4S3KA

Crystal structure of the bacillus megaterium qm b1551 spore cortex-lytic enzyme slel
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
433
structure length
429
Chain Sequence
GGFAQIYTVKAGDSIYSIAKQFRIDAGKIIRANELPNPNQLVIGQSMVIPINGTYYTVKAGDTIWKVGRKLGVSYQAIANANNVSVTAPLTPGRRILIPPSPNKRNGEFLGYVETSNRKITPQTEKMINQNAKYLTYLGPANFEVQKDGSLKAPPLNNLGSIAKENDVIFLMVLANIENGAFSDEVGRAILNNKDVQDTLLNNIVKTAKEQNFRDIHFDFEFLRPADKEAYIAFLQKAKKRLQDEQLLMSVALAPKTSRDQKGKWYEAHDYKAIGEIANFVVPMTYEGGPPMAVSPIGPVRDVLEYAVSEIPSSKIIMGQNLYGYDWTLPYKPGGEYAKAISPQRAIELAARYKVAIQYDNKAQAPFFRYKDEQQRTHEVWFEDARSIQAKFDLIKELKLRGMAYWKLGLDFPQNWLLIEDNFKITKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of SleL, a peptidoglycan lysin involved in germination of Bacillus spores.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Hydrolase
molecule keywords Spore germination protein YaaH
total genus 142
structure length 429
sequence length 433
ec nomenclature ec 3.2.1.-:
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01476 LysM LysM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4s3kA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4s3kA02
1LWHA 1Z32X 3FNDA 1UD4A 1UWSA 1JI1A 5DT5A 1UD8A 5A95A 1Y7VA 3GH5A 3GXMA 2BHUA 1KR1A 1HJWA 1J11A 2J7CA 5JBEA 3CHEA 1B31A 2JIWA 1XCWA 1BPLB 2VZTA 1QHPA 2WHLA 2AAAA 3OBAA 5M03A 1JAEA 2WKGA 1V02E 3A3HA 1NH6A 2O9TA 5E0FA 1JZ8A 4X0VA 2WLZA 4J28A 3RMEA 5DMYA 3BAJA 4MNMA 4JHZA 1H0IA 4M56A 2OLHA 2CEQA 2W67A 8CGTA 1JG9A 1C92A 3GH4A 4MB4A 5GNXA 2G3MA 1QNQA 4PCTA 2W61A 4CUCA 3SCNA 3VIOA 4J3TA 4TXEA 5KEZA 1EDQA 1X1NA 1QBBA 4JCLA 3WY1A 4HOXA 1CXIA 4PSPA 4NZCA 2ZX8A 1YHTA 3CBWA 5FKYA 4QLJA 4AYSA 1IV8A 1V0NA 4AW7A 1DHKA 1QNSA 1WDQA 1PJ9A 3U7BA 3VIJA 4AXNA 4A3HA 5D8ZA 4E8CA 5BXSA 4JFTA 4EAMA 4UFLA 1AMYA 5I23A 1UUQA 2Q8XA 3OGVA 2XFFA 3B9EA 1BSIA 4D6IA 3W27A 3N15A 4HA1A 1BQCA 2J77A 1E56A 3T2QA 1EGZA 1PX8A 3GDBA 1V08A 4JFUA 3TP4A 4UQBA 2OWWA 4JHOA 1Q6DA 3WD3A 4OZOA 2WLYA 4IPNB 2G4FA 1SR0A 3U7VA 3WQWA 1EDTA 4AD2A 3WBAA 4PMQA 1ISXA 3I3DA 7CGTA 3NYDA 3AS2A 1IZJA 1UHVA 2VQUA 3GXFA 3IJ7A 1TA3A 2NW0A 1WB0A 2BY3A 1VBUA 4P7OA 1GOIA 2AOSA 3VPLA 1IZKA 1BYBA 3AIWA 1JD7A 1BGGA 3DC0A 4J3VA 4L4PA 1TMQA 3AS3A 1B9ZA 4GZIA 3BCDA 1VJSA 4CU6A 1Q6FA 4URIA 4DWSD 2CNCA 1JD9A 1VEMA 2J8GA 3F5JA 4PMUA 3N13A 3UCQA 4HTYA 3ARQA 1JFXA 4RE2A 4H8UA 3ARSA 3PZVA 4UCFA 4XV0A 2BVDA 1KGXA 4Q7NA 1OWQA 4CKQA 3BAXA 3WUGA 2WHMA 3MUAA 2Y5EA 4D6HA 1FOBA 1JYNA 1JNDA 5BXRA 1VFMA 2OSYA 1UA3A 4F9DA 5IHRA 1UZ4A 3FW6A 4D6JA 1OBAA 2BY1A 4AMCA 1JXKA 3L2LA 1J12A 3IAQA 3I3BA 3RDKA 1BYAA 4JAWA 3WSUA 2BXYA 1V02A 3AHTA 4BQ5A 1WZKA 3EDDA 3PBGA 1VAHA 3GXDA 5AC4A 3VD3A 2WVVB 2J74A 2XGIA 4U5KA 1B1YA 1CIUA 1WDSA 4UOJA 1HKIA 3NCOA 3WNLA 5FL0A 3FN9A 3W4RA 1KXTA 3AFBA 4W85A 1F4AA 3L4VA 3VIKA 1QVBA 2D1ZA 1V3HA 3HU7A 3AZSA 3VVGA 5D9MA 3T0AA 2VI0A 3ZSTA 4U5IA 1FP8A 4UFHA 1WE5A 5AC5A 1E55A 2NT0A 1GZJA 1LL4A 3CUFA 2FH6A 7A3HA 2XM2A 2JF7A 1VJZA 1E4MM 1MQQA 3WMCA 3OA5A 1ZJAA 1BG9A 2C8NA 3IAPA 1G01A 2GK1B 4MB5A 4KGLA 3W24A 1UKQA 2WMIB 3UERA 3SCWA 2J4GA 3UR8A 1KGWA 1QHOA 3WDQA 1BFNA 5LA2A 2BVYA 1EXPA 1KBKA 2GJRA 3BLKA 3EYPA 4UOZA 4HZ6A 3G6MA 4LYRA 3VD9A 4WIWA 2PB1A 3PZ9A 4PMOA 2JE8A 5D4YA 3TA9A 3HMCA 1WNOA 5TD4A 1EO5A 5HXMA 2B31A 1H1NA 5HOSA 4PMVA 4MB1A 4JFWA 1WKYA 3VD5A 1EDGA 4F66A 3ARPA 2GK1A 4U33A 2FHFA 3VGEA 2JEPA 3KWXA 1R7OA 4NSBA 3BCFA 3N9KA 3WNNA 5A3HA 4AEEA 4AZ7A 1LWJA 4OIFA 3NJ3A 1CDGA 1Q6CA 4WSJA 5BCAA 3VOCA 1OB0A 2GDUA 3VD7A 4P8UA 2OYMA 3AROA 2E0PA 3LPGA 1X6NA 3LPOA 4JKKA 2A3CA 2G3JA 1PZ2A 3SUWA 1UR4A 1HP5A 1M7XA 1SMAA 3THDA 1JDCA 4CD5A 1OINA 3OLGA 4MJ2A 3ZT7A 4XZWA 2DSWA 1V3IA 4U2ZA 5FL1A 3WUBA 1KBBA 4F79A 1TCMA 2JF6A 2J25A 2EO7A 4BCEA 1HKKA 4ATLA 3MV11 1V6UA 1UH4A 3CHFA 1C93A 2IXUA 1HN1A 5A6MA 4UQEA 3WNOA 2J8FA 1UWIA 2A3EA 1E6XM 4BZYA 5BRQA 4D1JA 1B3ZA 2CIPA 5I2UA 1Q4NX 3IJ9A 4E8DA 3K8KA 2NT1A 3OLEA 1GQJA 6TAAA 4V28A 4FMVA 4ZXLA 2GVYA 4B15A 4YHGA 3O9NA 3UEQA 1WCGA 1ITXA 2VCBA 4KWUA 4AZCB 2IUZA 3PZIA 4TUFA 4MADA 3AS1A 2XTKA 5CPQA 4P8XA 2XVLA 4PSRA 1OGSA 4YPJA 2X09A 4PCSA 4UNIA 1TVNA 3PZOA 3AHYA 4HP5A 3GH7A 5CG0A 3CZ8A 2DH2A 4B16A 2J7GA 4HMEA 1JDAA 5CXPA 2E9MA 1JZ2A 5M17A 1W3JA 1C8QA 1GVYA 3N1AA 4FK9A 1QI5A 3EMZA 3PZQA 3D5HA 1MW2A 1JF6A 1B2YA 1JAKA 5A6BD 2DPEA 1ISZA 1ECEA 2RGMA 3J7HA 4N0RA 4B3LA 2EJ1A 1XH1A 4H04A 1J0ZA 2J78A 1E5JA 4HA4A 4GKLA 3K8MA 2WWDA 2DIJA 3ECQA 3AIRA 1HT6A 1UG6A 2YOCA 4J7RA 1KXQA 2V3FA 3N04A 4R27A 4A3YA 1JZ4A 3SCTA 4NRRA 1CENA 3CMJA 3BAKA 4FLOA 1E40A 4R5EA 2DGAA 1BYCA 1UZ1A 1KQYA 1VEPA 1WDPA 3DYMA 4H8HA 1MXDA 4M29A 4E4PA 4C7GA 3W81A 1CXKA 2WZHA 1E0VA 3SCOA 4KMQA 3OZPA 2CESA 2X05A 4ZEPA 2DT0A 1JYWA 1CECA 1W2VA 2DH3A 4U31A 2QHAA 4UTFA 2DSKA 5EMYA 1QNOA 3QHMA 1UR8A 1V0MA 1C8XA 1UD2A 1WO2A 3NSXA 3RM9A 4H8VA 4AZIA 2CXGA 1EIBA 2VR5A 2VRJA 2W63A 4BQ2A 1JNEA 2QPSA 3N17A 1CWYA 2DEPA 3APGA 1PPIA 3TTOA 1M01A 1XC6A 3A47A 4CCDA 1CLXA 3AIUA 3SCPA 1US3A 5A8PA 2XGBA 1J0KA 2ZUNA 3W0KA 2ESCA 3GZAA 1JYXA 1HJUA 3VDBA 2XJ7A 3WQVA 4K68A 1E3ZA 3WFZA 1JFHA 2NSXA 1G9HA 1VEOA 3L4ZA 2W4XA 1E9LA 1G94A 1H49A 3CIVA 2WMKA 4FLSA 4GI6A 5FCZA 1E6SM 2W62A 1I1WA 3W29A 2YBTA 5A8NA 3AIBA 1DWIM 2BHZA 2C0HA 5JBFA 4M82A 3VIMA 5ECUA 3VDAA 4W8BA 2FHBA 2ZXBA 3PN8A 4HMCA 1VFUA 2J7DA 1YQ2A 1W9PA 1C8YA 1TE1A 2VTFA 3T0DA 4OUEA 1DP0A 5BXTA 3OG2A 4C7FA 5BXPA 3ARXA 2D3NA 3ARZA 1OT2A 2J7BA 2WZIA 3AXHA 3CTTA 3WQ5A 2HISA 2OWXA 4AIEA 5JUVA 1FH9A 1Q6GA 1UKSA 4BS0A 3WIJA 3WNKA 5E09A 3M7SA 4LYQA 3QOMA 1MWOA 2VT0A 2BHYA 4ZFMA 4UFIA 2WW5A 1HNYA 2WC3A 2MANA 2QV4A 2J79A 3QHNA 1FA2A 1BAGA 1TUXA 2E3ZA 2Y8VA 5CLTA 3WF0A 2VNCA 3KEHA 3ZJ8A 5CGTA 3AMDA 5ABGA 3AXIA 5C71A 5FIPA 3S6TA 3CUIA 3WENA 4M24A 3GYCA 4LGXA 4CN1A 4W5UA 1XSJA 3ZR5A 3VD4A 4PTVA 2YL8A 3SCQA 2XM1A 5JIWA 2YDRA 4ATDA 4FLQA 1D3CA 5HDRA 3BC9A 3WKZA 3ZJ6A 1HJVA 4LX4A 3VDCA 5EFDA 4JCMA 2XIBA 3ZQ9A 2QMJA 4PTXA 4MB3A 1E72M 4PRWA 2VOTA 4AWEA 1UWUA 3KZSA 2CBUA 1BHGA 3ZIZA 4CVUA 1CGVA 3FHQA 4UZUA 1ZB5A 1DTUA 2YBUA 1FFRA 4PUEA 1FHDA 1BTCA 2EBNA 2VX4A 2W66A 3OLDA 3T09A 1BG4A 3U5UA 4AIUA 2A3BA 3PZUA 1UA7A 3NDYA 2Y24A 3AYSA 3DYOA 4P7RA 2WC7A 2GJXA 1XH0A 2GDVA 3NDZA 2ZX9A 4EKJA 5KZ6A 1B90A 1DWAM 3B8SA 1W91A 1OIMA 3N18A 3UR7A 4PTMA 4JKLA 1UR9A 2WZEA 1MFVA 1W9VA 2PBGA 1LF1A 3SCSA 2D20A 3CHDA 3CO4A 1HX0A 5IHSA 2WBKA 4ZXOA 4OKDA 2ZWYA 2J75A 5A8QA 2WNWA 3KL0A 4HMDA 2D3LA 3ARVA 1H3GA 3ARYA 2X1IA 1LLOA 5CLWA 4NI3A 5FD0A 1MW0A 1M53A 3WBEA 2CKSA 4TX6A 1BLIA 5D9NA 3CPUA 1U2YA 3PHAA 1OD0A 2FGLA 2XPKA 2VMFA 3AMCA 1X6LA 3F5LA 1XSIA 3LPPA 4H41A 3MUZ1 2ZUSA 4WK9A 4QDMA 1LG2A 5D9PA 4DUVA 1SFSA 5A8OA 1HVQA 1EQCA 2E8YA 1H09A 1E4NA 1J0HA 2CERA 5IFPA 1WZAA 4WSKA 2YLLA 3ALFA 1OGBA 3K4AA 3PZMA 4MAZA 3VU2A 1NOUA 3ZJ7A 2DQXA 5JH8A 1CTNA 2BXZA 2FH8A 2DT3A 1F4HA 1US2A 5I5RA 2QF8A 1UWTA 2WBGA 1LG1A 3LMYA 1CXHA 4LXFA 1JF5A 4KGJA 1DEDA 1EH9A 1E6ZA 4TOQA 3RJXA 1QI4A 1PX3A 4PTWA 4D71A 2G41A 3RIKA 1UR0A 3N12A 2BV9A 1ITCA 3W6MA 4PMZA 1VFOA 2GFTA 3T2OA 2F61A 3K46A 3CHCA 3CZEA 4OBSA 2EXOA 3AOFA 4DUWA 4UFKA 1W3KA 1J10A 1FH7A 2Z1KA 2J7FA 3ZSSA 4J3XA 1C7TA 2VUYA 3VIPA 2YLAA 3NIYA 4Y7EA 4M81A 2JEQA 2WB5A 3WD2A 3TTYA 4PMYA 2DSVA 4W88A 3VX0A 7TAAA 2VVNA 1W1VA 2WVTA 2WMGA 5GNYA 4IM4A 4EK7A 1TZ7A 2YA0A 3FAWA 3BLPX 2OSWA 1W9BM 3PZNA 3WD0A 3SEPA 3WQ8A 3AIVA 1WPCA 4KH2A 3TTQA 1M03A 1CXEA 2VZSA 2DSUA 4HOZA 2XSBA 5EBAA 2ZICA 4AD4A 3MV01 3EDJA 1B0IA 5ABHA 2QPUA 5A69A 3L4TA 3SUTA 5LA1A 2YJQA 3WNMA 4PEEA 4PYSA 1R8LA 1UKPA 4UQAA 3VGFA 9CGTA 2WHKA 1CGXA 4Z2IA 5BYWA 1PAMA 3WL0A 1NP0A 4PMXA 4F9JA 5I6SA 5IXEA 3A4WA 4WKAA 1K6AA 2YDQA 3CZLA 1TFVA 1B30A 2OSXA 4UFMA 3II1A 2WAGA 1BYDA 4OJYA 4NF7A 5A6LA 1R86A 4CCCA 3SUVA 5HBFA 2ZE0A 4B9ZA 5JBDA 4J3UA 4W93A 4UR9A 2ZXAA 4TTUA 5I79A 2V38A 3W26A 1UKOA 4MDPA 4AISA 2BVTA 1GQIA 3AZTA 1OSEA 3CZGA 3VIFA 1ZBCA 3EBVA 1AQ0A 1V0LA 3A6OA 3W82A 2VR4A 4PUDA 4QLLA 2WHJA 4U3AA 2WPGA 3UETA 4IPLA 3UG4A 3PZTA 4CD8A 4RE3A 1J0JA 1RH9A 3GM8A 3K8LA 3A4AA 3WF4A 1HIZA 1V6XA 3MUIA 2VRQA 1M04A 3S2CA 2XG9A 3DECA 1WZLA 4C7DA 2CCRA 4HU0A 1RP9A 3UG5A 5DT7A 4Z2LA 4EANA 3POHA 3QGVA 1ZBVA 1KB3A 1S46A 1LL6A 3U57A 4PMNA 2GSJA 2CPUA 3GBDA 1JL8A 2CBVA 4P8VA 5A2CA 2YL6A 1GUVA 4MNJA 3KL5A 1KGUA 3GNPA 4V2XA 1XCXA 1E71M 3WH7A 1L0PA 2VL4A 2ZUTA 3RCNA 5CZKA 1VFFA 1J0IA 2VJXA 3THCA 3WMSA 1JZ6A 3BAIA 3BH4A 1E6RA 1CGUA 1D7FA 4BQ4A 3FY1A 3SCRA 1E43A 3KL3A 4XZBA 4AEFA 3BAWA 1UR1A 2UY5A 1BVZA 4JKMA 3JUGA 1E73M 1V3JA 2D2OA 1GJUA 1V3LA 1H11A 5I0DA 1NWUA 1QPKA 1CBGA 4W8LA 3G6LA 4P7LA 4YHEA 2ZXQA 3RM4A 1CXFA 1CZ1A 5ABFB 4AZGA 2YDSA 1EHAA 2V3EA 3W28A 5CJ5A 1HF6A 2OYLA 4ZE5A 3WDHA 1HKMA 2XSAA 4GO9A 1TG7A 2XWEA 4M1RA 2EPNA 3ZO9A 1Q6EA 4XX6A 4IUGA 6A3HA 3CUJA 2D24A 1KXHA 4GIAA 2CETA 1WZMA 1VF8A 2VVSA 4UQDA 4HPGA 1C3FA 1QI0A 2VCAA 4QCEA 1E6PA 3AS0A 4H2CA 3AXXA 4QP0A 3AISA 2UY2A 2ZXDA 4FF5A 1W1TA 1K9DA 1TR1A 2VZUA 3FXYA 5E9AA 2WMJA 4ACZA 1XD0A 4ZENA 3OIHA 4ML4A 2XYLA 2W91A 4GINA 1I75A 3VTRA 3MMDA 2E9LA 4BF7A 3DHPA 3TOPA 4JFSA 1VIWA 2X8RA 2BS9A 2E8ZA 4J27A 1L8NA 2E4TA 5DF0A 2D0HA 3WMBA 2VC9A 2A3HA 2WXDM 4BA0A 1B3XA 3VGHA 4OOZA 4Q22A 1HJSA 1H2JA 3AMLA 2G3IA 1CGTA 1OT1A 1ISVA 2BFGA 4M80A 1JZ3A 1KQZA 1V6VA 5GPRA 2J7HA 4V27A 4GZJA 5C8BB 4W8AA 1PIGA 4JIEA 3IANA 2DSZA 4P8WA 3M46A 2BNJA 4A4AA 4HZ8A 3MSGA 5E70A 5AYIA 3MANA 5DO8A 3MUY1 1GOWA 3VUPA 1HXJA 1W3LA 2WANA 4XB3A 3BSGA 3WFLA 4LPCA 4HOWA 2DT1A 4DWSC 2D0GA 1ODZA 1ODUA 1VB9A 2V5DA 4GQRA 1DWHM 1RPKA 1B3WA 3ZM8A 1JGIA 1KXVA 4CN6A 3UESA 3B9DA 1OCQA 4D72A 4GI8A 3VM5A 3MU7A 1DWJM 1GCYA 4QAWA 1OGGA 1E3XA 4CCEA 4AD3A 1W9DM 3AZRA 1V3KA 3I3EA 3GTNA 4IISA 4WKFA 4AZCA 3GBEA 1PZ3A 1KFWA 4DUXA 1V6WA 3AHVA 4H7VA 4CU8A 3MKKA 2XIIA 2F2HA 3W25A 1QNPA 2RGLA 4MDOA 1RP8A 1W32A 1WDRA 3VMPA 2O9OA 4DWSB 1HKJA 1JZ7A 3UG3A 3BMWA 2XVNA 1D2KA 1W3HA 1KR0A 3WDRA 1W9UA 2JIEA 5CPTA 3MS8A 3WNPA 2X2YA 2UY3A 1CEOA 5BROA 3VGDA 2AMGA 2G3NA 1SMDA 1FH8A 3W6LA 1LJYA 1UOKA 4CD7A 1XSKA 5A6BA 1UD3A 3HN3A 1E70M 2IXVA 4TX8A 4YN5A 2CITA 2V5CA 2PWHA 3MMUA 5M5DA 1H0GA 4GQQA 3VDHA 4W7WA 3ARTA 3W38A 1UWQA 2ZIDA 1UQYA 3WF3A 2X0HA 4EE9A 4RL3A 1JXJA 4MPKA 1QBAA 3T2PA 4MAVA 3OB8A 2EPLX 4J3SA 2PWDA 4WF7A 3OZOA 1W2PA 1DWFM 1CNVA 3U5YA 1CGWA 1GPFA 1UKTA 2VQTA 1VRXA 4Z2KA 1GHSA 2XUCA 2XFRA 4ATWA 3AJ7A 4WJXA 3VNZA 3SUUA 3ARUA 2PI6A 2EEXA 5A2BA 3AHXA 4AZ5A 3QR3A 3GXIA 2Y4SA 3IK2A 4QCFA 2OYKA 2YKKA 4GI9A 1ZBWA 2OWCA 2WSPA 5HNNA 5E0CA 5HPCA 4U3CA 1MFUA 4X9YA 4PBGA 3RJYA 1HP4A 3WH5A 2VX6A 2D23A 3WELA 1C90A 5I77A 4P7NA 2PWFA 3RM8A 3CH9A 2WMFA 1XRVA 2WVVA 5CSUA 1PEZA 3RO8A 1W1YA 3HJEA 4U2YA 3T0BA 1GNXA 5AY7A 3VIIA 4AD0A 3F4VA 5EFFA 1O6IA 4UFJA 5IFTA 1EQPA 5GQBA 4B9YA 2GJPA 4E2OA 3WH6A 3BAYA 3VIGA 5CGMA 3PTQA 1ZU8A 1AQMA 3ZT5A 3ZJKA 3BXWA 2WYSA 1DWGM 2E40A 1JIBA 3VO0A 1I1XA 1E1EA 1E5NA 4D6EA 2CHOA 5A6JA 5I3DA 3ZT6A 1GORA 4UZSA 2FGZA 1J01A 1KCKA 2FHCA 3AHZA 2CKRA 2BY0A 5CQ1A 2CYGA 4PN2A 1EOKA 1G0CA 1BGAA 1U33A 3L4YA 3PTMA 3VNYA 3WD4A 2FDMA 3AI0A 3WL1A 1MVYA 3POCA 1EOMA 1JYVA 2BY2A 3CMGA 1CXLA 5BWFA 3F5KA 1UD6A 1LQ0A 4AD1A 1GHRA 2VCCA 4CD6A 2Y8KA 1U30A 3WUFA 3EMCA 5A8MA 5I24A 3CZKA 4XUYA 1ZS2A 3K1DA 5E6YA 1P6WA 4PMDA 1K9TA 4J3WA 4W7VA 1V03A 2WCGA 4AZ6A 3W53A 1XGZA 1C7SA 4MNLA 3GNOA 4CU7A 4CVWA 3A4XA 1MYRA 4Z2HA 5ABEA 2XVKA 2Y2WA 1GOKA 2VURA 1O7AA 2XHYA 1MW3A 2EPKX 1XH2A 3RILA 1E0XA 2VZVA 5LYRA 1JDDA 1N82A 3VKKA 2J62A 3FAXA 3E1F1 1GQKA 1E6NA 4OBRA 2CBIA 1BVNP 2F8QA 1NP2A 3AQUA 3NUKA 3T08A 3WDJA 5A94A 4S3KA 3DHUA 4L4OA 1NOFA 2W92A 5D9OA 1C91A 1E6QM 1KWGA 3ARRA 1GVIA 4TVUA 2EQDA 2ZX7A 3OGRA 3TONA 4ZE4A 3EDKA 1NOWA 4AC1X 1J18A 3AMKA 2PWEA 4QFUA 4W87A 1OD8A 1E1FA 1EA9C 4HA3A 3WF2A 2JFEX 3WQ4A 1E15A 3NSNA 2WMIA 3VIHA 4WKHA 4GPNA 5M3WA 2VX7A 4AIOA 8A3HA 4D6CA 4AY1A 1QI3A 2J7EA 5A6KA 1FFQA 2X0YA 2ZUMA 2WVSA 5BRPA 2E9BA 2VX5A 3GNRA 5C70A 3L4WA 2O9PA 4MTVA 3ZMRA 4UQCA 3WH9A 3CGTA 2Z1SA 5A2AA 4GZEA 4X0NA 5DFAA 5CSYA 1V0KA 1W1PA 4FLRA 1CLVA 1VBRA 2PWGA 1R87A 5IDIA 4Z2GA 4D1IA 1UR2A 2VRKA 3L4XA 2XVPA 3IJ8A 2PC8A 1NQ6A 3WDPP 3D3AA 4NRSA 1OIFA 1W9XA 2UWFA 2ZUWA 1KWKA 4JZ5A 3AYRA 1AVAA 4RE4A 1JI2A 2YL5A 2ZX6A 4JFVA 4W84A 2EPOA 1H4PA 3OGSA 1QI2A 4W7UA 3SIMA 3VINA 3VGBA 1MQPA 4D6FA 3K4DA 2PBOA 1LL7A 1IT0A 1XYFA 1GQLA 4QLKA 4CD4A 3CUHA 4AD5A 1XD1A 2PF0A 2VO5A 3VMNA 1NWRA 1PIFA 3WD1A 2WM0A 2ZOXA 3M07A 1ISWA 4KRUA 2WSKA 3L4UA 4JL1A 4W5ZA 3KE0A 2A3AA 1UD5A 2UY4A 1V3MA 3AIQA 2GJXB 4JL2A 5E6ZA 1ZBKA 3VMOA 2VZOA 3BSHA 3PZGA 5A6SA 3RPMA 4N42A 3N11A 5F7UA 4D6GA 3LPFA 1MQRA 1UH3A 4HZ7A 5LA0A 1K9EA 1OM0A 2XFYA 1HL8A 1NARA 3NSMA 3CLWA 4S3JA 1K9FA 4CGTA 1A47A 3EMQA 2GUYA 1HJQA 2DDXA 3WN6A 2D0FA 1GONA 2YIHA 1E0WA 5EB8A 3AIEA 1ISYA 4B3KA 4W86A 1R7AA 1HJXA 5ABFA 3WEMA 5D8WA 2V3DA 2WC4A 3CZJA 1ZJBA 4D6DA 4BQ3A 1GJWA 1SYTA 2WKLA 2WCAA 4TVDA 1AQHA 2XVGA 3O2LA 4WLCA 1V6YA 3MSDA 5AYBA 3SURA 5JIPA 3VX1A 1EO7A 1WAWA 1KCLA 2ZX5A 2QLYA 2W5FA 3EDEA 3M6DA 2CHNA 5HPOA 5GNZA 4AZBA 4ACZB 2QMKA 1WP6A 3VILA 4MNKA 4M8UA 1J0YA 4MJ4A 2YA1A 4DM1A 3FHAA 2TAAA 1XHGA 4KRTA 3WH8A 2CBJA 3OLIA 4LQ1A 2DT2A 4UQ9A 2WVUA 4P7QA 4DM2A 2YA2A 3BMVA 3WQ6A 5I78A 1NWSA 3WF1A 4AZHA 1UYQA 3AICA 2YL9A 3BGAA 3EDFA 5CPSA 1CPUA 2D22A 1E4LA 2WWCA 1B3VA 3ZOAA 2C7FA 3L2MA 3AMGA 3QOKA 1VENA 3VM7A 1GOQA 2O92A 1GOMA 4PMRA 4ACYA 2EPMX 3SUSA 3TTSA 1GOOA 3VGGA 4UOQA 1NWTA 4Z2JA 1CGYA 1RD6A 3WUEA 4GXPA 3ARWA 4OOUA 5DEZA 3ALGA 1QW9A 1J9YA 4F8XA 3PTKA 2J47A 4CN4A 4TVCA 1UWRA 1H5VA 2HVMA 1JZ5A 1R85A 3MMWA 2O9RA 3ZR6A 1QOXA 5FOOA 1BF2A 1G5AA 1XYZA 2ZWZA 1EHNA 1FP9A 4TTGA 3QHOA 5A6AA 1A3HA 3SCUA 1QNRA 1HVXA 3DYPA 1GW1A 1B3YA 3SCVA 2WMHA 4LYPA 1FHLA 2DIEA 1MW1A 1XV8A 2ZUVA 1UH2A 6CGTA 1H41A 1PX4A 1ZL1A 4W89A 3WDIA 4GO8A 1HL9A 1PBGA 1CYGA 1G1YA 2XWDA 1NM9A 1ESWA 3MO4A 1TVPA 3B9AA 3CUGA 3W37A 2JALA 4DWSA 3O6AA 4HPHA 4HU8A 2V3GA 2WCSA 3WEZA 3WEOA 2G8ZA 5A1AA 1E4IA 1TA3B 1MXGA 1QW8A 2ZUUA 1QHZA 2WK2A 1UQZA
chains in the Genus database with same CATH superfamily
1L6YA 2OEJA 3EWDA 1VPYA 1UD4A 1UWSA 5A95A 4H9YA 2BHUA 4QG9A 3LLXA 1XLDA 3R7MA 3P74A 3QF0A 3SRHA 2VZTA 2QJGA 2AAAA 1IZCA 5FJTA 1JZ8A 5E0FA 3AUOA 5LIKX 1H5YA 2WLZA 5LHEA 4J28A 5DMYA 3UXAA 3BAJA 4M56A 1GKRA 2XZ9A 1DJGA 1BXNA 3KABA 4TV5A 1HW6A 3XINA 4B4FA 2W67A 4IP4A 5I3KA 3CQ0A 1VFLA 3GH4A 1VRDA 1FWSA 2G3MA 5HATA 3WQOA 4LAKA 3TAOA 1QOPA 3G1FA 5HMFA 4TXEA 2ZR5A 4C65A 3S1UA 2MLXA 4QLJA 3SZ8A 4AYSA 1WDQA 3A4JA 1FAPA 1EJUC 2C16A 3MO7A 5DXYA 2PV1A 4PB3A 4ZOEA 4A29A 5BXSA 4FX8A 1Q65A 4Y96A 3TNOA 2GVJA 1UUQA 3H9RB 4JTEA 4ZOBA 5G4WA 2XFFA 1KCZA 1BQCA 1CI1A 1S3TC 4QX4A 3T2QA 1R9HA 4O1AA 3GDBA 3TP4A 3D46A 4OZOA 3N2TA 1SR0A 3AU6A 3WQWA 1EDTA 4AD2A 2YSWA 4L80A 1ISXA 3NYDA 4N9EA 3AS2A 1ZP3A 2VQUA 1I2QA 2NW0A 1G4TA 5IOBA 1O60A 3VPLA 4A3UA 5CAKA 1BYBA 4GQBA 4DJEA 4IL0A 3DC0A 1QXLA 3TMLA 1MNZA 3PPCA 4NASA 1Q6FA 3E6EA 4DWSD 2CNCA 1BSLA 1VEMA 3UCQA 1C8VA 3MKVA 4S39A 3WJZA 4LH8A 3UWWA 4CKQA 4KQZA 1OG6A 4L6HA 3KAFA 3ABOA 1VFMA 2OSYA 3DAQA 4GABA 1FX6A 4A2SA 4NJJA 1JXKA 1V4YA 4IUOA 1OY0A 1FHUA 5CGQA 3WSUA 2K8IA 2E6DA 4XAGA 3QW3A 2ZTKA 5LXXA 4GOAA 4CQAA 1GRJA 3I65A 2VDIA 1TPB1 4PRRA 1DE6A 3KS5A 1EX1A 1OFDA 3R89A 1X97A 1PV8A 5A6TC 2J74A 4QG8A 2O7QA 3RRAA 3S2NA 2IKJA 3NM3A 4TU1A 1CIUA 1B4KA 3L2IA 1WDSA 5AC7A 1ONXA 3W4RA 2AL1A 3P5ZA 1QVBA 1GEHA 1WQ5A 3FEMA 4K1WA 4AY8A 3LCHA 3PPHA 3R12A 3W2KA 1AH4A 2NT0A 3C2VA 4XZIA 2EG8A 5T91A 2NV9A 4JTQA 3S0CA 2C8NA 1XUZA 4HN8A 5BZAA 1WV2A 5D2WA 2GK1B 3DXIA 3TOYA 1UKQA 2X0SA 4QT3A 3FAPA 1AW5A 3DUGA 3UD6A 5C7HA 4GQ0A 1OX4A 1WUEA 5AYXA 5F2MA 1RCQA 2QPXA 3GU9A 1S38A 3BQ5A 2NUYA 3QPZA 5E93A 1LBMA 3UJSA 2JE8A 2G0WA 3R2GA 3NWRA 4JXCA 4G8TA 1EO5A 1VFHA 3DFOA 4MB1A 1WKYA 4XO7A 3MWAA 4O1EA 1VFSA 5M1TA 1DJQA 3TMQA 4OGZA 4U33A 3LOTA 3N34A 4X61A 3N9KA 3WNNA 4XWUA 1DVJA 3Q4DA 5K4ZA 2XH4A 1A0EA 1ZRQA 1LWJA 4OIFA 2QAPA 1SJAA 4L9XA 2R1LA 5BCAA 8TIMA 4P8UA 3WJYA 3AROA 2E0PA 3LPOA 4JKKA 3URAA 2G3JA 3SUWA 2ADAA 3BK0A 3W2MA 1ZALA 4O57A 5CH9A 1P6BA 1JRBA 1JDCA 3FYPA 4CCZA 3OLGA 1BL4A 4XZWA 3WJWA 4DRIA 4DO4A 4U2ZA 1VYRA 4KS0A 4ZFCA 4F79A 1KM5A 2F23A 5IBXA 3UNTA 3W9ZA 1A5SA 4O11A 3C8NA 1UH4A 3UZYA 3W71A 3L12A 5A6MA 4IPPA 4UQEA 2YCIX 4HPXA 1VLIA 3CL6A 2B5UB 4MYAA 2A3EA 3QJAA 5I3IA 4YJ5A 3W75A 3IJ9A 2Y61A 2OO0A 1NDZA 3OLEA 6TAAA 7PTDA 3QC3A 3GX9A 5G1MA 2GVYA 1D3HA 4DRKA 1AG1O 1WX0A 1Q7ZA 1XBYA 1WCGA 5BOOA 1ITXA 4KWUA 4EPEC 1TPUA 2IUZA 4TUFA 3KRBA 3UZJA 4GH1A 4MADA 3W2NA 3AS1A 2PPNA 5G4EA 2XTKA 4R9XA 4P8XA 2J24A 3EOEA 1J4EA 1T96A 2P8CA 4PSRA 4YPJA 1R38A 1KKRA 4XBJA 2VWSA 4UNIA 2R1MA 3DC8A 4ADSA 5DIUA 3TN5A 2ATSA 4DPPA 4BK9A 4B16A 4EXAA 3PAOA 4JN6A 5CXPA 3CQJA 4UTWC 3FFSA 3LX9A 3KRUA 1JZ2A 3UI6A 1C8QA 2DW7A 1GVYA 3O5IA 1H1YA 3HQPA 3EMZA 1TSIA 2ZQUA 1MW2A 3NL2A 4YNGA 4MGGA 1PTGA 3BE7A 3F4CA 2J8TA 3PWAA 4GYPA 2FZDA 4N0RA 3C2FA 4B3LA 1E5JA 4HA4A 4HSOA 3HF3A 4TR9A 3AIRA 4LF1A 2YOCA 1KXQA 3BZJA 1Q66A 1REQA 5J5RA 4A3YA 1JZ4A 5U4NA 3BAKA 3EWCA 2DGAA 1PE1A 2H6RA 4IFKA 3R94A 1W8GA 1KQYA 1VEPA 5I3FA 2ZRZA 3W81A 1DQUA 3W2LA 3OZPA 3W1RA 1JYWA 4HD5A 2EJAA 2W6RA 2QHAA 4Q8PA 5AZ1A 4LC6A 3TUUA 2R8WA 1C8XA 3GXTA 1WO2A 2FKPA 3NSXA 4K7YA 1TRIA 1TVLA 2CXGA 1HGWA 4BQ2A 2W63A 4HNTA 2AQWA 2PZNA 1PHWA 4ZVJA 5KITA 1FUYA 2QPSA 3N17A 4F2TA 3UWVA 1SZRA 1XC6A 2GL5A 4CCDA 4JX6A 3W0KA 4DY1A 3VDBA 4I6KA 1HJUA 4Q8WA 3WQVA 1M41A 3GFYA 3H2OA 4WUIA 3MHUA 1NDYA 1R0MA 4GVHA 1DJIA 1VEOA 1EC8A 3S5SA 2VC6A 1G94A 4QIUA 3WLHA 5E9XA 1NQKA 3ICJA 4GI6A 4UTHA 4K7VA 1I1WA 4JR5A 5LNVA 3LQGA 2C0HA 2QS8A 3BOLA 5ECUA 5D30A 5FJJA 2ZXBA 4PTDA 4LU0A 3HIJA 3TXZA 1Z9AA 2CLIA 1TE1A 2ACSA 2QUMA 2FAPA 1A5NC 1LLZA 5BXTA 3ARXA 1EWDA 4XTDA 3H53A 1GVFA 1SGJA 1OT2A 1U83A 3AXHA 5C2CA 4N4PA 3ATZA 3WQ5A 4H6KA 2OWXA 4AMAA 2R6OA 5BU6A 1DJNA 3WIJA 1ENUA 4LYQA 2WZMA 4FNQA 3TLLA 1TREA 2VP8A 2WW5A 2BOFX 1BAGA 1FCQA 2Y8VA 3S1VA 2ZRYA 1VPQA 3ZJ8A 4XZ9A 1WDDA 5ABGA 3AXIA 1NDVA 2V9DA 3IVTA 1GKPA 4CN1A 1NEYA 1XSJA 1S5TA 4N02A 3VD4A 1UCWA 4FLQA 3VKDA 2B81A 1PINA 3BC9A 3ZJ6A 3PWGA 2PP3A 4BWLA 4JFMA 2INZA 4LX4A 5EFDA 1WBJA 4K8EA 4J4NA 3ZQ9A 1AODA 4PTXA 4MB3A 2PGEA 2VOTA 4AWEA 4YVXA 4I8YA 5HW6A 3CS2A 1VGAA 3K5XA 1CGVA 1R30A 4ICNA 4NAFA 4E3TA 4L6OA 2P4VA 3HFTA 1K7FA 2YBUA 1QWKA 4PUEA 4O2TA 3B9NA 4XAPA 2EBNA 3TTEA 1G6CA 1PKLA 2Y24A 1RBLA 4MG4A 4DQWA 1Q6UA 2WC7A 2GJXA 1XH0A 2GDVA 3NDZA 3PUOA 4GNVA 3H22A 3OYZA 1LORA 4XZLX 3B8SA 1LQAA 2BZNA 2A1YA 2GQAA 3SY8A 3SCSA 2D20A 3CO4A 1XIFA 2QIIA 3F4NA 4NQ1A 4G1KA 3LG3A 1YX1A 5IHSA 1TZZA 1PL9A 2WBKA 2ZWYA 2X7WA 3B04A 5A8QA 2WNWA 2XIOA 3KL0A 4HMDA 4E8GA 1N8WA 2PC4A 3F1QA 1TV3A 3QKZA 5CLWA 1DJZA 3GFZA 1M53A 3NZRA 1YLVA 3WBEA 4LCSA 3CPUA 2R94A 1YDYA 1M6JA 1TX0A 4MSSA 3F4DA 1L6SA 1XP3A 5JH1A 4CEXC 3F5LA 4FP1A 4NG3A 2ZQ0A 1K03A 2V81A 3P8IA 3KLKA 1KFEA 5K9CA 5D9PA 5A8OA 4PBFA 1S5MA 1S2VA 4DBEA 4FOJA 4WSKA 3PZMA 4MAZA 3B0XA 3LCWA 2EG6A 4Q7BA 4HZMA 5EMUA 3ZJ7A 3BJFA 2BXZA 2NV1A 3W1UA 1YBQB 1JCMP 2QJHA 2DT3A 1F4HA 1US2A 5I5RA 4NYUA 4DXKA 1UWTA 2WBGA 1LG1A 3BLEA 1KM3A 3NQAA 5KZDA 1E6ZA 1PHQA 3KLLA 4HSHA 1QI4A 3S47A 1RVGA 2PLKA 2BP1A 4NNRA 2BV9A 3W7KA 3GWQA 1VYSX 4Y6GA 1YATA 2FYMA 4A3RA 2GFTA 2D69A 2RDUA 3NTPA 2IS7A 3QMSA 4FO4A 2EXOA 2WSYA 4O1DA 1YKWA 1TPVA 4FNRA 1I0DA 3T81A 1XINA 3IIXA 1C7TA 4XG1A 3UWZA 4UTKA 1OFBA 1UR3M 2E6YA 4GD0A 2I17A 3REQA 3O5MA 3KW3A 2PGRA 5HUOA 7TAAA 1W1VA 2WVTA 4UTLA 2A6NA 2YA0A 5F2IA 2P76A 1E0TA 4Q6XA 3SEPA 1UPMB 1WPCA 1M03A 4XIAA 3B0VC 2DSUA 1VPXA 4HB7A 3ITCA 1K6WA 3MV01 5ABHA 4YTTA 1F73A 4X63A 4TV6A 2BGSA 4UQAA 3VGFA 1IXNA 4F0MA 4O8AA 5J6EA 1W17A 2PRLA 2V8ZA 4LAZA 4DRPA 4L4MA 2V5KA 3S83A 4KIEA 4IGMA 4PMXA 5FEWA 5C2GA 4HNLA 3PBVA 3A4WA 2QUNA 2Z29A 3F2DA 4NZFA 4UFMA 2DORA 1RA0A 3BW4A 5A6LA 4ZS6A 4O19A 2QEZA 1P5BA 1VJIA 3SUVA 4GC4A 5EMMA 3LUTA 3W02A 4IMEA 3VK5A 3W3OA 4UR9A 3V1HA 1PDYA 4LAWA 1EZWA 4MKVA 5JMUA 2CWNA 3N4EA 3CYJA 4AISA 4DO5A 2BVTA 2H9AA 2WJZA 1GQIA 2ITKA 1OSEA 5EBUA 2EF9A 3EBVA 1EFZA 4J1OA 1YW1A 4O52A 4YWIA 3CMFA 5DX7A 4PR4A 1IE7C 4PUDA 3NVDA 1UROA 4U3AA 3QRHA 1TO3A 4IPLA 3NL6A 3PZTA 4A22A 4R85A 3NGJA 1RH9A 3GM8A 4GBDA 4FXRA 3A4AA 1HIZA 1I8JA 8XIMA 5IM51 1D6OA 1M7PA 2CCRA 4HT3A 4HU0A 5FEXA 1XLFA 3POHA 1ZBVA 2Q3RA 3QGKC 2G37A 4H9TA 3O0KA 3WLPA 4JGDA 2CPUA 3HFYA 1JL8A 4RUBA 2CBVA 2HCVA 4NT0A 2YL6A 4MNJA 3GIPA 3GNPA 3WH7A 2ZUTA 5CZKA 4LAXA 1UBPC 3UT0A 4YU1A 3CL7A 5HWMA 4EPDC 1PSCA 1CGUA 4BQ4A 4C1KA 3FY1A 3SCRA 1YXYA 3O6DA 4AEFA 4NP7A 3BAWA 2UY5A 4YVVA 3DH7A 4XVDA 1E73M 2D2OA 1Z69A 4QJ4B 2OR2A 1H11A 3H4GA 1NWUA 1YADA 1J4RA 3C3UA 1QPKA 1X39A 2X1TA 3O0FA 4P7LA 3KVKA 1TCDA 4QDWA 4I7VA 2V3EA 3W28A 1HF6A 2PGWA 3WDHA 2A7NA 1C9HA 2XSAA 3IGUA 2XWEA 4M1RA 1I2NA 4DIPA 3ZO9A 3VKCA 1M9HA 3ID7A 4MPQA 4IUGA 2D24A 2X2GA 3TVAA 3VAWA 1KXHA 2QYGA 1IQ8A 4Q8MA 4IIFA 2QT3A 4S3DA 2A7PA 3QLDA 4X60A 1VF8A 4UQDA 4HPGA 3E5PA 1YNQA 4H2CA 3MKCA 3UI5A 5D75A 1B54A 4QP0A 3UVIA 1XDMA 4NZ4A 2DG3A 3EOLA 3PNZA 3RPDA 4KCVA 2ZZ2A 3IUHA 3W6YA 2PWVA 3DHFA 3EKGA 3KACA 1KM2A 3VZYA 1QDSA 3QW4B 2XYLA 4GINA 4TMBA 3MMDA 4ZB2A 3H55A 3H4XA 2BS9A 3FV9A 4C6BA 3WG6A 1L8NA 5DF0A 3TIMA 4MZ1A 4QJ5B 3WMBA 2VC9A 4RNIA 4Z1CA 4O28A 3BVJA 4BA0A 1P43A 4GVIA 4ZQPA 4MWAD 1JCXA 1H2JA 2G3IA 2R14A 3A5VA 4NU7A 3L7RA 1JZ3A 1KQZA 1VCGA 3ITYA 4V27A 3BTNA 3M7WA 4GZJA 4Z1AA 4DJFD 4HA0A 3AXMA 3BGGA 3FX4A 1F6PA 1Z8AA 4WRHA 4A4AA 2WJDA 4HZ8A 3CGNA 4O12A 3WJSA 5E70A 5DO8A 3IV8A 1W3LA 3VUPA 8RUCA 2WANA 4GGBA 5IBXC 3WFLA 1DHPA 3GDRA 3ENLA 3IACA 3CO8A 3TR2A 4HOWA 2HTMA 3UVAA 1RCXB 1B3WA 4ES4A 1W5QA 1SJBA 1KXVA 5H8MA 4UMAA 3B9DA 4JNMA 2O4QA 4ERIA 3R79A 4HN4A 3T44A 3IKGA 2ZQVA 2PF8A 3N4FA 1TPEA 1H63A 3R43A 1A5BA 3I3EA 2HJPA 1VCFA 1THFD 4IISA 3QH2A 5CSSA 3MMTA 1PXGA 1KFWA 5C9RA 5HNUA 4H7VA 2BX7A 5FF4A 4H6RA 2M1IA 2F2DA 3G77A 1QNPA 4M6PA 3B8IA 4DWSB 3Q37A 2XH2A 3ZLGA 3GAYA 5CC3A 3ORWA 2GGGA 1D2KA 4GG9A 1KR0A 1TPC1 2OG9A 3UA4A 2JIEA 4UIOA 3WNPA 4GUGA 3WCZA 2GGEA 2AMGA 2G3NA 1LJYA 4NIRA 3PK7A 2A4AA 4ZQCA 2P88A 2IXVA 6TIMA 4FIQA 4XAKA 3W1PA 4IIBA 2CITA 4O14A 2V5CA 4NNCA 1H7RA 1ZCCA 4C02B 5MKGA 4MJMA 2PV3A 4XO6A 3ARTA 3QV8A 5TIMA 1UQYA 1RLDA 2HS8A 4JBRA 1K8ZA 3NL5A 4FR6A 2HBVA 2Y70A 1DTNA 4G1NA 4WF7A 3OZOA 2V0TA 1A4MA 1DWFM 1CGWA 1TMLA 2J13A 3GHRA 4LFYA 1KM6A 3F4WA 3ELFA 4GIRA 4ATWA 4WJXA 1GJPA 2CWXA 4G2PA 3M4HA 3M5ZA 3AHXA 4AZ5A 5A2BA 5M2FX 2FIQA 4NUWA 4Q7IA 4QCFA 2OYKA 2YKKA 4GI9A 1ZBWA 4XQ6A 1NMWA 3G18A 3DHDA 1MFUA 1R46A 1RJRA 4XD6A 1XRTA 4H00A 3QFWA 1TPH1 2H3DA 2HNEA 3RFAA 3TYEA 3K1GA 1I9CB 4P7NA 3I4KA 4NX5A 4O4WA 5HTGA 5ENLA 5CSUA 4DRHA 3L5AA 3QPYA 3T0BA 1GNXA 1RAKA 5AY7A 4HHMA 2I5GA 3MJYA 1K70A 5D37A 3H24A 5IFTA 2XPAA 4Y9PA 3PNUA 5GQBA 4ZQNA 4JTUA 2QDGA 4X2PA 4NJKA 4LALA 3VIGA 3LEPA 1TJPA 4RJEA 3ZT5A 3ZJKA 1A49A 2GJLA 1DQWA 1J5SA 3VO0A 3MBFA 5FJPA 1X98A 1FWRA 3UR2A 1GORA 1PO9A 1FKIA 1PKNA 4DVOA 2FHCA 2OZ8A 2CYGA 3VFCA 3L4YA 4DYJA 3OA3A 2BY2A 1XLIA 4NZ3A 4S23A 1F6YA 1QTWA 2J9YA 3VNMA 1L6WA 2GWNA 1A3WA 2E1WA 2ACQA 2XIQA 3UZWA 1OVDA 5F1UA 1G4EA 3UXLA 1N2VA 1P6WA 3GQYA 4QT2A 1K9TA 4J3WA 4I7WA 4LV9A 4W7VA 3HPSA 2WCGA 3KOYA 2HROA 3RN6A 3A23A 3W7CA 1XGZA 4GUJA 3W7OA 3MW7A 3LM3A 1MYRA 4LCQA 9RUBA 4RLIA 3BZGA 3KRZA 2ACUA 4YXGA 3ABSA 3G3DA 2PDGA 4NILA 2E09A 5LYRA 4DB7A 2YXOA 3UP8A 2GVLA 4CQDA 1GVEA 4QRNA 3FAXA 3HOJA 3P14A 3O63A 4Y8EA 7ENLA 2F8QA 5A94A 3S8HA 3HG4A 1ONEA 1IEIA 1C91A 4YYCA 1KWGA 3ARRA 1LRNA 2GQ9A 3OGRA 4GQGA 4ZE4A 1KT1A 1EIXA 3RX3A 1NFPA 4PFMA 1OC5A 3AMKA 1J18A 3BW2A 1OD8A 2J88A 2VFFA 2IW0A 5DMLA 1QT1A 1ME7A 2WMIA 3H7RA 4WKHA 5HKGA 1NF7A 2Y78A 4D6CA 2ZUMA 4Q3MA 3MT1A 4KFNA 3KVMA 3M43A 2O9PA 3VOGA 4UQCA 3WH9A 1ZCOA 2Z1SA 3MI2A 5DBTA 5DFAA 5KMYA 2ISFA 3GG1A 3V5OA 2PWGA 4IQCA 3KDOA 3PBUA 4Q8TA 4D1IA 2XISA 3L4XA 2XVPA 1I2OA 4C91A 3D3AA 3FDKA 3M0IA 4R34A 4XAZA 3VA8A 3LBMA 1AVAA 4RE4A 1XW8A 3B05A 4JFVA 4JFLA 3TWAA 3OGSA 4O17A 3SIMA 3H2CA 3CPGA 3EB4A 3W7QA 2PBOA 2PPPA 1IT0A 1GQLA 4KFOA 1DIDA 3UU0A 3GUGA 4Q4RA 3WLOA 3QBUA 3RITA 2VO5A 4ZMGA 2VFGA 3LHWA 1NWRA 3WD1A 4RX0A 2PTYA 1ISWA 3KCOA 3M07A 4OBTA 2W0UA 4GACA 2A3AA 3NOYA 3BANA 2UY4A 4H2HA 4BJHA 3TCEA 2V6AA 2DUAA 3P67A 5A6SA 3BSHA 4WOQA 3WLQA 2DZPA 4O0ZA 4HZ7A 5LA0A 2DZUA 2Y85A 4KCUA 3N25A 1W0MA 1R3TA 1FDZA 2GVEA 4FZIA 1F5ZA 2DDXA 1QW7A 5GJPA 5J5DA 3TU9A 2YCKX 1F61A 3TYAA 4ROPA 1ISYA 1S5VA 4W86A 5EA9A 3W7EA 3I7QA 4E6MA 4QGCA 3WEMA 3IUDA 1NJJA 1ZJBA 3GD6A 1FWDC 2DZVA 4RV3A 3U2ZA 5HA7A 2TSYA 3VNJA 4WLCA 1LYXA 3SURA 2A0NA 2C3ZA 3QY7A 2QLYA 2B0MA 1FTXA 1U22A 4U86A 5GNZA 4DBUA 1YNYA 4ACZB 2KX9A 4C6OA 2NQZA 4US5A 3BSMA 5JVLA 3EPNA 1NDWA 1F05A 2GYIA 3N2OA 3FHAA 3WH8A 2EAWA 4WDTA 3HV9A 4GX8A 4LQ1A 4ZB5A 2DT2A 1TUFA 3VKJA 3RLHA 4KERA 4UNKA 1PVNA 2PDIA 5CBBA 4AZHA 2PGFA 4QQ3A 1UYQA 3C56A 4GIEA 2J6VA 4GXWA 3WLLA 1EEXA 3UZXA 2C7FA 3E0VA 3L23A 3W7PA 5C6MA 4KIRA 3AMGA 3QOKA 1VENA 4GC3A 4BI7A 2DV0A 2O92A 1T40A 4PMRA 2EPMX 3TTSA 1GOOA 3VGGA 4MWAA 4RXFA 2O56A 4UOQA 1Z44A 4QS5A 2ZZ7A 1QW9A 2Y7DA 3TQKA 3NO3A 4CN4A 4HGXA 3PR9A 1H5VA 3AYTA 3DFQA 4F2UA 3MMWA 2O9RA 2DZSA 3ZWSA 2E7FA 3OW1A 1G7VA 1G5AA 2RQSA 9XIAA 4B5VA 1XYZA 2ZWZA 3GAKA 1FP9A 3LLFA 2QJIA 3DYPA 2WMHA 1TWZA 2P5NA 2DIEA 2GSEA 4H4IA 5LIXX 4H3DA 4Y9NA 2YDAA 4W9QA 4Z42C 3P0XA 3TYBA 1CYGA 1G1YA 2DP3A 1GYNA 1FWWA 3MO4A 1NF0A 3W37A 5I02A 3SQLA 2C79A 3LDVA 5AECA 4IQEA 3C0QA 4JHMA 1QHZA 1FVPA 1YDOA 4QE1A 3T4CA 2I5QA 2PRHA 1QCWA 3S5YA 5L6UA 5DT5A 1UD8A 4K2SA 3V3WA 1Y7VA 3GH5A 5DN1A 1KR1A 2PDXA 1SO6A 1KBLA 2UBPC 3W7DA 2JIWA 4PUWA 1XCWA 1BPLB 4C5ZA 1WOBA 4L9ZA 4HQVA 1Z89A 3KX6A 2WKGA 3A3HA 2O9TA 2QCDA 4EXBA 4X0VA 3SSZA 3RMEA 4UTTA 1H0IA 3N6JA 3CV1A 4F0SA 3NQ7A 2OFJA 4PUNA 3W83A 1XPYA 3W7HA 3LB0A 3TC3A 3TYUA 5I09A 4OU1A 3PAJA 3UWYA 4MB4A 4NNAA 3CPRA 3U4AA 3CAQA 2AGKA 4BF8A 4HNOA 3CQKA 3VIOA 4J3TA 5KEZA 3QQ1A 1X1NA 4MFDA 1Z6KA 4HOXA 1CXIA 4W4QA 2IQTA 1RHCA 2PTZA 3UWEA 1T99A 1V0NA 2DVXA 1O95A 3VE7A 1PJ9A 3U7BA 2F7FA 1TELA 4AXNA 4ROQA 5D8ZA 3URNA 3GIYA 4JFTA 3SFWA 3T0CA 2H8ZA 4A8RA 2F2KA 5I06A 2UV8G 4FB7A 2HNHA 3KS6A 1BSIA 3O5GA 3FOKA 3S9YA 2PWUA 3S1GA 4LOCA 4V1YA 1FWJC 2J77A 1E56A 1EGZA 5HUAA 2B7PA 4JHOA 3GUWA 3SBFA 4UDMA 2ZA2A 1FKDA 2Q5AA 2CLOA 2V67A 1V51A 4MLRA 4A2RA 1JUEA 2VXNA 2O0TA 3IJ7A 5CEWA 2QCNA 3LNMA 1TA3A 1A7XA 3KBMA 2B4GA 4LBSA 1C9DA 1ZSXA 2QCEA 1XIBA 1OX4B 1M68A 3IIOA 3MCOA 3NXLA 1BGGA 4HHHA 1FKFA 1KC7A 4DBDA 4NJGA 2QXWA 3ITVA 3TW6A 3PJTA 4XTIA 4DZ5A 1VQTA 1AJZA 1LOQA 3TYDA 3MQTA 3F5JA 3N13A 5F4XA 3WZ0E 5LNRA 4RE2A 4MSPA 4XV0A 1W31A 1KGXA 1NIUA 4Q7NA 2VM8A 3Q67A 4LANA 3RFWA 2F6KA 3WUGA 1Y8BA 4Q4PA 2Y5EA 3Q2DA 5CZJA 5BXRA 3TJXA 1FKGA 5IHRA 3UG8A 2BY1A 1HKWA 1J12A 3ATYA 3SW6A 3I3BA 2Q6ZA 2EGZA 3GU1A 3WLMA 2NXGA 3G3MA 4JAWA 4IPXA 3AHTA 3LBCA 3QV9A 4Z08A 3VC6A 1F40A 3PM6A 2A85A 3CT2A 3EDDA 2RUCA 2HWGA 1Y0EA 4ECLA 4FN2A 3DEQA 3V4BA 2XGIA 3NDOA 4U5KA 1T8XA 1TJRA 1B1YA 4WEVX 3GG0A 4H7CA 3RU8X 2GGIA 2WPBA 3NCOA 2YYUA 3M6YA 3VOJA 4Q6JA 3FN9A 1CW2A 1D7KA 1EYMA 3L4VA 3STFA 3PA7A 2D1ZA 1V3HA 3P5YA 3W72A 3HU7A 4BWLC 3AZSA 3CJPA 5D9MA 6REQA 4WY0B 3T1GA 3MYPA 3T0AA 3LI1A 4BI6A 3EKLA 4G9PA 3QN3A 3WBYA 3FA4A 5AC5A 1T11A 2C91A 1PZ1A 6XIAA 1Y0OA 1NU5A 3CUFA 3FLUA 3C2EA 4JTLA 2FH6A 4JYEA 3W1AA 4R33A 2JF7A 1ALDA 1MZRA 2VGGA 4WVXA 2OT1A 2VFDA 4NKCA 4DF0A 3RU6A 3W24A 4LUJA 5ABTA 2Y63A 3LD5A 4Q8UA 2WMIB 4QEEA 3SCWA 2J4GA 2J6XA 2PCEA 4IGSA 5LA2A 1FKBA 1KBKA 5AC6A 3PRBA 4LYRA 2G50A 2PB1A 3OG3A 2Z6JA 3PZ9A 3ZFHA 4P61A 2G4JA 3HMCA 1JNSA 4DT4A 5TD4A 5HXMA 2C19A 3SADA 3M1ZA 4DEFA 4JFWA 3VDGA 3N9RA 1XG3A 1VC4A 2GK1A 3SECA 4ML9A 2JEPA 3LXBA 3W7LA 1R7OA 3NEVA 1Q5MA 3CL8A 2CW6A 4AZ7A 4ZO7A 4N2YA 3NJ3A 1CDGA 4WSJA 3P93A 1UB3A 1Z3NA 1UZDA 2GDUA 3I6RA 1UW9A 1EP2A 3W7RA 1PZ2A 2NUWA 2L2SA 4TMCA 3MP5A 5T8GA 3RLUA 2XH0A 6XIMA 1Q85A 2Z7GA 1EC9A 1XQLA 4MJ2A 1DPMA 5SWUA 1DOSA 3UJRA 3MVTA 5HQLA 3K4WA 5AVHA 1OC6A 3MV11 1V6UA 2WKJA 2BLEA 3CHFA 1HN1A 4G2DA 3EPMA 1UWIA 1E6XM 3WBWA 4FEZA 4G7EB 2ZFAA 5H1WA 5BRQA 3BG9A 5I2UA 5CPNA 2DU2A 1GQJA 3M0KA 4FMVA 3HA1A 2PDUA 1EYWA 3KCJA 3O9NA 4ZPWR 4WY0A 2HV5A 4UBPC 3R10A 3UZ5A 4NL1A 1DBTA 1V93A 1SW3A 1TPFA 2XVLA 5E5CA 3VOIA 1OGSA 2E6AA 4ZQOA 4OE7A 1L6FA 1QAPA 4PCSA 1TVNA 1RALA 2OQLA 5CG0A 4L72B 2DH2A 3BQ6A 1EL3A 4YS1A 3SIZA 1YE6A 4JEJA 2E9MA 4NJHA 1B5TA 4GGHA 3G22A 5M17A 4DAIA 2OKOA 3CIXA 3D5HA 3VZZA 1JF6A 3L21A 1EJ7L 1RBAA 3PBYA 2DPEA 4IMCA 1ISZA 2RGMA 1W37A 1W5NA 2ZZ4A 5A6BD 3J7HA 2EJ1A 2WJFA 4H04A 4NXKA 2LLEA 2ZRVA 1BKFA 3K8MA 2WWDA 2DIJA 5CCZA 4J7RA 4KETA 5D05A 3N04A 4IJBA 2HVOA 3CMJA 3IGHX 4ADTA 3I6EA 4B5XA 4FLOA 1XIJA 4B2DA 5HWBA 1UZ1A 1HL2A 1EKOA 2OKTA 3L0NA 4QR6A 4HPJA 2PP0A 4GIVA 1X6UA 1H60A 3PTDA 4M29A 4DXVA 1AK5A 4C7GA 3OPSA 3DFHA 4GIYA 1O1ZA 1JPDX 2J9XA 4UNLA 3GTHA 2DH3A 4U31A 1YXDA 3HURA 4UTFA 1VS1A 4QE4A 5DMNA 4J2PA 2DSKA 4K3ZA 5EMYA 1QNOA 1UR8A 2PA6A 1XGEA 3XIMA 3TZNA 3RM9A 4H8VA 3RF9A 4AUBA 4IMGA 5DCEA 2HSAA 1TIWA 4JYFA 2VRJA 1VKFA 1AUSL 7REQA 1CWYA 1Q3NA 1WKDA 4XAYA 5HANA 4GYKA 3N4AA 1EUAA 1GK8A 4C6EA 4K68A 1E3ZA 3WFZA 1N8FA 1WYIA 3O3RA 1QR7A 4JTSA 1TWIA 3L4ZA 2W4XA 3E38A 1KFKA 4ADUA 4F3HA 2WMKA 3BLDA 4H9MA 1ADOA 2W62A 3GG8A 1K1DA 2IF4A 4WQ6A 3I7RA 3TH6A 3LTYA 4HJWA 3R0DA 1B4EA 3VIMA 3VDAA 2FHBA 3JXVA 4HMCA 1VFUA 2E77A 2J7DA 1SVDA 1SFJA 1C8YA 4QDPA 2HZGA 4Z0JA 2V63A 1Q7QA 2VTFA 1Q1CA 3OG2A 3TQPA 4C7FA 1AW1A 3LSCA 3W00A 4JNZA 2J7BA 3KADA 3SN0A 4JD4A 2H8XA 3FJ6A 4FX7A 2HISA 4RDVA 1FH9A 3CHVA 5J04A 1POKA 1YPXA 3QOMA 2BMBA 1MWOA 1HNYA 3WF0A 5CLTA 4ZPVR 2VNCA 4BF9A 3BOFA 3AMDA 2FJUB 2EPHA 3W07A 5C71A 5FIPA 2GUUA 3QLLA 2ISDA 2XP7A 3GYCA 4M24A 4IH3A 4LGXA 4W5UA 1QPOA 5HNTA 4PTVA 1TV8A 5HDRA 2VFIA 3LHZA 4JCMA 1U79A 2GOUA 1LRTA 3G1VA 1UWUA 3KZSA 1IEWA 2CBUA 5BU9A 4CVUA 3FHQA 2CC0A 3LSBA 1DTUA 4A6GA 5DIVA 4DAFA 5EGRA 2ZA1A 5FF2A 2VX4A 3S6DA 3OLDA 5FEZA 1BG4A 3U5UA 3IEBA 2HDJA 1ZJHA 3AYSA 2BXVA 4MMWA 3DYOA 1XBZA 4INFA 1AMKA 3OO2A 2YFNA 3MA8A 3T40A 1SUXA 4RNJA 1DWAM 3AXKA 4JDYA 3N18A 3DGBA 4JKLA 5H6HA 1UR9A 1Y65A 1PYFA 1SSDA 2WZEA 1MFVA 1ADSA 5DY2A 2C14A 5U7SA 1AD4A 2BG5A 1LF1A 3QTPA 3CHDA 3A3WA 4AF0B 1X1OA 3NPXA 5LNWA 2YW3A 3FKKA 4LJ3A 4YTUA 1F3XA 3QTGA 2QJJA 1GZGA 3ARVA 3ARYA 3IJDA 2X1IA 1MW0A 2DFAA 1J93A 2XZ7A 2BODX 4QG6A 1K02A 2CKSA 1BLIA 4HU4A 2VKZG 1XICA 5AN7A 4XD5A 2QF7A 1TKKA 5DANA 2PDCA 1SW0A 3PHAA 3FDGA 4WXYA 3TCZA 2VMFA 3AMCA 1FKHA 1X6LA 2Z4GA 3LPPA 4H41A 3MUZ1 2ZUSA 3ZLHA 1LG2A 3GDLA 3M0ZA 3SJ3A 1SFSA 1M5YA 3W7NA 4DUVA 3MUXA 2CLKA 1HVQA 1EQCA 2E8YA 1J0HA 5AHFA 2CERA 5IFPA 1NOUA 4O10A 4E5TA 1M5WA 1OK6A 1TCOC 3OYXA 3NO1A 3ZR4A 1Q45A 5LHFA 4AQLA 2PZ0A 1MEHA 3LMYA 1CXHA 4LXFA 1JF5A 4KGJA 1I60A 4DRJA 1W8SA 1DEDA 4TOQA 3VI2A 1CCWB 1KM0A 3CWHA 1AL7A 4DN1A 4PTWA 4D71A 1IXQA 1JR1A 3N12A 2A79A 1H7PA 4LNCA 3U3HA 4IQ2A 4PMZA 3K46A 3CHCA 4BI5A 3IUIA 1SFLA 2QVNA 1ONRA 3FK4A 3U0HA 4DUWA 4UFKA 3WK2A 1ECQA 1W3KA 4HNUA 1TV5A 1XKYA 2MF9A 3K30A 1FH7A 2Z1KA 2J7FA 3PC0A 3ZSSA 1LUCB 1MZHA 4S3FA 5LZLA 3GR8A 1NELA 5E1QA 3NIYA 4Y7EA 4LB3A 1XR2A 2KGJA 2WB5A 4DRSA 2CXEA 2G96A 2R82A 3JZEA 2DQWA 2DSVA 4MOZA 4EK7A 3W87A 3BLPX 3GHTA 3EOOA 1W9BM 3PZNA 3AIVA 3TTQA 3NQDA 1CXEA 2VZSA 2ZCGA 3O8AA 1C9WA 4HOZA 3NQGA 5EBAA 1HXVA 1B0IA 2QPUA 3H6OA 5A69A 3MUCA 1R9ZA 3KVLA 3L4TA 3SUTA 1FCUA 4PEEA 4G50A 2BOGX 4PYSA 1R8LA 1XF0A 2ZR6A 9CGTA 2ZDSA 1PAMA 2PU1A 3WL0A 3HQ1A 4ONVA 2YDQA 1ZGDA 4YLWA 4JTIA 3NG3A 3V16A 1R86A 4M7TA 5HT1A 4CCCA 3K2GA 2KZHA 3YPIA 5HBFA 5CJNA 4E4FA 1IXPA 2Q8ZA 3LQLA 2E6FA 2IKGA 4J3ZA 1GTHA 5JBDA 4W93A 1LQ2A 5I7GA 4B91A 5GJMA 3UI4A 2V38A 4Q8VA 5A5WA 1UKOA 4MDPA 4DZAA 3OOQA 1RY0A 1GVQA 3CZGA 3VIFA 4AEOA 2HK0A 1EPXA 1JRCA 3A6OA 3W82A 1WXZA 2VELA 4QLLA 4J5NA 3UETA 1UASA 3WO8A 1D8CA 3UG4A 4CD8A 1J0JA 2HBXA 1FRBA 3K8LA 3LN3A 3JVAA 4NYYA 4L6DA 3MUIA 4X3ZA 4HBKA 2RHGA 4DIAA 1FWAC 4GNJA 4Z17A 1VHCA 1M04A 1KKOA 5DT7A 4F0HA 4Z2LA 1RZMA 1EWEA 3UPMA 3QGVA 1LL6A 3U57A 1HFBA 4PMNA 2GSJA 3KOWA 2AMXA 1R5YA 3MDYB 4N9CA 2D9FA 1F74A 1R2SA 2NQHA 3LXCA 3KTSA 3KXQA 2PN0A 1W5PA 2PTDA 3RCNA 4GMEA 3DBPA 4LAYA 3THCA 1F9CA 3DCPA 1A5CA 3TSBA 5LGXA 1T7LA 1AZ1A 3BOXA 1E6RA 4OQVA 1D7FA 2PPGA 1E43A 4AVFA 1D7HA 2WJEA 3EXSA 1UR1A 3TZFA 1BVZA 3B97A 4ZOAA 4JKMA 2XP9A 3JUGA 2PMQA 3GTXA 1GJUA 3M5VA 3NAVA 1X8FA 5I0DA 3B03A 5I00A 4GJJA 2RURA 5AC8A 1FHVA 4YHEA 1A3XA 1CZ1A 1EHAA 3A9BA 1EJTC 5CJ5A 4HCDA 3O5OA 4ENLA 3SB0A 3HV8A 4GO9A 2P3ZA 1TG7A 1KD0A 4WJEA 1YE4A 4O54A 3CUJA 4LS2A 3LHTA 1VZWA 3H26A 4LAMA 4GIAA 1XYLA 2DG4A 2CETA 1MUWA 1XYCA 1KLZA 3S6OA 2PDFA 5F4SA 3TC6A 1QI0A 3RCMA 2VCAA 1JDEA 1S1RA 3MDWA 1OZQA 4QCEA 1E6PA 2XN1A 2ATMA 3AS0A 3D0CA 3WMLA 4LUTA 1N55A 1W1TA 2VZUA 5E9AA 1GT8A 1QPRA 4I9TA 1SZGA 2RDTA 1WXJA 4ZENA 4ML4A 2E9LA 5HNRA 3R4IA 3TOPA 2X8RA 2FB3A 3M0YA 2Q8LA 4J27A 2E4TA 2X41A 3V0TA 3REQB 4C1LA 1XLBA 3GHSA 2A3HA 4RZ5A 2WXDM 2PODA 1B3XA 2E25A 3EA2A 3EGJA 3PF3A 4OOZA 4Q22A 1F3EA 5BXJA 3LTPA 2J66A 3LM7A 3VOHA 3GLCA 3OVRA 2QCGA 3HGRA 4R7OA 4F48A 1ISVA 2BFGA 2YCLB 3ANVA 1V6VA 2ZQSA 4PBEA 1PIGA 2CLPA 2ZADA 3V36A 3TDBA 4S2CA 5AHIA 4GFSA 2C1HA 3M46A 4CEUC 3AWOA 3MUY1 3IIZA 3H7UA 1HXJA 2OZ3A 4ORIA 1A5OC 4XB3A 3TEVA 1XG4A 3MJMA 4IIDA 1FWCC 1Z7AA 2UZ5A 4DWSC 1DV7A 3G8EA 2D0GA 4YTSA 1FWHC 4GQRA 5FJRA 1ZAHA 1UUMA 3P60A 3D47A 4MWAE 4D72A 1QOQA 3W7GA 4NAEA 1DWJM 1GCYA 1ICSA 2RJGA 1E3XA 2EKCA 4AD3A 4ORMA 3VOFA 3AZRA 1VBJA 2WV8A 4C6CA 1GGOA 5D33A 3M0JA 3GTNA 3STGA 3JYMA 3NQVA 4WKFA 1H62A 1ONWA 4DUXA 4YTQA 3PJWA 3N2CA 3PPGA 3LGGA 3AHVA 4D8AA 3B40A 2F2HA 4PCPA 3MVIA 3C61A 2RGLA 4MDOA 1GG0A 2DUXA 3PRAA 3G8RA 1W32A 4K8HA 2O9OA 4HHPA 3TROA 1JZ7A 2P0IA 4S2BA 2X7VA 2GGHA 2QDHA 2P0OA 2X16A 3MS8A 3ZS4A 3GKAA 3W7IA 1FH8A 3FYYA 5A6BA 1UD3A 1ROUA 3LA4A 2WM1A 1S1PA 4GY1A 1U5VA 2DUZA 4F4RA 3V0SA 2FZ8A 3H4WA 4JTHA 4KQNA 4GQQA 3VDHA 1UWQA 4PC8A 3NM1A 3WK0A 4WCJA 1WAUA 2X0HA 3PUDA 1HO1A 4DPQA 4OVXA 4BY3A 1GEQA 3OB8A 3RR4A 3ABXA 4JQ1A 3BGJA 3M0LA 4J3SA 1W2PA 1CNVA 1GPFA 5LIYX 4K37A 3C2YA 1JDFA 5D2TA 4MZ8A 3W23A 3D3FA 4CQ9A 4Q32A 4Z2KA 2XUCA 3MBDA 3SUUA 3KVJA 4IIHA 2PI6A 1PYMA 1YTKA 2C0AA 1R3SA 2EEXA 3CU2A 3QR3A 2GVGA 2PAJA 1WBHA 4PUJA 4HNNA 2F4EA 1SO3A 4EF8A 3B0UX 4L65A 1RV8A 4U3CA 3SY1A 1FWFC 4RE0A 3RJYA 1HP4A 3GC5A 2C1GA 2C18A 2VX6A 5C7VA 2LGOA 5I77A 1QMLA 5T9CE 1R9XA 4H9ZA 2WVVA 5DLCA 3DENA 4JQ3A 3W1LA 1PS9A 4RDZA 2XPBA 2PDMA 3F4VA 3NQFA 1O6IA 2FTYA 1EQPA 3TV8A 4ODRA 4WGHA 1TWWA 4PEKA 1ZLPA 3O5JA 3OOBA 3JYJA 3PG8A 3SI9A 1XS2A 1ZU8A 4GA8A 4LCRA 3BXWA 4L56A 3IGXA 3LTSA 1DWGM 1JIBA 1IEQA 1E5NA 1XFCA 3WK1A 5A6JA 4AU0A 1KBIA 3H2AA 2FGZA 1R3RA 1J01A 2DZBA 3SGGA 2BY0A 3SR7A 4PN2A 3H54A 1G0CA 1OADA 4ZSTA 2HS6A 3S2MA 3TQVA 3VNYA 2PDLA 1YNPA 5AHMA 3WL1A 3AI0A 3U2OA 1FWTA 1CXLA 3CMGA 3F5KA 1LQ0A 4MWAB 2W9MA 3TJ4A 2Y8KA 4IMDA 1U30A 1NTHA 3EMCA 3MPGA 3A24A 5E6YA 4BEUA 5CPLA 1V03A 3WQGA 4TYOA 1H7WA 2ZRXA 3S42A 4EWND 4CU7A 3A4XA 3WFAA 5ABEA 2Y2WA 2OCZA 1E51A 1CB7B 4XKYA 2VURA 5K7JA 2XHYA 4H01A 2EPKX 3CWNA 2IPWA 3U48A 1JDDA 2GQ3A 3UW6A 1GQKA 4YWSA 4D8ZA 1VLWA 4MIMA 4OBRA 4NI8A 3HQNA 3B3DA 2FB2A 1NP2A 3AQUA 3HPFA 3NUKA 1IIGA 5XINA 2W92A 2YB1A 1E6QM 1OEPA 1GVIA 5HQEA 3KBSA 3PANA 1F76A 3EDKA 4MYXA 4HBOA 4AX6A 3TC5A 4AC1X 4F0LA 1BWVA 1SJDA 2PWEA 2JFEX 4GI4A 5HK4A 1A5LC 4P5UA 3PUEA 2I5IA 4GPNA 5K3VA 3GFXA 3UGVA 8A3HA 1QI3A 2J7EA 5A6KA 1FFQA 2X0YA 2WVSA 3TFCA 2E9BA 5C70A 4U85A 2PE4A 5LNSA 4HKPA 4JN8A 1YDNA 3ZMRA 3C0SA 2FKEA 1VCVA 3TK7A 1W1PA 3W01A 3E0FA 3OQ8A 1OYCA 2A6LA 4AXKA 3LZ3A 2XU2A 4Y9OA 4QJ1A 2VRKA 2PC8A 1NQ6A 1F8IA 1OIFA 1W9XA 1VBGA 3N2MA 2ZUWA 1O68A 4JZ5A 3TW7A 5BOFA 2OZTA 4JOMA 3WK3A 1TMHA 2V5LA 3K4DA 2HE5A 4FI4A 1XYFA 4FXFA 1IR1A 1XD1A 2AL2A 2PF0A 3VMNA 2WQDA 1PIFA 2ZOXA 1Y5WA 3I6CA 3F7JA 4KRUA 4DF1A 3ANUA 2WSKA 4W5ZA 4M51A 5CC7A 3CV2A 4B5WA 1V3MA 4JL2A 2ISVA 1ZBKA 2VZOA 3RX4A 3G1HA 5G5IA 3VAVA 3GZ3A 2HMCA 4GUIA 4GVGA 5B7YA 1K9EA 1OM0A 2BGQA 3CV7A 2XFYA 3CQHA 1NARA 1IWBA 2VC7A 4IT6A 4S3JA 4TW6A 1K9FA 1A47A 4AC7C 1X38A 3JRKA 3SO7A 1JPHA 2D0FA 2YIHA 4GVFA 2A3LA 3RLVA 3VNDA 3B8DA 3K13A 4B3KA 3CEPA 5ABFA 1PDZA 4EWJA 3BCJA 2V3DA 1QPFA 2WC4A 3SAZA 1O12A 1S5WA 3ZZ1A 1GJWA 2PPOA 1QU4A 3VCRA 4N19A 1XLHA 3E2RA 5AYBA 4DF2A 5JIPA 3GXPA 5KSWA 2ZX5A 4XD3A 2I14A 3M6DA 1KCXA 4ZTYA 1MNSA 1AFSA 5HW8A 3L66A 2QMKA 1UP3A 4AY7A 1X7FA 1WP6A 4DJFC 3VILA 4M8UA 1J0YA 4MJ4A 3P6LA 5DCBA 5MHBA 4I5UA 3IWPA 4DM1A 3DU0A 3ABQA 4QHRA 4TW8A 5HULA 3ERPA 3ONCA 5FJOA 4UQ9A 2GDQA 4P7QA 3KHJA 3PB2A 2JGQA 4O1CA 3WF1A 2VD8A 3HJZA 2OU4A 1T0OA 3EDFA 3R58A 3DOPA 4IGHA 2WWCA 3ZOAA 3UY7A 4R7WA 1OCNA 3UQAA 5TAOA 4IP5A 4UR7A 3B9OA 1BXBA 4JICA 4ACYA 3SUSA 2OMAA 4KCWA 1ICQA 3A21A 1NWTA 1RD6A 4BEQA 3ARWA 5DEZA 1RD5A 5B8IC 4F8XA 4J4OA 2J47A 2QDDA 3DIPA 2MNRA 3ITOA 4J9JA 4RNHA 1O5QA 1QOXA 1JCJA 2Y5JA 2Y7FA 3HZ3A 1JPMA 2W27A 3N29A 1BF2A 3BO9A 1O1HA 4NAEB 3WQDA 3S1XA 4IZGA 1Y5XA 5A6AA 2X42A 3SCUA 1PKYA 4LVFA 1XYAA 3GY1A 3SCVA 1HKVA 1XV8A 2ZUVA 1UH2A 4GRSA 6CGTA 2A21A 1PX4A 4KT2A 1SZNA 4A21A 3WDIA 4GO8A 4LWWA 2FTPA 2XWDA 1JEZA 3QSTA 1LRQA 5BMXA 1TVPA 3OZYA 3EB3A 1JCTA 3O6AA 4HPHA 4HU8A 2NLYA 1QNVA 4MKNA 1G4PA 2GJNA 1LWHA 4NZ5A 3FNDA 2FLIA 1DXEA 2QKFA 4LC8A 2R1PA 3GXMA 1MEWA 1HJWA 1RQHA 2VEFA 2J7CA 3HG2A 5JBEA 3STPA 3CHEA 3GVWA 2RUSA 3I6TA 3QMTA 4IXXA 2RDXA 1QHPA 2WHLA 3PFMA 3OBAA 5M03A 1L2QA 3UZZA 1EC7A 1JAEA 2JKEA 1A80A 2L5HA 1NH6A 1KRAC 4LV4A 1QWGA 1S3HA 3QR0A 3OZMA 3TA6A 2CEQA 3SQSA 5JQ9A 8CGTA 1JG9A 4S38A 4RDYA 5GNXA 1QNQA 3MSYA 4CUCA 2X1SA 5AB3A 5FAJA 4MY1A 3UNDA 4JQ4A 1W3IA 1GVRA 4AYGA 1EDQA 1QBBA 4JCLA 2VYOA 3GW0A 4H7ZA 2QUVA 3DG6A 2PU0A 4NZCA 3CBWA 1YHTA 4YIWA 9XIMA 4AW7A 1DHKA 1QNSA 2PFHA 3N9SA 2Q09A 3W2JA 3R8HA 3VIJA 4AVOA 1ELSA 4NHVA 4A3HA 4E8CA 2P53A 1EEPA 4EAMA 1EBHA 3RYSA 4R9OA 4QTGA 5I23A 5GPGA 4IPIA 3B9EA 1Q6LA 4D6IA 3W27A 2OB3A 3N15A 3CEUA 1JPIA 4F0RA 4XZHA 4C1NA 3FCPA 4O50A 3T78A 1J79A 4OV9A 2GWGA 4UQBA 3MYOA 2OWWA 1Q6DA 1AJ0A 4Y9AA 3DFSA 4IPNB 5DMMA 1TWDA 4JDBA 7CGTA 2ZC8A 3G2GA 1IZJA 1J96A 4YTRA 1UHVA 3GXFA 1R9YA 3UR5A 1WB0A 2BY3A 3M47A 1VBUA 4P7OA 2E68A 2AOSA 1IZKA 3IKDA 1JCNA 3M5YA 5KETA 3AIWA 2PDWA 1XQKA 3KHDA 4J3VA 4L4PA 3IVSA 1X1ZA 3SRFA 3AS3A 6ALDA 4AG0A 1M3UA 4CU6A 3S3GA 2E5CA 3LK6A 4RW5A 4URIA 1JD9A 3UBPC 3C2OA 2FMNA 4O13A 1G7UA 2Z7KA 4HTYA 5DELA 4BFAA 5JU6A 1ZNNA 4H8UA 3GRIA 4UCFA 1YTDA 2BVDA 3Q94A 1OWQA 3BAXA 4IPJA 1TIMA 4HMNA 4D6HA 4JS3A 1JYNA 4JFIA 1D3GA 1UA3A 4F9DA 1UZ4A 4D6JA 4YL2A 4AMCA 3L2LA 5F2LA 4FIRA 1MUMA 2RUQA 4HYVA 2BXYA 1T6MA 4KEUA 3R11A 4BQ5A 2EHHA 2KI3A 4XVEA 1TV7A 4A8LA 3BJTA 1N7KA 1X8CA 1EJWC 3GXDA 2WVVB 1DQXA 4O1FA 4UTUA 2VEIA 3VNIA 4PMJA 4H19A 4UOJA 3TKFA 1E9IA 5L9FA 2VEKA 3WNLA 4KCTA 2FPTA 2XN0A 1KXTA 3AFBA 4W85A 1F4AA 4UXDA 2QDEA 2FJKA 5AOUA 4QJ3B 4DZ2A 1KFJA 4LUTB 3VVGA 1KLYA 2VI0A 3ZSTA 2OQYA 3IJLA 2FVLA 1WE5A 2OT0A 4UFHA 4FS9A 2XFWA 7A3HA 5A8GA 2XM2A 4PGLA 2CLLA 1VJZA 2YZ5A 1ICPA 1E4MM 1MQQA 3WMCA 3M0MA 2EKGA 4W9PA 1BG9A 1G01A 1TV2A 2NZLA 4MB5A 4KGLA 2QAFA 4DZHA 4GCAA 2QUTA 3UERA 2B7QA 1KGWA 1QHOA 3SJNA 3WDQA 2I57A 3NXFA 3LXAA 2FVMA 3E2SA 3RX2A 4DRQA 4UOZA 4HZ6A 3W22A 3BDKA 4WIWA 4EX4A 3KP1A 3LRMA 4PMOA 1Z42A 3RHGA 4DI9A 4DYEA 5D4YA 4B92A 5GJNA 1TWSA 1H1NA 4PMVA 2C71A 1IF2A 5I3JA 3S9IA 1EDGA 3ARPA 1FWBC 1D7JA 3UXKA 1P4CA 2FHFA 1UMLA 1XLMA 3OJGA 4NSBA 1UIPA 3ZWTA 5HJLA 1B6CA 2GPTA 1Q6CA 1QK0A 1E1CB 4R0XA 1EJXC 1UBSA 5BNKA 2H90A 2ONEA 3SQMA 3VD7A 1FKKA 2OYMA 1X6NA 1UC5A 3RMJA 2A3CA 2ZDRA 3A5FA 5C0QA 1UR4A 2VR2A 5CZTA 3EY6A 1F7BA 1ZJIA 1M7XA 3B8TA 4CD5A 4S3BA 1J2BA 3H21A 4GKTA 5LSMA 3ZT7A 2DSWA 1FXPA 1V3IA 5FL1A 4TQTA 1KBBA 5KZEA 5K2ZA 4F0KA 3L5MA 3H23A 2JF6A 4IG2B 2EO7A 1U5HA 4ATLA 4PULA 5AYYA 1C93A 3P81A 3IGSA 3WNOA 4LBUA 1HO4A 1IYXA 4BZYA 4EP8C 4CNSA 2CIPA 1Q4NX 3OBKA 3EEZA 3GXNA 4E8DA 2NT1A 3E2VA 3S9ZA 1PUDA 4ZXLA 4KEZA 4WXZA 4YHGA 3WH0A 5AFDA 2BTMA 2VCBA 5DCDA 4DELA 1JUBA 2POZA 3BG3A 3FKRA 2FPVA 2YBVA 2Z2UA 1DL3A 4OT7A 5CPQA 2GZXA 5KINA 3U2EA 4AF0A 5LGZA 2X09A 3N2BA 1VH7A 4UTIA 1R3QA 2BGNE 4ZOCA 3LBOA 5C5YA 3PZOA 3AHYA 1GVSA 4HP5A 3GH7A 4X9SA 3CZ8A 1XLAA 4HMEA 1JDAA 1KM1A 2RUDA 1G69A 3T8LA 4HK7A 4FK9A 1QO5A 4FNUA 4US6A 1QI5A 4HSNA 5CC6A 3PZQA 1B2YA 1JAKA 1ECEA 3L67A 3DERA 2ASHA 1ZHAA 1J0ZA 1AJ2A 3P2VA 4QQUA 4GKLA 3O5RA 3MCMA 4ALDA 3PPFA 3ECQA 3UJEA 2OX4A 1VD6A 3B8VA 4R27A 1CENA 4DNMA 4LYKA 1BYCA 3AUJA 2WOQA 1WDPA 3DYMA 4H8HA 2REQA 3NEHA 4C6PA 3RXZA 4E4PA 1CXKA 1E0VA 4WDXA 1TJ2A 3SCOA 4N9BA 4Q8OA 2CESA 2UZ9A 2X05A 4QE5A 2DT0A 4Y2WA 1V77A 6ENLA 3E12A 3IJIA 3BL3A 3OBEA 4IJRA 3G1YA 1UD2A 1MDLA 5JH2A 1Q4WA 1GW9A 4UTJA 1T8QA 1XI3A 1EIBA 2VR5A 5BW6A 3EOUA 4G6CA 1JNEA 1KT0A 5AKQA 2CU0A 1XLEA 2NXHA 3PUGA 2DEPA 3APGA 4DO6A 2OX1A 1P7TA 3A47A 1CLXA 1Q8JA 3SCPA 1US3A 1J0KA 2ZUNA 3R6IA 5G2HA 3ME3A 4H6QA 1JFHA 1AQFA 1G9HA 1G67A 3NQEA 2PBCA 3CIVA 1C29A 5FCZA 1E6SM 3DFTA 3W29A 2D2HA 1O4UA 5A8NA 3A22A 3QZ6A 2QCFA 4M82A 3QYSA 2WNNA 4MY8A 4K1GA 3NZQA 1DXFA 1YQ2A 3EX1A 4FX6M 3UQNA 1EGMA 1MO0A 4OUEA 3B7XA 4NVTA 1HZYA 1ZUAX 3USBA 1KV8A 3ARZA 4OWGA 3CTTA 2KR7A 4DO7A 4UB9A 3EOSA 4AIEA 3IRDA 4KR0B 5E09A 2VT0A 4ZFMA 4UFIA 2BDQA 1J5TA 2WC3A 2J79A 2MLYA 3QHNA 1TUXA 3LRKA 2F21A 4GE8A 3S6TA 3WENA 2PDQA 2ZVRA 4IMAA 1U1UA 4XSLA 1GWJA 3ZR5A 1LT8A 1RCOB 2YL8A 3SCQA 2I9EA 3SRDA 2YDRA 1FKRA 1D3CA 4XK2A 2CHRA 2BSLA 4KEVA 1E72M 4PRWA 3S1WA 2M08A 5RUBA 1KTBA 4AH7A 3ZIZA 1NVMA 3FEQA 2ZA3A 3M64A 5H8UA 1RK6A 1FFRA 1GVOA 1FHDA 1BTCA 4AIUA 2A3BA 3PZUA 2X40A 2ALDA 3ONBA 4EKJA 5KZ6A 4LNYA 1B90A 4LRTA 3T8QA 1XYMA 4ZQMA 5HWNA 4PTMA 1OF8A 3LGEA 1W9VA 2DJXA 3HGOA 3DFNA 3BJSA 2NQ9A 2RKXA 5H8PA 3HG5A 4UMCA 1L6GA 3ABZA 1H3GA 1SFTA 4JTTA 1LLOA 2V5BA 2GUBA 4U28A 5XIMA 5D03A 3RK8A 2Y88A 1V6TA 4UTTC 4XKMA 4TX6A 5D9NA 5TF0A 1LOLA 1E9ZB 1SU5A 1U1JA 1A0CA 4EOUA 3O5DA 4MVAA 1XSIA 5K9DA 4LS1A 4QDMA 3KTXA 5IDZA 3EXRA 3I10A 3BLIA 1H09A 3UQIA 1E4NA 4ZL1A 1WZAA 3O5PA 2QCCA 3ALFA 1OGBA 3TE9A 3VU2A 2XP4A 3Q58A 1TZ9A 3U2CA 3BICA 1CTNA 2FH8A 4C6LA 3KM8A 3EWBX 3OVQA 1D7IA 2NWSA 3N6QA 2QF8A 4I8DA 4L7ZA 3EX2A 2QR6A 3KAGA