA 4MGVA 3LHYA 4KPLA 4GVGA 1GYLA 4FA3A 3BPWA 3GO2A 3BURA 3CBWA 3FA5A 2EQDA 4XZMX 4JS3A 3I10A 4M7SA 3N13A 2NQJA 1J6PA 4I5UA 3CT2A 1LOLA 1JZ2A 4C6CA 2VZVA 1XLFA 4JKMA 4O0KA 5ABEA 1EOKA 2FGZA 2Z1VA 1LJYA 3SCNA 1QBBA 3W53A 4AW7A 4E2BA 2WZEA 3ANVA 3UG8A 3A21A 1R2TA 5F4SA 1SO5A 3TJIA 1JFHA 3I6TA 3VD5A 3EOLA 5D4YA 2XH7A 4IF2A 2PODA 3DKLA 4BY3A 1ZAIA 2NQLA 4PFMA 1PL9A 1MEWA 4RNHA 3ODKA 1B31A 2IPWA 1OYCA 1JUBA 3R0UA 4U86A 2PDXA 3CHVA 1D3HA 4Z1YA 3H7VA 3WQCA 1TPH1 1EOMA 4AIUA 4AXNA 4LBUA 1CECA 4ML9A 3Q4DA 4QNWA 2DIKA 2G41A 2P50A 2OELA 4DELA 1ZJIA 4MB1A 3L5LA 1P0KA 4K1WA 3C2FA 4MKVA 1QOPA 3OYZA 2TPSA 4IPPA 1BXCA 4KFNA 2XIOA 1YKWA 2OQLA 4UB9A 4DQWA 2D69A 2ZUMA 2NLIA 4UDMA 4RE4A 3POHA 4GX8A 4YVVA 3ONCA 1ZY9A 5DFAA 2Z4GA 4P5UA 2R1NA 2UY2A 4FALA 5A5WA 1TPDA 2XN2A 2ZRYA 5DMMA 2ZZ5A 2WM0A 3HMCA 1DWAM 3RNDA 5CPLA 2CLKA 1NSGA 1UKOA 3QEZA 3K2GA 1EC7A 1E6PA 4GH1A 3M44A 4TNSA 1HP5A 3OLDA 3QQWA 2GSEA 1XV8A 4IG2A 3WNPA 4IIHA 3HIJA 2GWNA 3ITVA 4OU1A 4J3XA 3UW6A 4IPJA 3HG3A 3O8AA 3KXQA 4H2HA 1TX2A 5J04A 2UV8G 3IKGA 2A6LA 1FKRA 4ZSUA 1LCOA 3DC0A 5D2WA 3GSMA 3H7UA 1P1XA 5EGRA 1RQBA 4IP5A 5C70A 3W7QA 2W63A 1NARA 1PCWA 3WH0A 3IIZA 1SW0A 2F6UA 4S3DA 3EA2A 3KM8A 4QJ1A 3W1LA 1H61A 4IP7A 5HMFA 3U5UA 3T42A 1BSLA 4HBKA 1F6KA 1GK8A 4KQNA 3PUGA 3RX4A 1C8XA 2AQOA 2IPFA 3KRUA 2JZVA 1KV8A 1UH4A 4ZMGA 3CHEA 1Z44A 5DITA 3KBWA 3VOJA 4KWUA 5HAOA 5FCZA 3EDKA 2BWGA 4AYGA 2VVSA 1W3TA 1LF1A 2TMDA 3PBVA 1S2CA 4J35A 4NNRA 1MW0A 1WZMA 3G1DA 3PZMA 5F4XA 3CJPA 4LB4A 1IZKA 1D7KA 1J4IA 2CHNA 1IWAA 4R7JA 1J0IA 3C3UA 3QV9A 2J88A 2QCGA 3GDRA 5D8WA 1BGAA 2ZADA 1XGEA 3NQ7A 2XIJA 2XDFA 4AZBA 2E7FA 4FAPA 4GYKA 3TJ4A 3VIMA 1WDQA 2EKGA 4I9AA 2EG7A 2VL4A 4MJ2A 4QQUA 1ZJAA 2FZNA 4MNMA 1JVWA 2V69A 3W1QA 3VKAA 4YS1A 2Q09A 3M0ZA 4IUOA 2FMOA 1HNYA 3C2OA 3MYOA 3H2NA 3WK3A 3GZAA 3O5QA 2DG9A 3W22A 5C7VA 3KBSA 2C79A 3A4JA 4Q6XA 2Z1SA 5D9NA 6ENLA 4KT2A 5I79A 4TMBA 1SYTA 3E2QA 4NZ1A 3VD9A 1A5MC 4KESA 4PUJA 2V63A 1CLVA 3FSTA 1UZ1A 1FKTA 5D09A 4TX6A 1GUVA 4ERIA 1TV8A 3QSTA 3HPFA 3TW9A 4MYAA 2HJPA 4FNRA 1ISXA 4GABA 1XI3A 4PE8A 2VCBA 4V33A 1KCXA 4DLFA 3NQ2A 6CGTA 1F9CA 3UCDA 3LRKA 2FIQA 3TNOA 3NQAA 3JZUA 1HL2A 5LNSA 2W62A 3GHSA 1RD5A 4XZWA 2YKKA 1IE7C 3B8IA 5CGTA 1XUZA 3G1YA 1UCWA 2QJMA 1G6CA 1RD6A 1LLZA 2NZLA 1KR1A 5A3HA 1BYAA 3M4HA 1KFBA 3EX4A 1OT1A 3DYMA 5AVHA 1WZKA 1H09A 1W9UA 4ZL1A 2YDAA 1UR8A 3W7RA 1A5CA 1YDVA 1C92A 3GU1A 2PWFA 3P8IA 5M03A 3VNLA 2DZUA 5D9MA 3PSVA 4WSHA 5M5DA 1KQZA 1I0BA 3NAVA 4GGBA 4IGMA 4PCFA 1I0DA 4Z1BA 5HK4A 2MANA 4ICNA 4M6PA 1MQRA 2YYUA 1W8SA 3BOXA 3SCOA 1AQFA 5I3DA 1Q1CA 3O63A 1EH9A 4H6RA 1JJKA 4GYFA 1PTAA 5HNNA 3GE7A 1LDCA 3LU2A 4WDTA 4WD0A 3K4AA 1FOBA 3ZT6A 4KQZA 1FKXA 2BVWA 1NVMA 4OUEA 5C54A 4PGLA 4KIEA 2ZUVA 3CUXA 4NIRA 4U84A 5K4ZA 3VIPA 3C8NA 3G5EA 4A6GA 3CHCA 3B0PA 4MLRA 1O68A 1NMWA 4L6DA 3OOQA 1MW2A 3LTYA 3BG3A 1E6QM 4BA0A 3SUTA 1SQ7A 4R9XA 1W3IA 3T4WA 3LUOA 4A05A 3PN8A 3NXLA 1G9HA 1QNPA 4DZAA 1JNDA 4IPNB 2FTYA 5E9XA 3TOYA 4O0ZA 1Q6DA 2PPNA 2VZOA 1FFQA 4QP0A 2C91A 5CZKA 3AWNA 3D47A 3PY2A 1UWTA 4HMNA 2DT0A 4F0SA 4D72A 4JX4A 2ZR6A 3ICJA 1TZZA 1RALA 2PGWA 4J28A 1PDYA 2BASA 2W0UA 3V35A 5I98A 1JPIA 1QPFA 5L9FA 1GOXA 4W5ZA 1F3XA 3RJYA 1TZ7A 3GFXA 4R7OA 4XD5A 3S2NA 2SFPA 4OOZA 2ZZ1A 4YVPA 1QNQA 2FZMA 3VNDA 3E0LA 1W1YA 1W5OA 3A13A 4AX6A 2GK1A 3BLDA 2MNTA 2WMKA 1ZB5A 3M41A 4JIPA 1GZJA 5CSSA 1KM5A 1Q6GA 3KLKA 5A1AA 1W5NA 2C0AA 1LWIA 4GIRA 3RO8A 3NSMA 3VD4A 4HNTA 3PZUA 1ZZMA 2XGBA 1GW9A 4PTMA 2G3NA 4LUTB 4M3PA 3VKJA 2XP7A 5GVJA 2NT1A 3I7QA 2GZXA 4U3AA 1FWIC 2OO6A 1RQHA 3DN5A 4XD6A 2FQIA 3KCLA 4JFTA 3TV8A 3NPUA 1A5LC 5REQA 4J7RA 3SI9A 5EA9A 3O9NA 5G5IA 3TW7A 3N11A 1NIUA 2VRJA 2OGJA 3GW3A 1VPQA 4IIEA 2ZICA 3FDKA 1XIHA 1AQHA 1ZSXA 1REQB 5AN7A 3CC1A 2YZ5A 3HQ1A 5LHEA 4BWLC 3UF9A 1E70M 3K4DA 2CXGA 2Y88A 4HCHA 4B9YA 4NUWA 3HPXA 1VJSA 4M8UA 2O7SA 1HQTA 2PEVA 5HKGA 1HN1A 2WLZA 2IKIA 2WZHA 4I3GA 2O4MA 3MSYA 5DIVA 4NJHA 1MSSA 4AFYA 1C8VA 4F0HA 3KOFA 1V8EA 2QF8A 1W3NA 3EWDA 2RHGA 4LYKA 4HNUA 4MDPA 3N2CA 4XD3A 3AZRA 4HPHA 1PHWA 3WH8A 4ZBCA 3CTLA 3GH5A 2E9LA 2EJ1A 3UWYA 3ITXA 1GZGA 2DSUA 4A2SA 1F3WA 2YYTA 1YPIA 7ODCA 2J25A 4KBXA 3W26A 4C7FA 3FX4A 1UIOA 5U7SA 1JZ3A 1LOQA 1OB0A 3NL2A 1W37A 2QGHA 2HPMA 2JF7A 1MNSA 2Y7FA 3RLGA 2XTKA 4B16A 4PMJA 1KXHA 1XH1A 2E3ZA 1A0EA 1HT6A 1ZJBA 3OEXA 1M01A 3AZSA 5G2WA 4V27A 3BCJA 1M5YA 4V2XA 2OJPA 4WDXA 3ITGA 1V02E 2CLHA 3UERA 1O5RA 3WMSA 3T78A 2NX9A 1RR2A 3CPUA 1EWEA 1PX8A 3S46A 2XH0A 4S38A 3KS6A 3PJXA 2QCCA 1FWDC 3U2CA 4V1YA 1H62A 2KI3A 2DSKA 4ML4A 2EPLX 1TJ2A 4YJ5A 1W9PA 4W9OA 3VPLA 2VCCA 5HWBA 4AU0A 3NTPA 1SO4A 3ARRA 1DYSA 3FK4A 4W8AA 1HGYA 2Y24A 3UCCA 3PTQA 4NJGA 1PIFA 2QULA 2D24A 4AEOA 4X60A 4AH7A 2JFEX 3S5OA 3G8RA 4UFKA 1XSIA 4Q8WA 2VOTA 3MUZ1 2DZWA 2V5BA 4J3SA 1BYDA 4O13A 4GIAA 4AIEA 5HUAA 1UP2A 3SN4A 2EAWA 2ZVIA 2RSEA 2KO7A 1G4EA 4DF1A 1OFPA 3G1RA 4DJFD 3RPDA 3RHGA 4C65A 2VC9A 3FHAA 1D9EA 1J6YA 5FIPA 1XLGA 3F4CA 3B04A 4B5VA 3ARZA 4QG9A 5GQBA 4NZCA 3Q67A 5KZDA 2FHBA 3M47A 1KRCC 3W6YA 1AG1O 2V30A 4INFA 1WOBA 1SJCA 3NOEA 2F2KA 1XIGA 1XIIA 4PBFA 1IR1A 1F05A 3EEZA 1IT8A 1UR1A 1EYMA 1JUEA 2QAPA 3T40A 4DRHA 4QLLA 2Y5SA 2GSJA 1OGBA 4DNHA 3NIYA 3ZR4A 1KCLA 2GOKA 2R82A 2VFHA 5K7JA 5IRPA 4IP4A 2YCLB 3UJFA 2AKZA 5BXRA 3B97A 2DU2A 3A4WA 1KFCA 3GM8A 4XUGA 3IK4A 2QUMA 4H9VA 2V3FA 1WXJA 3T05A 1V79A 1VD6A 1QAPA 4S39A 2PDYA 4JDYA 1HKMA 5D04C 2WKGA 1EB3A 1G4TA 4K2SA 2QHAA 4HNLA 2P3EA 1H63A 1QDSA 4MTVA 3DFOA 2G3FA 2GSHA 7PTDA 1XLJA 4NHVA 1FWWA 3REQA 1IEXA 5MKGB 4GIVA 4AD3A 4HZ7A 2EPMX 4G8TA 1ZCOA 3WQEA 5F2IA 3H12A 3FYYA 3OW1A 3LTSA 3LPFA 1ICPA 2XPAA 4DI8A 2C1HA 3SB0A 1R3WA 4L6HA 4F8XA 7ENLA 1FHLA 3GDTA 5JBDA 4RNIA 2CYGA 2CBJA 4TIMA 1GQIA 4GKLA 4LNCA 1BQGA 1YE6A 1GVFA 2B81A 5G4WA 1CX9A 1HL8A 4DIAA 1XIJA 1R3VA 5FJPA 1AL7A 3PR9A 4K37A 2QV4A 5H1WA 1A5UA 4UFIA 2P88A 3GDLA 4OT7A 1MFVA 5CGMA 3LPGA 2P53A 3HPZA 4LTSA 3QFEA 2QUTA 5HANA 4DY1A 2YCJA 2WSKA 4ZO6A 2XIBA 3TAKA 3GTYX 4CQAA 3UI5A 1KCKA 3NEVA 3QYSA 1LT7A 1VCVA 4ROPA 4CEXC 1KLYA 3PPFA 1IT0A 3A24A 2IF4A 1LG2A 3WH7A 9XIMA 3QZ6A 4O1AA 3AHZA 2ZE0A 1XSJA 2JIEA 4X2PA 3TNBA 4IM4A 5IHRA 1O5XA 3I7RA 1DJXA 4RZ5A 4AD5A 2QIWA 4ZE5A 2ICSA 4A35A 3NQCA 1LZOA 1ZTVA 3U2EA 2ITKA 3AIQA 4KERA 4RPQA 5LKYA 3CAWA 4N6FA 2OKOA 4JD4A 4XBJA 1FWNA 1BD0A 2E8ZA 3R12A 2Q5AA 3LZ3A 3OG3A 2DT2A 4LQ1A 5F4WA 3FAWA 3UY7A 2WWCA 5BNKA 4PODA 4OJYA 3TZNA 1JYWA 3N73A 1ZAJA 2PD5A 1PBGA 1QFEA 4OUIA 4IIGA 3W29A 4NY2A 1XLKA 4IFOA 3R8RA 3OGVA 1VGAA 4WCJA 2JEPA 1EF3A 2WMHA 1MDLA 2ZOXA 1FCBA 2G97A 3GXNA 3R1ZA 3TA6A 4XB3A 1AQMA 3GAYA 2PDWA 1OC6A 1EPVA 4NKCA 3MP5A 2XGIA 1G7UA 1JQVA 3LGEA 4JTEA 2PP0A 1TV5A 5CLTA 4C1NA 5E6YA 3W1MA 3N2BA 1H49A 3MB9A 4HNNA 2VEPA 3IJ8A 2ZZ6A 3G24A 5AHEA 3KAFA 3T2OA 4N6EA 1FKWA 4ADUA 4US5A 3WKZA 3VK5A 1SU5A 3RRXA 4NZ5A 3VGFA 2CWXA 3MHUA 2QVNA 1GYMA 3C0JA 1K4HA 3O2LA 3EX6A 4QTGA 3CT7A 3EX3A 2VX7A 4E8CA 2NXHA 2XFYA 3HZ3A 4C90A 2OX4A 1Q6LA 3BGGA 3M07A 2WNNA 1CGTA 1EBHA 1F3EA 1H41A 2D2HA 4V28A 5AHFA 4C6QA 4RCXA 4MY8A 3S3GA 1EO7A 2B31A 4W8BA 2CKSA 4JQ3A 1VR6A 5XIAA 5D02A 3FS2A 1RZMA 4WRHA 1W3JA 2Y7GA 1V6YA 4ZQRA 4H8HA 3WBEA 2EPHA 3W84A 3G1XA 3G2GA 3TW6A 1GKQA 3S6OA 4H8VA 1IXNA 1AD1A 1DP0A 3T0BA 2QIIA 1VEPA 3AUOA 3CL8A 3B8SA 5A6AA 5EMUA 1LQ2A 3M0IA 3DBNA 4LBSA 3UT0A 3CU2A 4HKPA 3KRBA 4W87A 1VFLA 1JFXA 1XP3A 3PTMA 1JPDX 2ATMA 4ZB2A 3RFWA 2VDGA 4IMEA 2XVNA 4HMCA 2PTYA 1VFOA 4C1NB 2PBOA 1WQ5A 1HVXA 3O5DA 4PMNA 2DSWA 2ZVRA 1H2JA 3AS2A 3AI0A 2I9EA 3FNDA 3K1DA 1RP9A 1J79A 4O11A 3CZGA 3O5FA 1HW6A 3UGVA 3W73A 4EPEC