4S3KA

Crystal structure of the bacillus megaterium qm b1551 spore cortex-lytic enzyme slel
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
433
structure length
429
Chain Sequence
GGFAQIYTVKAGDSIYSIAKQFRIDAGKIIRANELPNPNQLVIGQSMVIPINGTYYTVKAGDTIWKVGRKLGVSYQAIANANNVSVTAPLTPGRRILIPPSPNKRNGEFLGYVETSNRKITPQTEKMINQNAKYLTYLGPANFEVQKDGSLKAPPLNNLGSIAKENDVIFLMVLANIENGAFSDEVGRAILNNKDVQDTLLNNIVKTAKEQNFRDIHFDFEFLRPADKEAYIAFLQKAKKRLQDEQLLMSVALAPKTSRDQKGKWYEAHDYKAIGEIANFVVPMTYEGGPPMAVSPIGPVRDVLEYAVSEIPSSKIIMGQNLYGYDWTLPYKPGGEYAKAISPQRAIELAARYKVAIQYDNKAQAPFFRYKDEQQRTHEVWFEDARSIQAKFDLIKELKLRGMAYWKLGLDFPQNWLLIEDNFKITKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore germination protein YaaH
publication title Structural and functional analysis of SleL, a peptidoglycan lysin involved in germination of Bacillus spores.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Hydrolase
total genus 142
structure length 429
sequence length 433
ec nomenclature ec 3.2.1.-:
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01476 LysM LysM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4s3kA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4s3kA02
4JL1A 4NRSA 4LYPA 3SCUA 4UQAA 1HKJA 5ECUA 4Z2HA 4AZ5A 4JCMA 3M07A 2ZXDA 4IPNB 1GHRA 2A3BA 3PZNA 2DH3A 2OYMA 4AZCB 5IFPA 1WKYA 3DECA 4URIA 4HOZA 4PYSA 4KH2A 4S3KA 3MUAA 4DUXA 3VTRA 1E6RA 1E3ZA 4B3KA 1ISVA 2VR5A 2WXDM 4B9YA 3UESA 3CH9A 1WZAA 1E6QM 2VCCA 3F5JA 1BHGA 3WFZA 1NM9A 4P8XA 1SFSA 1R85A 3OA5A 3IJ9A 4PTMA 1EDTA 2ZE0A 2VRQA 4L4PA 2ZWZA 1W32A 1JZ7A 2VOTA 3WMSA 1JIBA 3N1AA 4J3SA 3WUBA 3WQVA 1H0GA 3ZSTA 4KRTA 1WP6A 4QLLA 2QLYA 2EXOA 1W1VA 1J0YA 4F79A 2VX7A 3EDJA 3THDA 1NARA 4HOXA 2O9RA 5FOOA 5I23A 3NSMA 2C0HA 3SCQA 3RM9A 1IV8A 3W38A 2VZOA 2WLZA 2WMIB 1A3HA 3EDDA 3WKZA 1EQCA 1VFOA 5E6YA 3VD4A 2VI0A 5FCZA 4PMQA 4JFSA 3AIVA 2ESCA 2J4GA 1P6WA 3WN6A 2FDMA 3WNPA 2QV4A 2BY1A 3VIMA 2G8ZA 4W87A 3GH5A 3MMWA 1CWYA 1WDSA 3BAJA 2BS9A 4GO9A 4S3JA 4Y7EA 2WW5A 4M82A 1B9ZA 1OGSA 1JYVA 3WDIA 4JKKA 3OLGA 2DSVA 5FL0A 1E71M 5M3WA 2X2YA 3VMPA 1OIMA 1FH7A 2DIEA 4X9YA 1HKMA 2WHKA 4Z2KA 2AOSA 1BGAA 1BVZA 2VX6A 3WDHA 1KCLA 4V27A 1JZ6A 2RGMA 1R7OA 1CXKA 4A4AA 3AYSA 3EMCA 4R27A 3VKKA 1GNXA 1FFRA 4MJ2A 1HXJA 3K8MA 2O9PA 1W3KA 5CSYA 2BFGA 4PSRA 5CPTA 4CD8A 4OBSA 1QVBA 1PBGA 1OT2A 2Y24A 2A3EA 3M6DA 3AQUA 1C7SA 4H41A 2EPNA 4MNJA 3WIJA 2BXZA 1ZBWA 4WJXA 4XZWA 4UFKA 5ABEA 4UOQA 2J7FA 1RH9A 4Z2IA 3T2QA 1GOMA 3ZO9A 1W1TA 3O2LA 2W5FA 5D9OA 4DWSB 3GZAA 3TA9A 1NP0A 2ZUNA 4GI6A 1M04A 3MO4A 1F4HA 1MW3A 1QW8A 3NDYA 1W3LA 4LYRA 2FHFA 5DO8A 4CN6A 5A2CA 5D4YA 1R87A 1MQPA 4F9JA 4PTWA 3AICA 5GNXA 4OKDA 3PHAA 3OBAA 1HJWA 4EKJA 3GXIA 1NOWA 1PAMA 2D20A 4C7GA 5I3DA 4XB3A 4AD2A 1VEMA 1OGGA 1U33A 3FHAA 4A3YA 1E73M 1JNDA 1PPIA 5JUVA 1MW2A 2D0HA 2DT3A 2WM0A 4EE9A 4UOJA 1ZS2A 1QHPA 4KGJA 5D8ZA 3TONA 5BCAA 2XSBA 4LGXA 5CLTA 1HKKA 4JKLA 2WHLA 2CXGA 2DSKA 4BQ3A 3NDZA 1W91A 3IAQA 4TTUA 2WCAA 4AXNA 2CBJA 3FY1A 1NOUA 1CXLA 4GXPA 1C7TA 4FLRA 2WK2A 3BAIA 1OGBA 3RILA 1B31A 3ZT6A 4KMQA 4DWSC 1AMYA 3PZUA 1TG7A 1GZJA 4J3TA 5IHSA 4W7VA 1KBKA 1J11A 3WF3A 4M8UA 4XX6A 2CETA 1UYQA 2NT0A 1M01A 4HA3A 1CGVA 2EPKX 2DEPA 2XSAA 4TTGA 5E09A 1LL7A 4HP5A 3LMYA 3I3BA 5E0CA 1WE5A 2UY5A 3QHOA 5I79A 3L2MA 1H1NA 2YDSA 5HNNA 1FA2A 4TVCA 4PSPA 2XVPA 2PWGA 1KB3A 1UWQA 1E56A 4RE4A 3W4RA 2CKSA 3B9DA 1C8XA 3AS2A 5IDIA 4WKAA 3A47A 3WH9A 4TUFA 4QDMA 4D1IA 3SCTA 3VIKA 2QPSA 3L4YA 4ZXLA 1UD6A 3JUGA 5ABHA 3OB8A 3AMKA 2O92A 1QW9A 4PUDA 3A4AA 2V5DA 3BXWA 3GXDA 5A6LA 1KXHA 2J79A 4W93A 2O9OA 4MNMA 4RE3A 1Q6GA 3HN3A 1J12A 5CG0A 4WSJA 4D6DA 2YIHA 2J62A 1NWRA 3EMZA 2FGLA 4W8LA 4W8AA 2VO5A 4WIWA 1XHGA 4U3CA 4D71A 1AQ0A 1YHTA 1FHLA 2D22A 1JG9A 3GXMA 3VX1A 1JI2A 3AZTA 3AHVA 3WFLA 1ISXA 2WC3A 4AW7A 4J28A 1LG1A 8A3HA 2CBIA 2J7CA 3T0BA 3AZSA 1RD6A 2YL8A 3CZLA 4N42A 4J3VA 3WQ4A 3EDKA 1B3YA 1HJQA 4TXEA 3VDCA 3PBGA 6TAAA 3CPUA 2J8GA 3WQWA 2VZSA 4PMVA 1WZKA 3VIHA 1W2VA 3AHYA 1V3JA 4HZ6A 4ZE4A 2CEQA 2VZUA 2CNCA 3AIWA 4MJ4A 4QCFA 5BROA 1RPKA 2PC8A 2VRKA 2EPOA 5GPRA 5CJ5A 4HZ8A 4GO8A 3S6TA 1E1FA 3LPFA 4CU7A 2VX4A 2IUZA 4AZHA 1XRVA 1GQJA 1OCQA 5A95A 7CGTA 1HL8A 2GDUA 4IISA 2WZHA 3OZPA 1E9LA 4ZFMA 2VQTA 5BYWA 4NI3A 4PCSA 1B30A 1KQYA 1E6XM 1V0KA 2FHBA 1CXHA 2CKRA 3HU7A 2QHAA 3BMWA 5A6KA 3VGEA 4QCEA 1JF6A 1UKSA 2WHMA 4ZEPA 4PEEA 2YL9A 5FD0A 2XJ7A 1W9DM 3F5LA 1E4MM 1GONA 5HBFA 1V0LA 1AQHA 2F61A 3LPOA 4AD0A 4GQRA 5A1AA 4LX4A 4MTVA 1C8QA 1H11A 2ZX8A 1V6UA 1JZ2A 3OLDA 4UQDA 2X8RA 1UOKA 4CN1A 3GBEA 5EBAA 3QHMA 3RJYA 3ZOAA 3ZMRA 4GKLA 1TUXA 3II1A 3W81A 1EA9C 2DPEA 3L4WA 4QLKA 3AS3A 1Y7VA 5JBEA 3WNOA 1G0CA 3FW6A 3VIFA 4DUVA 1NOFA 2ZWYA 2WANA 1VF8A 4OZOA 4QFUA 3KL5A 9CGTA 4JL2A 4J7RA 3ZM8A 4R5EA 1GUVA 1BYAA 2PBGA 3OIHA 1PX4A 3WUFA 1ODUA 1UWRA 4ATLA 2E9LA 4UZSA 1HJSA 3ARTA 1CLXA 2G41A 4ACZB 5A6SA 4Z2LA 1GOIA 2Y2WA 4Z2JA 4D6HA 4NZCA 2GFTA 4CCEA 3NUKA 3WUGA 2W4XA 3FAWA 1GJWA 1E1EA 2GSJA 3MUZ1 4WKHA 2WMGA 1FP8A 1J9YA 1KQZA 4AMCA 2ZICA 2XYLA 2BV9A 2W92A 3A4XA 5FKYA 3PZ9A 5M17A 4JHZA 4HU0A 1Q6EA 4NSBA 2WMKA 1DWJM 4MAVA 1EDGA 4JCLA 4OBRA 4E4PA 1OSEA 4GI9A 1DP0A 2XG9A 2WMHA 1VFUA 3NIYA 2XGBA 2DT0A 1DEDA 2XFYA 2V38A 3W28A 2E8YA 3AISA 1GW1A 3K4AA 1WNOA 4CN4A 2FH6A 2TAAA 1V3LA 1XSJA 3VM7A 4RL3A 2CYGA 3EYPA 4P7LA 4HMDA 2DDXA 1GJUA 2B31A 4F8XA 1GPFA 1KCKA 1UR2A 3PTQA 3TTQA 3W25A 1E6PA 5BRQA 1VIWA 3VNZA 1GQKA 1ISWA 1J18A 4M56A 3BLKA 4AC1X 3ARWA 4B15A 2PWFA 1BFNA 3MKKA 1LWJA 2ZUSA 3VNYA 1WO2A 2VNCA 5A6BA 3CUFA 3VDBA 1UR4A 4W8BA 5IHRA 1XV8A 3UCQA 1Z32X 2XGIA 3N18A 1JD9A 1J10A 5A2BA 1CBGA 1GCYA 5DFAA 1UKTA 4KWUA 2CESA 3VGBA 2WVVB 1JXKA 3CZKA 4Q7NA 3RM8A 1FFQA 3THCA 4AZCA 2WVUA 3VVGA 1R8LA 4W84A 1GORA 3FXYA 4W7UA 2VVNA 3ECQA 2J8FA 2CIPA 4K68A 3L4VA 3RJXA 2ZX5A 1W3HA 3SUSA 1JGIA 2D24A 1KGWA 2YA2A 5E9AA 3PTKA 5GQBA 2CBUA 1V6XA 1UR9A 1CGYA 4B3LA 2WVVA 1HP4A 1K9FA 1OINA 3APGA 2EPMX 3VINA 2UY2A 2WCGA 3SCNA 4D6EA 2WVTA 1EH9A 5A2AA 1UD2A 4PMNA 1LLOA 1OM0A 4CU6A 1PIFA 2BXYA 3T2OA 1FH8A 2VRJA 1IT0A 1E43A 1IZKA 1UD5A 1K9TA 1B3ZA 1UR0A 4OIFA 1H5VA 1UD3A 2WMIA 1M03A 4W89A 3WNNA 3L4UA 1HJVA 1UH4A 5GNZA 1PX3A 3TTSA 2XIIA 5AY7A 5LYRA 1UH2A 1GQLA 4P8WA 2VCBA 1UQYA 3ZT7A 2JALA 2VTFA 1GOQA 3SEPA 1K9EA 3WL1A 2XVLA 3AI0A 1JYXA 1JI1A 1HVXA 1N82A 5AYIA 2JEQA 3EBVA 1H4PA 5I2UA 5I5RA 3UR8A 5HPOA 5EB8A 5C8BB 1UD4A 1FP9A 1MFVA 4BQ2A 3UETA 2YKKA 2Y4SA 3AFBA 3IJ8A 1QNPA 3WD3A 2E40A 1HX0A 1V08A 5A8PA 5IXEA 2ZUWA 5A6BD 1F4AA 3EDEA 1UA3A 1W9PA 4HPGA 2WLYA 1CECA 1B1YA 5I77A 1HIZA 2E4TA 4TX6A 3CHEA 1MVYA 2XIBA 2Z1KA 2BVYA 4PMXA 1CXIA 3ZIZA 1YQ2A 2WMFA 2Y8KA 5E0FA 4H8HA 5CQ1A 5D8WA 1BYBA 4GZIA 4PRWA 1UR1A 1JDCA 4U31A 5ABFB 3M7SA 3VUPA 3DHPA 1VEPA 2IXUA 5DF0A 3ZR5A 3BAXA 1BPLB 5DMYA 3KL0A 3GM8A 5A6AA 2GVYA 1X6LA 3GH7A 3SUVA 4D1JA 2VUYA 4DWSA 2WMJA 4OOUA 4WKFA 1NWSA 1LQ0A 5A6JA 3UG3A 3UR7A 5BXTA 3MSDA 2WZIA 3F4VA 3VD5A 3N04A 3MMUA 4WF7A 1PX8A 5C71A 3AHZA 5AC4A 3EMQA 1X1NA 1VBUA 4J3XA 1UKOA 1BAGA 4AZ7A 1H3GA 3T09A 1B2YA 3L4TA 3WDQA 3IK2A 2PWDA 5TD4A 4DM2A 2W61A 2WYSA 2OYLA 1X6NA 3SUUA 2GJXB 3UG4A 2DT1A 4W5UA 2BHZA 1XCWA 1HN1A 1TR1A 2WSKA 1OWQA 3K8LA 4OOZA 1W1PA 1VJZA 4CGTA 3UEQA 1GHSA 4FMVA 2ZX6A 2XM2A 3IJ7A 2OSWA 3SURA 2VMFA 1KFWA 2DSUA 2EJ1A 2D0GA 3WMBA 4P8UA 1E6NA 4HU8A 1MFUA 2V3EA 5A94A 3CHDA 1G9HA 3GBDA 3RCNA 2AAAA 1US3A 3E1F1 2GJXA 4MDPA 2EPLX 2ZUVA 2J7GA 1WDRA 1E0VA 4P7NA 1ODZA 4GIAA 4CD6A 4M81A 2J7DA 2J25A 4AEEA 2Y5EA 2VC9A 1V02E 3O6AA 3WH8A 4PUEA 4X0VA 1V3KA 4CU8A 2XWEA 2GK1B 1ZL1A 1UKPA 1I1WA 2E9BA 2ZUMA 3WQ6A 3AMGA 2V5CA 2EEXA 4QLJA 3GXFA 1OD0A 2E0PA 3QOMA 2GJPA 4JFUA 3W53A 4U5KA 1W9XA 3MV11 1VJSA 4M24A 3A3HA 5ABGA 2GUYA 5CGMA 5LA1A 4F9DA 2WBKA 3T0AA 2XFFA 4U2YA 1QNSA 3U7VA 5KZ6A 2QMKA 2D1ZA 1TA3B 3ZJ7A 1B90A 2GK1A 1EIBA 4YHGA 3W27A 4AISA 3CZJA 3D3AA 3VIOA 4DWSD 3PZGA 3FAXA 5BXSA 4TVUA 1TE1A 4UZUA 1KXTA 3TOPA 3PZOA 3AJ7A 1EXPA 1S46A 1E4NA 1V02A 4YN5A 1V3HA 3WNLA 5DEZA 1BLIA 4TVDA 5CZKA 2A3CA 1AQMA 3AXIA 1KR0A 1HJXA 2FGZA 4AYSA 3WEOA 2G3IA 2PWEA 3OGVA 2YDQA 4AD5A 1LJYA 1WPCA 3CHCA 1RP8A 2BVDA 6CGTA 3GH4A 3WNMA 4U3AA 1TVPA 3PZIA 3WF2A 1XYFA 3KWXA 1A47A 3KL3A 2A3AA 2D3NA 2BHYA 1MXGA 3A4WA 1JFXA 3BC9A 3VOCA 1HKIA 5DT5A 1CZ1A 4FLQA 2ZUTA 1QNOA 2YLAA 1C91A 1XCXA 2ZX9A 2C7FA 1MYRA 4KGLA 4NF7A 3DHUA 3WF4A 1U2YA 4U5IA 1E4LA 4MADA 3EDFA 3ZJ6A 4ZE5A 1ZJBA 5GNYA 3B9EA 1CXEA 1JAEA 1UD8A 1UQZA 3W6MA 1JDAA 1HNYA 1ZU8A 3BSHA 4MNKA 3W6LA 3WSUA 2F8QA 2YDRA 4N0RA 5HDRA 2XPKA 2X0YA 3VX0A 4UOZA 2JEPA 2XVGA 3VMOA 5CSUA 2QMJA 3CUHA 4DUWA 4M29A 4CCDA 4MNLA 2DH2A 3AIQA 3ARXA 5I78A 1GOKA 4UFIA 1US2A 4AIOA 5JIPA 2J7EA 2CHNA 1LL4A 3CZ8A 3GNPA 1JXJA 3K8KA 3ZJ8A 2F2HA 1DHKA 4W86A 4P7RA 1PEZA 3OLEA 1H41A 4PMRA 1C92A 3MS8A 1UR8A 2E8ZA 1WDPA 3QGVA 1OB0A 3B9AA 2YJQA 1GVYA 4HTYA 5IFTA 2E9MA 4EANA 1WB0A 3WD0A 2WBGA 4RE2A 3BGAA 1MQQA 4BQ4A 2JIWA 4PCTA 3WNKA 1FHDA 1QNRA 3ARQA 4H7VA 4UTFA 3VIJA 4W5ZA 3WH5A 4AD4A 5A8OA 2BY2A 2W91A 4AD3A 2J75A 3OG2A 4D6JA 5I24A 1E3XA 3DC0A 1DWIM 5A8QA 1VRXA 3MANA 1QHZA 2X1IA 4HOWA 5AC5A 2VT0A 2DGAA 2O9TA 2G3JA 2DIJA 3ARRA 1PJ9A 4TX8A 3S2CA 3VU2A 1MXDA 1DWHM 1UKQA 1W3JA 3VD7A 3N15A 1CEOA 4UFMA 3PZQA 3WD2A 2OWXA 3BAYA 4V2XA 1ZBCA 3VM5A 5HPCA 5CPQA 4J3WA 4HZ7A 2W63A 4ATDA 3QOKA 3ZT5A 1NWTA 4P8VA 4PTXA 1QI3A 4PMUA 3T08A 3WDPP 1BTCA 1R7AA 1I1XA 4NRRA 5E70A 4HMCA 1VEOA 1SYTA 2W66A 5E6ZA 4FF5A 2UY4A 3HMCA 2BNJA 1EGZA 1K6AA 4ACZA 2OWWA 5I0DA 4P7OA 4EK7A 1TMQA 2YA0A 3DYMA 3WEMA 2W67A 3SCSA 1RP9A 1TCMA 2D0FA 3WF0A 4U2ZA 3AMDA 2ZUUA 3G6LA 5CPSA 3VIPA 1XC6A 2OYKA 4ATWA 1BQCA 3CMJA 2BVTA 4C7DA 1OD8A 7A3HA 4BF7A 6A3HA 2PWHA 4GZJA 1W2PA 1UWSA 1E6SM 4W85A 1B0IA 3K1DA 3VMNA 4AZBA 1H49A 1W9VA 5A69A 2V3GA 1UWUA 1QOXA 1NWUA 2X09A 3MUIA 2E3ZA 1D7FA 1Q6DA 1FH9A 2V3FA 1V0MA 2UWFA 1PZ2A 3K4DA 3BAKA 1JZ8A 1GOOA 2YA1A 2A3HA 1CENA 3PZMA 2WWDA 2Z1SA 1TVNA 2XUCA 2YOCA 3F5KA 4MAZA 4FLOA 3DYOA 4MB5A 3WH6A 1WZLA 3AXHA 1LG2A 5D9NA 3AIEA 3VGFA 3G6MA 2WPGA 1W9BM 3WF1A 4W88A 1FOBA 1XH2A 3LPPA 3ZQ9A 2JF7A 2JF6A 1QBAA 3ZR6A 1CLVA 1WDQA 1O6IA 4JFWA 5CLWA 1E0WA 1QI4A 1XSIA 2J78A 4QP0A 3W24A 2G4FA 2Y8VA 3GDBA 4MB1A 4W7WA 3TP4A 4QAWA 1E4IA 3MV01 1Q4NX 3LPGA 1MW1A 1D2KA 4UR9A 4BS0A 3W26A 3BMVA 1V6YA 2DSZA 3OGSA 3L2LA 3RM4A 3ARPA 2Q8XA 4JHOA 1E5JA 1M53A 1J0KA 4OUEA 1JNEA 1LWHA 1BG9A 2DSWA 3AIRA 1W9UA 1KWGA 2VR4A 4WK9A 4E8DA 3SCWA 2CPUA 3U57A 1MW0A 1BF2A 3ARYA 3N13A 5FIPA 2AMGA 1G01A 1ECEA 4BZYA 3AZRA 3SCVA 3POHA 3WL0A 3RMEA 2EO7A 1CGTA 3BAWA 4H8UA 3MU7A 4WSKA 3CZEA 1EHAA 1PZ3A 2XVKA 3M46A 4PBGA 4UFHA 1MWOA 4PMOA 3WUEA 1DWGM 2ZX7A 2EBNA 1JZ5A 1OBAA 4HA1A 2W62A 3AIUA 1ISYA 3N9KA 4UQ9A 3WDRA 1LL6A 1HF6A 3VPLA 4GZEA 3AXXA 2NW0A 2ZXBA 1Q6FA 2UY3A 5BRPA 4PMZA 3I3DA 3MSGA 5M03A 7TAAA 4J3UA 1JYWA 3WBAA 1SMDA 4JKMA 3AS0A 4DM1A 1UA7A 4UFLA 2WVSA 3WQ8A 2VZVA 1LF1A 3AYRA 2YLLA 1BG4A 5AYBA 3ALGA 1VAHA 4LXFA 4CUCA 2X0HA 4D6CA 1KXVA 4JFVA 1CPUA 1K9DA 1L0PA 4B9ZA 1KGUA 2YBTA 3WH7A 1JF5A 1G94A 1BYDA 4H8VA 5EMYA 1C90A 1R86A 2YBUA 3W0KA 1NQ6A 2CBVA 1E72M 1KXQA 3VIGA 3VIIA 1E0XA 4CVWA 1CGUA 3KEHA 4P7QA 1SMAA 4UCFA 3FHQA 4AD1A 2VCAA 2VVSA 3AMLA 4M80A 4AZIA 4AEFA 4AY1A 3NCOA 1J0ZA 3ARUA 4PTVA 3VGHA 2WAGA 5EFFA 1E15A 2X05A 4YHEA 2YL6A 4BQ5A 5BXPA 3T2PA 2ZXQA 1WZMA 4MB4A 1QNQA 3UERA 1UG6A 4PMYA 2IXVA 3SUWA 4ML4A 5ABFA 1UUQA 2YL5A 1IZJA 3IANA 1EDQA 3NSNA 3DYPA 3WENA 3BCDA 2VZTA 5A6MA 2ZIDA 1PIGA 2CERA 3AIBA 3POCA 1CTNA 3W29A 1JL8A 4LQ1A 4UFJA 2PB1A 3BSGA 3OLIA 4AIUA 5JBFA 3CUGA 4X0NA 1KBBA 4FK9A 2OSXA 3T0DA 2G3NA 1HT6A 2XFRA 1JFHA 3VO0A 4KRUA 4JAWA 4TOQA 1EHNA 2BHUA 3WEZA 3I3EA 3OGRA 5I6SA 2WWCA 1TFVA 4HMEA 1U30A 1XD1A 4CD7A 1ZBVA 4IUGA 2HISA 3CHFA 1KR1A 4AWEA 3BLPX 1KWKA 1QBBA 3SIMA 2PI6A 2WZEA 2VURA 1XYZA 1J01A 3SCPA 2BY3A 4UQCA 1J0JA 3N17A 1UHVA 3ARSA 1VENA 1Q6CA 2DQXA 4H2CA 2NSXA 1C93A 2BY0A 1VFMA 2XWDA 1HJUA 4CD4A 4EAMA 3WY1A 3VDHA 4CCCA 1NH6A 3CLWA 3VGGA 3TTYA 4GQQA 1AVAA 1CGXA 1EOKA 5CGTA 4E8CA 1ZB5A 5KEZA 2VQUA 1J0HA 2V3DA 3U7BA 3AS1A 1HVQA 3U5UA 5EFDA 2ZOXA 3ARVA 2GDVA 4A3HA 2XM1A 2VL4A 4WLCA 1ZBKA 1ESWA 1SR0A 4HA4A 3HJEA 1M7XA 1XH0A 4XZBA 1HP5A 3PTMA 1CYGA 5BWFA 1JZ3A 2WB5A 1V6WA 1E6ZA 3UG5A 3GNOA 4L4OA 1DTUA 1V6VA 4AZ6A 2EQDA 2MANA 3L4ZA 3RPMA 2XHYA 1EO7A 4YPJA 2DT2A 2D23A 1H2JA 1E55A 1XD0A 5F7UA 2CITA 1TA3A 1V3IA 5CXPA 3RDKA 2JFEX 4HPHA 1H09A 4M1RA 1W1YA 3CUJA 1WCGA 2J7BA 4E2OA 4D6FA 1UH3A 4ZXOA 3ZSSA 1UWTA 1VB9A 2XTKA 3ZJKA 2WNWA 2QF8A 3ALFA 1NP2A 1J0IA 2G3MA 3NSXA 1JDDA 1E5NA 3FNDA 3VILA 3TTOA 4LPCA 1MQRA 1QI2A 3W37A 3PZTA 5A8MA 3WQ5A 1E40A 3RIKA 3VGDA 1CIUA 1UWIA 5C70A 3CMGA 3WD1A 1EOMA 4JZ5A 1D3CA 1GVIA 5FL1A 3AMCA 3WDJA 4UNIA 3B8SA 3CZGA 2VJXA 2WCSA 1TZ7A 1UZ4A 3PZVA 1WAWA 3J7HA 5A3HA 1C3FA 3AHTA 2WKLA 4B16A 3WELA 3CIVA 1QPKA 4MDOA 3N11A 4CKQA 1OIFA 1I75A 3O9NA 1HL9A 4H04A 2NT1A 1L8NA 3FN9A 1QI0A 1JZ4A 1GOWA 2RGLA 3NJ3A 3CO4A 1G1YA 5HXMA 3BH4A 3OZOA 4GPNA 2XVNA 1V0NA 4GINA 3W82A 3A6OA 1ITCA 3WBEA 1V03A 3AROA 3CBWA 5HOSA 4CD5A 1B3XA 4AIEA 1CNVA 2WC7A 4MPKA 4J27A 5D9MA 2J77A 3AHXA 2JIEA 1ISZA 4D6IA 1JAKA 1DWFM 1CGWA 1EO5A 4BCEA 1B3VA 2C8NA 1BSIA 2HVMA 1BGGA 4UQEA 3GNRA 4F66A 2PBOA 4IPLA 4UQBA 3WD4A 5LA2A 3MMDA 4AZGA 4Q22A 5M5DA 1DWAM 2D3LA 4CVUA 1KGXA 3VD9A 4JFTA 3N12A 4GI8A 5JIWA 5LA0A 2OWCA 2WSPA 1VFFA 4ACYA 3QHNA 4D72A 4V28A 5JBDA 2QPUA 1ITXA 3ARZA 1G5AA 3SUTA 5BXRA 4MB3A 1QHOA 1UZ1A 1XSKA 2WKGA 3D5HA 4FLSA 2GJRA 1V3MA 4BA0A 5DT7A 4LYQA 3KE0A 2WC4A 4OJYA 3NYDA 2J74A 5D9PA 1QI5A 1ZJAA 3VDAA 4D6GA 1OT1A 3CGTA 4U33A 2VX5A 2J47A 3KZSA 4Z2GA 3VD3A 1CDGA 2ZXAA 3K46A 3SCRA 1JD7A 2FHCA 4C7FA 4ZENA 1C8YA 1GQIA 2D2OA 1E70M 1O7AA 3CTTA 4PMDA 3RO8A 3CUIA 2OLHA 1JYNA 2FH8A 1CXFA 4PN2A 1B3WA 3QR3A 3L4XA 2J7HA 2CHOA 1H0IA 2WHJA 2JE8A 1EQPA 3WMCA 2PF0A 1XH1A 3GTNA 4IM4A 8CGTA 1BYCA 2CCRA 3MUY1 3PN8A 3IAPA 4XUYA 3BCFA 1XGZA 3GYCA 1BVNP 3SCOA 5A8NA 3U5YA 4JIEA 4XV0A 1VBRA 3AOFA 2OSYA 5JH8A
chains in the Genus database with same CATH superfamily
4LS2A 1DKWA 1S5TA 3W1QA 5FA5A 3UR2A 1ZCNA 4AZ5A 4GOAA 4HKPA 4GFSA 1DIOA 1HO4A 1TPB1 5CH9A 4QEEA 3S47A 1SZNA 3V18A 3H7RA 4S3AA 5HW8A 3NL2A 1KM1A 4ZB5A 4PYSA 2NUYA 1PKNA 1ZQ5A 1E3ZA 4B91A 1ISVA 2VR5A 2WXDM 4B9YA 4I5RA 3U8GA 3SAZA 1WZAA 2V0TA 3U4AA 1R3YA 3DFTA 3F5JA 4P8XA 1R85A 3MHUA 3CNYA 3OBKA 2WSQA 3IJ9A 1EDTA 4GISA 4ZQMA 5FF3A 3F1QA 2VOTA 1B4EA 2QVNA 3WUBA 3LBMA 4TV6A 1A3XA 3BMXA 3F7JA 2EXOA 4YWIA 2IKIA 3EDJA 3THDA 1UUMA 1NARA 2YCJA 2EHHA 3FCPA 2DUZA 5I23A 1Q45A 1OX4A 3PUEA 3O63A 3W38A 3H4XA 5I00A 1RVGA 1XW8A 5FJUA 1VFOA 4IPIA 5E6YA 2BOFX 3AIVA 4A3QA 1PKYA 3LG3A 3DU0A 3DI0A 3WN6A 3OZYA 4US5D 1WBHA 4MF4A 4S3BA 2Y70A 1XFBA 3LQLA 1X8CA 3VIMA 4W87A 4X60A 2Y5JA 1AJ2A 2YR1A 1CWYA 3EEGA 3BAJA 5AC7A 4GO9A 4M82A 4WY0F 1B9ZA 4Q3MA 3T07A 4RPQA 3B8IA 3WDIA 4PRTA 3HG4A 3H4WA 5FL0A 3VMPA 1C9DA 4X9YA 1HKMA 1BGAA 3LTPA 3WFAA 2RGMA 3MP5A 3R2GA 3S9ZA 4A4AA 1V8EA 1X7FA 1XLBA 1FFRA 1WKFA 4MJ2A 3FA5A 5CSYA 2O7SA 2PRMA 2RJHA 1F6KA 3NRKA 5LGXA 3O07A 5EMKA 1PBGA 5HWCA 3G0XA 1VGAA 2JGQA 4H41A 2WJZA 4JTCA 2DIKA 1O1ZA 4JTDA 1PZ1A 1ZBWA 3BOXA 5JMUA 4UFKA 5F2LA 2J7FA 1RH9A 3WBXA 1LQ2A 4Z2IA 3ZO9A 4DJEC 3EB3A 2RUQA 2W5FA 3UWQA 1I9CB 1NP0A 3CS2A 3BOFA 1M04A 3A22A 1EP2A 3TJXA 1LT7A 1H7NA 3PP7A 4LYRA 4Q4MA 3GRIA 3GW0A 1VFHA 1PWLA 3KABA 3DHFA 2HMCA 1FKWA 1EZWA 3PHAA 3RLHA 3R89A 4HD5A 1NOWA 1PAMA 5I3DA 2ABBA 3N4FA 3LHZA 4AD2A 3OO2A 1ADDA 4A3YA 3UP8A 1PPIA 1S2CA 1MW2A 2FFCA 4EE9A 2E67A 4ODQA 1QHPA 1ME8A 2M08A 2V2CA 5D8ZA 1IXPA 2CZFA 5EMJA 3S6DA 3SY5A 4FEZA 3TSDA 4BQ3A 1PZ0A 1W91A 3Q37A 2WCAA 3KS6A 3B3DA 3WO8A 3E0IA 1CXLA 4GXPA 3TZFA 4FLRA 3WLSA 1OGBA 1JNSA 1B31A 5G5IA 3ZT6A 4KMQA 3S6OA 3PZUA 1TG7A 1L2QA 2OZ8A 3DDMA 4W7VA 3SY8A 4A29A 4M8UA 3H6OA 4XX6A 1MDRA 1XGEA 1Z9AA 4QJ5B 3TE9A 2HVNA 1CGVA 4TTGA 2OGJA 5E09A 3UD6A 4TIMA 4HP5A 4LOCA 3LMYA 1OFBA 3I3BA 3LLFA 2P3EA 5E0CA 3UI5A 4RXGA 1WE5A 3CQIA 1LYXA 1U1JA 2UY5A 2PFHA 1E44A 1H1NA 2YDSA 4FOUA 4JGDA 4MFEA 2JBMA 5AECA 1KB3A 1UWQA 1E56A 4L6DA 5IDIA 4JYSA 4L56A 1KM0A 4D1IA 4RLIA 1RBAA 2QPSA 4ZXLA 3VK5A 3H8AA 4DZHA 2O92A 2ZC8A 1QW9A 5FJPA 2HPMA 1Z41A 3UG8A 2EKCA 2O9OA 5LXXA 4RE3A 5CG0A 3IRDA 2YIHA 4L4MA 3NTPA 3U9IA 2WNZA 5I02A 2FGLA 4W8AA 3C61A 2GVGA 4ZQOA 3P2VA 4BWLA 1JG9A 2HK1A 4AHPA 1EQ3A 3WFLA 5G4HC 1CLKA 4KEVA 4Z0SA 8A3HA 2CBIA 1SUXA 3KCJA 5HK4A 4R88A 3FAPA 3G1FA 3R0DA 1KNWA 4JNYA 3EDKA 4TXEA 3QR0A 1T7LA 1OZQA 1TPH1 4XBKA 4F40A 3CPUA 1PXGA 2J8GA 4LUSB 2J66A 2B0MA 1P6BA 3P8IA 4V1XA 1FRBA 4DRPA 1I0DA 1FDJA 4NI8A 4AIBA 3AIWA 4QCFA 5BROA 5LIKX 2VRKA 5LIYX 2C18A 4IL0A 4X63A 2HTMA 4DI9A 2JKAA 2VX4A 5I3GA 4AZHA 1GQJA 1OCQA 1X38A 3TYBA 2RURA 3W7OA 4H9ZA 4KWWA 1B30A 5EMUA 1KQYA 1C9WA 1JGMA 1CXHA 2CKRA 2QHAA 2ONEA 4FX8A 1QPNA 3ZWTA 3GXNA 3WBWA 2Z24A 2NQ9A 5A6KA 1ICPA 4FP1A 4PEEA 2YL9A 1W9DM 4K1GA 1E4MM 1GONA 1IX5A 4XISA 1R6WA 3N2OA 3LHYA 4C5ZA 1E1CB 1R9YA 2HXTA 2ZDSA 4MTVA 3LTYA 2PD5A 1Q65A 4RUBA 3OLDA 2X8RA 3K5XA 2ETNA 1VQTA 3KP0A 4CN1A 3JVAA 5TAOA 3QHMA 5JVLA 2Y7FA 1EA9C 4YVVA 3L4WA 1Y7VA 5JBEA 2ZWYA 2WANA 2HK0A 1VF8A 4OZOA 2CLHA 3AU6A 4QAIA 4NT0A 3CAVA 9CGTA 2QNEA 4O53A 1A5MC 3NOYA 1MO0A 3THQA 3BW4A 2FVKA 4GMEA 3WUFA 3B8TA 1UWRA 4ATLA 3M0HA 2QGYA 2PZNA 2JKEA 4NXKA 3NO1A 1GTEA 2Y2WA 4NZCA 4XSLA 1S3HA 3AO0A 5I07A 4O1BA 2VWSA 3GY1A 4WKHA 4H8NA 2C3ZA 1KQZA 3GHRA 4XBJA 2XYLA 2W92A 4RX0A 4FAMA 1QPFA 3A4XA 3TXZA 1Q13A 3ABRA 2V5KA 3AALA 1Q6EA 4NXSA 2VEMA 3T55A 1DPMA 4GJJA 4JCLA 3M0ZA 3GU2A 3NPVA 3CGMA 2QCLA 2YX0A 3O5JA 3ODKA 3LZ3A 2I5QA 2WMHA 3KDNA 1JRCA 3LDVA 2FZBA 1VKFA 3W28A 3IJDA 1EJWC 2F38A 3T1GA 4RDYA 3FKRA 3K4AA 1WNOA 3PB0A 2KO7A 4ZO7A 5CC3A 1XSJA 3A24A 3VM7A 2PN0A 2ATSA 4P7LA 2B31A 4F8XA 1TO3A 1GPFA 3OVQA 1K8YA 1UR2A 1RD5A 3SSZA 5HNUA 3TQPA 1VIWA 1YKWA 3AYVA 4B5VA 5C55A 3R5EA 3LUOA 1NF7A 4AC1X 3ARWA 4UB9A 1D6OA 2PCEA 1LWJA 2VD8A 2KGJA 4ALDA 1IEWA 1TV4A 3K1GA 2DJLA 1Z32X 2XGIA 4RNHA 3N18A 1BKHA 3P61A 2WQDA 2HV5A 1T40A 3B97A 5DFAA 4KWUA 2H8XA 3CQJA 4Q7NA 4F0MA 2HZGA 5KITA 4AZCA 5HUPA 1CB7B 3ISIX 3LGDA 1US0A 3H2CA 3FXYA 3S2NA 1A5NC 2VVNA 1WA3A 2R24A 4UTWC 3L67A 4K68A 3IV3A 4JBRA 3V36A 2BP1A 3SUSA 1OYBA 4G6CA 5F4SA 1TWDA 2D24A 2YA2A 4QHRA 4UCGA 2CBUA 3WG6A 2ITKA 4NYUA 4L61A 2INZA 1HP4A 4GY1A 4IG2A 3MWAA 4LBSA 5HTGA 4KESA 1D7KA 6TIMA 4CU6A 3ZVIA 2ON3A 1FH8A 2VRJA 1UD5A 1D8CA 2NV9A 1H5VA 3KZPA 1Z7AA 3M16A 4TV5A 3W73A 3WNNA 1HJVA 4I5UA 3IJIA 5GNZA 1PX3A 3E02A 5AY7A 1TPVA 2C13A 3RX4A 4DRNA 4ZB0A 3V7PA 3UU0A 2XP9A 3NPXA 4JIRA 3AI0A 1I45A 1MI3A 1ZTVA 2X41A 2X42A 3EBVA 3CIWA 3OODA 3MBDA 2F4EA 3M0IA 3UR8A 3MYOA 5C8BB 1YADA 1KD0A 4BQ2A 3CC1A 3UETA 2YKKA 3HJZA 4IFKA 3AFBA 3G8EA 1QNPA 4NZFA 2E40A 4UR7A 3GXTA 1V08A 4X22A 4B5UA 4XIMA 5IXEA 2ZUWA 2CLFA 1ONWA 5A6BD 1F4AA 3EDEA 2R94A 1W9PA 4DRJA 1YDYA 4HPGA 3KRSA 3L2IA 4TX6A 3IVTA 1MVYA 3PSVA 3PSWA 2DQWA 4GIVA 4Z1AA 4FNQA 1CXIA 3ZWSA 1W54A 2QCGA 4HA0A 3ZIZA 5D04C 4WJEA 3IARA 1UR1A 1JDCA 4DRIA 3E2VA 1IEQA 2VFEA 4N2YA 3R8HA 5DMYA 4MKSA 3E5BA 5A6AA 3GH7A 4DRHA 4WKFA 1LQ0A 1NU5A 3N6HA 1V5XA 3FA3A 1V93A 1I6NA 3MSDA 2HBXA 2FZMA 3M1ZA 5C71A 1VBUA 1O4UA 3TWAA 4WDUA 3GO2A 4MWAC 2CLIA 3H26A 3USZA 3DGBA 2A85A 3AWNA 3CWHA 3N2BA 3T09A 5D2XA 3SZ8A 2QCHA 1IT7A 1AA1B 1SSDA 3FKKA 5TD4A 4DM2A 2W61A 2WYSA 1Q7QA 5DRIA 3SUUA 4ZQNA 3KBWA 2BHZA 1XCWA 1RJRA 4LAYA 1TR1A 4FMVA 3CPRA 4NVTA 6ALDA 2XM2A 3IJ7A 2OSWA 3STFA 2XP4A 3BOLA 4LFYA 3WMBA 4P8UA 1E6NA 3NZ1A 4K8HA 4HU8A 1GG0A 1KV8A 5T26A 5DXXA 1SM9A 2A3LA 3E1F1 4MDPA 1YW5A 4ZBCA 3WLQA 4WQ6A 4LS0A 1FKHA 3RFWA 5M2FX 1RQBA 3P5ZA 3WH8A 2VC9A 4Z17A 5KZDA 3RX2A 1YE4A 1ROUA 3IRSA 4GH1A 4CU8A 1FCUA 1J4RA 3PJWA 3A4JA 2NXIA 2E9BA 3BARA 5D38A 3GDLA 2EAWA 3LHVA 4QRNA 3PFMA 4NX5A 1R46A 1VRDA 4JFUA 2INFA 4MZ1A 2KX9A 2PBCA 2VELA 4M24A 1FHUA 2IW0A 2IQDA 4PULA 2XP7A 4EWND 5LA1A 1YDNA 3BV7A 3MZNA 1HTIA 3MCOA 4U2YA 5KZ6A 4Q4OA 2GK1A 3W27A 4AISA 1EC9A 3CZJA 4HHHA 2GQ3A 3ES8A 1D7HA 2OTDA 5BXSA 5FAGA 4X2PA 4F3HA 1RY0A 2QYGA 1S46A 5DEZA 1BLIA 4TVDA 2DZBA 2F6KA 4CQDA 1EKOA 1R9XA 2G3IA 2PWEA 3CHCA 1PUDA 3WNMA 1TVPA 3PZIA 3WF2A 1XYFA 2QDEA 2D3NA 4NJHA 1VHCA 3GHUA 4L1GA 1HKIA 5J8LA 1F9CA 2FVLA 3K30A 4IT1A 2UV8G 4GJ1A 2OQHA 4HU3A 4DJDC 1MYRA 4YCPA 3ZJ6A 1ZJBA 1CXEA 3W88A 3OHMB 1A5SA 3I65A 1ZU8A 3W1TA 1OC6A 3W6LA 4N0RA 1IQ8A 2X0YA 3DXIA 3HG5A 2JEPA 4X9SA 1IGSA 2YCLA 1N8IA 4DUWA 4LS1A 1GGOA 1TTIA 3TYCA 1PHQA 1S5WA 4Z1CA 3I4EA 1YRRA 3GNPA 5CZJA 4ZSUA 1W5QA 1KFJA 1P1MA 1H41A 4AWUA 1UR8A 3QGVA 1EFZA 1EUNA 1GVYA 4HTYA 1F3EA 3I10A 4EANA 3EEZA 4RE2A 3BGAA 1MQQA 4QE4A 4BQ4A 4PCTA 2O4MA 3VIJA 5A8OA 1ZCOA 1UROA 3PF3A 4JTQA 1FWCC 3F03K 5I24A 2YZRA 1XLMA 1E3XA 3DC0A 4RNJA 3G1RA 3V1HA 1V6TA 5C5YA 1UMLA 3UPWA 3UVIA 2ACQA 1Q3NA 3KHDA 4AY8A 2D2GA 4O8RA 3W7MA 5I03A 4X2RA 4JX6A 2E7FA 2B81A 4RNFA 1AG1O 3BAYA 3JYJA 3HPSA 1ZBCA 1M65A 3VM5A 3SADA 2PS2A 4DZAA 5HPCA 1QT1A 4J3WA 4ATDA 1GJPA 3QYQA 3QOKA 2PTYA 3ZT5A 4P8VA 2NUXA 2PD9A 1SFLA 3GVWA 3UT0A 1A0CA 2ZA3A 1I1XA 4OUIA 1Q6OA 2W66A 2NQZA 2OVLA 2UY4A 3HMCA 2BNJA 1EGZA 3TN6A 1K6AA 2FB3A 3GAYA 4JQAA 3E0LA 2OWWA 3I6TA 1EIXA 4L9ZA 2W67A 4QG8A 4Y9OA 4JIQA 3FGCA 1K77A 2CZ5A 1LDCA 3T81A 5HAOA 4BJHA 1FWTA 2BVTA 3BG3A 3VZYA 1Q2SA 2PGWA 7A3HA 4BF7A 6A3HA 3HMJG 2IKHA 4HNUA 4CNUA 4GZJA 1KRMA 5HINA 4AF0A 3P14A 1HGYA 1UWSA 1UUOA 3SBFA 3UJSA 2RHGA 3FOKA 5I3JA 3MQTA 1NDWA 4AXKA 4GYFA 3JZEA 4FS9A 2GSEA 2Z6JA 4M6VA 3W7JA 4QE5A 3VE7A 2V3GA 4TU1A 1UWUA 2AL2A 3ITGA 1QOXA 4C1LA 3O5EA 2QUNA 4J3ZA 3MUIA 3LUTA 1ITUA 1VC4A 1A5OC 5HJLA 1KLZA 3C5QA 4CNNA 3FYPA 1IR2A 3BAKA 1JZ8A 3JW7A 1GOOA 2Z7GA 1CENA 1QASA 4XAGA 4MAZA 2YOCA 1QRQA 5SWUA 1DVJA 4W88A 1Z8AA 3ZR6A 1O6IA 2OLSA 1XSIA 4Q6JA 4QP0A 1FWNA 2G4FA 2Y8VA 4AX6A 4XZLX 1S2VA 3PBYA 2FZDA 2A7NA 1Q4NX 1MW1A 1D2KA 3GHTA 3W26A 3O5OA 3VOGA 4HNLA 1IWBA 1J2BA 5AHIA 4GLEA 3STCA 3GR7A 1E5JA 1LWHA 1XYCA 2VYOA 3AIRA 1KWGA 2VR4A 1QOPA 1FKGA 4E8DA 2EF9A 3SCWA 2CPUA 3LNMA 5EY5A 1BXNA 1JUBA 3QMTA 2FB2A 3CL8A 4HNCA 3UFYA 1ECEA 4H9VA 3NVDA 3RHGA 1W5PA 1UMYA 2QDGA 5DBUA 3SQMA 1PZ3A 4KKXA 2QIWA 4PMJA 2HVOA 1DWGM 2EBNA 4HA1A 5HNRA 5HMDA 3AIUA 4B5SA 1MMFA 3U2ZA 1RLCL 1TJ2A 3KX6A 4KBXA 3FXGA 4OGZA 3N14A 2WNNA 3SGZA 4DRSA 3HPXA 2V67A 7TAAA 3EWUA 4J3UA 3SIZA 1PBKA 1SVDA 1P7TB 3GVQA 3KVJA 3AS0A 5CPOA 3PNUA 4OU1A 2VZVA 5BMWA 2Y7GA 4G50A 2YLLA 3UR5A 1BG4A 2HNHA 3QVQA 5AYBA 3XISA 3KTSA 1ZSXA 1PCWA 4DBWA 4JFVA 1CPUA 4KIRA 4B9ZA 3KS5A 3GE7A 1XLIA 1BD0A 1G94A 1BYDA 5EMYA 1C90A 1SO4A 2CBVA 2Y88A 4ZMGA 2QJMA 4FX6M 4XSMA 4LCQA 3NTYA 3TC6A 4P7QA 2X40A 3FHQA 4C6KA 4QNEA 4XKYA 2R1NA 4GWEA 4AZIA 4AEFA 4CQAA 3GW3A 4G7EB 3NCOA 4Y9MA 1A80A 2WAGA 5REQB 3TYZA 2X05A 5BXPA 1OX5A 3SY1A 3GUGA 3S8HA 1NFGA 2P0IA 3DESA 1RK5A 4MB4A 3UERA 4O57A 1NTHA 1Q6UA 3W01A 4V15A 3UZWA 1DYSA 3PBVA 3PJTA 3IANA 3DYPA 2NQ5A 2JK2A 3EPOA 2QCDB 3BCDA 2FPYA 4GNKB 3O6DA 5A6MA 1ZENA 2ZIDA 2TRSA 3UZ5A 3W29A 1JL8A 3F2DA 3M0KA 3E0WA 4AIUA 4REQA 5JBFA 4FNUA 4FK9A 2Q5AA 3VDGA 2OSXA 1SSGA 2G3NA 2XFRA 1JFHA 1TVLA 4Q8PA 4JTAA 1ZGDA 2PSNA 3I3EA 4ZOCA 1B57A 4D8LA 1TFVA 4HMEA 3FSUA 1TTPA 4EOUA 3CJPA 1D7JA 3A13A 3BZGA 4IUGA 3RLGA 4AC7C 1KWKA 3HFTA 2PI6A 2WZEA 2VURA 1X8FA 1J01A 3SCPA 3N17A 4NJGA 2QEZA 3QJAA 1XLAA 2DQXA 1H7OA 1RA0A 1JEZA 2J9ZA 2DZPA 4ZQCA 4N7QA 3ABQA 1ZNNA 1TTQA 4CD4A 3GNNA 3E2SA 3UVAA 3VDHA 3M43A 2P76A 5D33A 3SM0A 1EOKA 3MT1A 5CGTA 2PDGA 4E8CA 1ZB5A 4O14A 5KEZA 3JZUA 2VQUA 2V3DA 4ODLA 4GKTA 1X96A 3AS1A 1O12A 1HVQA 2PZ0A 3U5UA 5EFDA 3BV4A 3TW6A 1PWMA 2VEFA 4HMNA 4GCXA 3AC0A 1GRJA 1FKDA 2ZZ7A 2JKPA 1M7XA 2Z0IA 4XZBA 4JTLA 1KT0A 3CU2A 3PTMA 4UWMA 3M5XA 2PE4A 1WBJA 3UPBA 1V6WA 1E6ZA 1QUMA 4MLRA 3GNOA 1V6VA 4DZ2A 2OZ0A 3SI9A 4C1KA 2D23A 1H2JA 2GL5A 1H5YA 1TA3A 1V3IA 3B0UX 3RPDA 3CV1A 3ANYA 1WCGA 2C16A 4E2OA 2I56A 3M0MA 4ZXOA 3ZSSA 4ODNA 4IJCA 2QF8A 4YTUA 4LCSA 2VFFA 3IK4A 4DHGA 1JDDA 3DFOA 3TTOA 1MQRA 1QI2A 3T8LA 4BWLC 5A8MA 3RIKA 5C9UA 1K6WA 4LAVA 1UASA 2AQWA 3CMGA 5CZSA 5DLCA 1D3CA 1GVIA 5FL1A 1EJ7L 3LGEA 3GXPA 1RPXA 1TWSA 5TF0A 2VJXA 1WAWA 2AWGA 1C3FA 3OPSA 4A8LA 3WELA 1OCNA 1W1ZA 3VUSA 3CIVA 2VGIA 4ZODA 2XFWA 4GJIA 1G69A 5B7YA 1HQTA 1YW1A 3O9NA 4HBEA 2I7GA 1GOWA 3NJ3A 3VCRA 3CO4A 3KAHA 1IXOA 3OZOA 1TZ9A 3QLDA 4IFOA 2EULA 3RNDA 3MKCA 3L9CA 2OFJA 1ITCA 2I5IA 3W1NA 1K4GA 4CD5A 1B5TA 3LCXA 1EWDA 3WJYA 3LSBA 4EXQA 2VFIA 1CCWB 4QIUA 4MPKA 2J77A 3BJTA 3ID7A 2H9AA 1ISZA 2BOEX 3UQNA 1JAKA 4N6EA 4BCEA 2HVMA 3KRUA 3W6YA 4UQEA 1EYMA 1K03A 3EB2A 2OCZA 2VHLA 5LA2A 1YBQA 1DJWA 4LVAA 2VC6A 2OGYA 3MMDA 4ASTA 1MEHA 1I2RA 1KBIA 1DWAM 2RJGA 1P48A 2ZZ4A 5JIWA 4AVNA 1ITXA 3GDMA 4WGXA 5HMFA 2XSXA 5BXRA 5ECVA 2WKGA 1HXVA 2GJRA 4LYQA 2ZZ1A 3ZS4A 4TYOA 1DHPA 4ZOEA 3PRAA 1FBAA 3M5VA 1QI5A 1ZJAA 3KLKA 4D6GA 3CGTA 4RW3A 4JIIX 4DF1A 2J47A 3KZSA 3R11A 1FWEC 5K4XA 3W2NA 6PTDA 4L80A 4C7FA 3O5KA 1PYMA 2D2OA 3FSTA 3WQPA 4US5A 1A4MA 4PMDA 3RO8A 1VYPX 2FH8A 2X2GA 2GJLA 3QR3A 1YIXA 2JE8A 2F7FA 1HKVA 3WMCA 4Q4SA 2HPIA 2PF0A 3GTNA 3S42A 5T9BG 1BYCA 4KETA 2CCRA 3LS9A 3W22A 3IAPA 4KW2A 4HHPA 1XGZA 3GYCA 3MJMA 3U5YA 5MKGA 3WLKX 4LVBA 2DFAA 4QZVB 5JH2A 4JL1A 3EWXA 4NRSA 3JRKA 5HQEA 3SCUA 3G2GA 1YXYA 5ECUA 1HO1A 1SQ7A 3OOQA 2ASHA 1W1B1 4ML9A 3M07A 2ZXDA 1F6YA 2A3BA 4MPQA 2QXWA 4S39A 3PZNA 4DZ3A 3QZ6A 2V2HA 2K8IA 4AHQA 3CQKA 4P61A 4URIA 3CEPA 1XIIA 3MUAA 4HCLA 1E6RA 4GD0A 4QQUA 2NVAA 1LBFA 5G2IA 3CH9A 2F6UA 4QNWA 4GVFA 1K70A 4S3GA 1SFSA 4K7VA 2DY3A 4PTDA 3G3MA 3BW2A 2ZE0A 3EX2A 3DH7A 5HUAA 1JZ7A 4RZ4A 1JIBA 5DBTA 3URNA 2PWUA 3TDBA 1DTNA 1H0GA 1F7BA 4RR4A 3KUMA 1L6GA 3C0SA 3BICA 3Q94A 4HT3A 4KWOA 4O54A 2VX7A 4F48A 5KSWA 4IIDA 3NSMA 4S1FA 2F9RA 3H7UA 3RM9A 3NA8A 1IV8A 3M4HA 5BWAA 3AUOA 3EDDA 5GJMA 4ENLA 1EQCA 3BPWA 3H22A 2FQIA 2Q8LA 2ZYFA 3VD4A 2VI0A 1E51A 2ZQTA 4MYXA 4A35A 4PMQA 1OF8A 4DLFA 3MA8A 2J4GA 3GG1A 1P6WA 3IJQA 4I7UA 2XPBA 1O68A 2QV4A 1J6YA 1S5VA 1VP5A 4CLMA 4EVZA 1I4NA 4S3JA 4Y7EA 2PDKA 4WDXA 2HNEA 1LUCB 2P0OA 3KBSA 2WSYA 3LENA 2X2YA 1P1XA 1FH7A 6ENLA 4G56A 1KCLA 4YLWA 1R7OA 3TX9A 3KOZA 3AYSA 4R27A 4OT7A 3K8MA 3SDOA 3KAGA 1W3KA 1WUFA 1ZAJA 2BFGA 4PSRA 3QLLA 5CPTA 4CD8A 1YTEA 4OBSA 2QQ6A 4ORIA 2VEGA 1U22A 1OT2A 3LYEA 4PL2A 4JIHA 3QQ1A 1R3RA 1NY1A 4LRTA 2MLYA 4I9TA 4MNJA 2BXZA 4WJXA 1LOLA 4PH6A 4HVXA 1OJXA 4H83A 3WJXA 1GOMA 2OEJA 2ZR4A 3GD6A 4S2CA 3LCIA 3LY0A 1ZJHA 4DWSB 3DBNA 1VIZA 2ZUNA 4MG4A 3MO4A 4JN7A 5AVHA 4JQ3A 5HT1A 2OFNA 4CN6A 3V5CA 2A1YA 1MQPA 4F9JA 3O5DA 4PTWA 4WJ8A 3AICA 1AK5A 1U5HA 4QJ3B 3OBAA 2CLLA 4Q8TA 4EKJA 3PK7A 1FKJA 4CQ9A 4XB3A 3VKAA 4EPBC 1JNDA 1YXDA 5JUVA 2D0HA 4UOJA 4A05A 1ZS2A 3HGSA 4KGJA 2QCNA 2VP8A 1TPEA 2PODA 3L21A 3TONA 4HK5A 2XSBA 5CSRA 5AHFA 4JKLA 2WHLA 2CXGA 4PCFA 3NDZA 2FKPA 3ES7A 3IAQA 2BMBA 2F21A 1ZFJA 4B5TA 3QY7A 3BAIA 3ABSA 2V68A 1XRTA 3LXBA 1A5AA 1KBKA 4IWWA 2P4VA 3UI4A 3NOEA 1M01A 4HA3A 1KFEA 3PR2A 1HL2A 4O16A 1YTKA 1PKMA 3QF0A 1VYRA 2W79A 3GKAA 5HWNA 1OYAA 2L5HA 3BLEA 1H51A 1EBGA 2XVPA 4RPPA 3HB9A 3B9DA 3CL7A 4WKAA 4IL2A 2TYSA 4NASA 4QDMA 3COTA 3SCTA 2PU0A 4HN8A 2CZEA 4NYYA 4J4NA 3NNTA 3JUGA 3RO6A 3OB8A 4GRSA 3QC0A 4PUDA 3A4AA 3DGRA 3L68A 4AVFA 1M6JA 1FAPA 4NU7A 2XGZA 4Q6XA 3RXZA 5A6LA 1KXHA 2J79A 4W93A 3WQEA 4WR3A 3ELFA 5DITA 3HN3A 1GT8A 1J12A 4C6LA 1I60A 1KV5A 4LW7A 4WSJA 5HQLA 3DFNA 1NWRA 2VO5A 4U3CA 4FXFA 4MIMA 1FHLA 3C0JA 4E6MA 3GXMA 2L2SA 1YLVA 3AZTA 4DO7A 2OEKA 5DCEA 3L5AA 1OF6A 1LG1A 3AZSA 3XINA 1RD6A 2QUMA 2YL8A 4N42A 2YZ5A 1B3YA 4C6EA 3M64A 4MY8A 3W75A 6TAAA 3PBWA 4U86A 3WQWA 1XIHA 4I5XA 5FEWA 4PMVA 1VCGA 5CC6A 2OJPA 3P6LA 2CEQA 4AYGA 2WO5A 4XD3A 3OHIA 2EPOA 2PP1A 5CJ5A 3QSTA 1LQAA 3REQA 4HZ8A 3LA4A 1E1FA 3LPFA 1XIBA 2IUZA 5A95A 2CLKA 1W3TA 7CGTA 1QPLA 3SW6A 1P0NA 1KTNA 3PM6A 4ZFMA 2F6XA 3NQ2A 4K36A 4PCSA 1R3VA 1E6XM 2FHBA 1W3NA 4N6FA 1NDYA 3HU7A 3MB9A 2DZSA 1F73A 3KVMA 3IGUA 3BMWA 1GZ1A 1EEPA 1P5BA 4L7ZA 4PFHA 1H1YA 1ME7A 1JF6A 3JYMA 1TPC1 4ZEPA 2JGYA 3ZLHA 3MZ2A 2YFOA 5FD0A 1R3QA 2Q8ZA 2Z1WA 1V0LA 2ISWA 4LRSA 1H7RA 2F61A 4QSHA 4GQRA 3PAOA 4LX4A 3LM7A 4LVFA 3PNZA 5BOEA 2ZX8A 3KWSA 3FLUA 4UQDA 1GVQA 1UOKA 4TMBA 4K2SA 3DFQA 3RJYA 5A8GA 3UJEA 5DANA 3W81A 2Z26A 3P84A 2AQOA 1V7AA 4XAYA 4KIEA 3B0PA 1G0CA 3Q65A 5H1WA 2Q6ZA 4F0RA 4AVOA 3EPNA 1BEUA 3KL5A 3WQFA 3NZGA 4IQ2A 3ZM8A 1EYWA 2QUUA 3ERPA 1GUVA 2PBGA 2XINA 4CQ8A 1YMYA 1WV2A 2GGHA 1HJSA 2DORA 3BWWA 1BRLB 4ACZB 5A6SA 3BG9A 4D6HA 2OMAA 1GYNA 2F2DA 1B6CA 2G37A 3O0FA 3PG8A 2GSJA 4Z08A 3W7GA 3B8WA 3G1VA 2J88A 4GYKA 2F84A 1J9YA 3GNDA 5DQPA 5B80A 3FYOA 5XIAA 2Y62A 2E1DA 4FAPA 5HMSA 1E9ZB 3QFEA 5M17A 4JHZA 3H7VA 4FXRA 3PJXA 4C6IA 4PCPA 1VH7A 4Q8OA 3LHUA 4GX9A 3UQAA 2YXOA 4R3UA 3NIYA 1Q6LA 2XGBA 2DT0A 4LB3A 4G1NA 2XFYA 1QWKA 2E8YA 3UWWA 3AISA 3GKFA 1GW1A 9XIMA 3UCDA 3EWDA 4CN4A 4DN1A 2FH6A 4N9DA 3IWPA 2YYTA 4RL3A 3GNXA 3EYPA 1XI3A 2CZDA 1I2PA 3LLXA 1HUVA 4M3PA 2MLXA 1UPMB 1EUAA 2RDUA 3LK6A 5KTLA 3W1AA 2C1IA 5BRQA 1VD6A 3VNZA 4E2VA 4NHVA 3C0LA 1TCOC 1J18A 4M56A 3BLKA 4PCNA 1GVFA 1BFNA 1AJ0A 3S0CA 3IJ6A 1DJZA 3U0HA 1L8PA 2VNCA 5A6BA 3VDBA 2Q3RA 4W8BA 1P43A 2BX7A 4YU1A 3RGCA 4U4MA 1XV8A 3UW6A 3GU0A 3H2EA 3A21A 3N4EA 1CBGA 1GCYA 3KLLA 3VGBA 1EJTC 4E5TA 4KT2A 3L23A 4IG2B 3FK4A 3CO8A 4W84A 1GORA 3CLMA 2FJKA 4O28A 2QAFA 4GUJA 2NV2A 3L4VA 2P53A 5F2MA 3LRKA 3TWBA 3PTKA 1XLJA 4Y9PA 4IP7A 1V6XA 1RQHA 3WZ0E 1CGYA 1UIOA 4WUIA 1M9HA 3NPUA 3V0UA 4WVXA 1L6YA 2EPMX 3GG7A 4JY9A 3SCNA 4QDWA 4B4FA 4RZ6A 3MHFA 4C6MA 1PIFA 2CU0A 4CQBA 1V7YA 3LV5A 1IT0A 3B05A 1XLLA 2I1OA 1B3ZA 1UR0A 5LKYA 3ANVA 3KCEA 4OIFA 1PV8A 4I8DA 3CWOX 4K6AA 1M03A 4W89A 3TC5A 3W7IA 1H60A 3NM3A 3MDYB 3TZNA 3TTSA 5LYRA 3LXCA 4P8WA 2Y89A 7XIMA 1Y0OA 3PBMA 3ZT7A 2JALA 4NQ1A 1GOQA 3SEPA 3WL1A 5E0KA 1QJWA 1PIIA 3EX4A 3UWYA 1JYXA 1ZALA 1N82A 4GQBA 1KFCA 5AYIA 1JCLA 1VFTA 2QW5A 1H4PA 3P3BA 5I2UA 5I5RA 4L64A 2IQTA 1EL3A 1DBTA 2VD9A 2RFGA 4H01A 1FP9A 1MFVA 1PB0A 3BLLA 2OLAA 2FZ8A 3IJ8A 3TJLA 1O94A 3E5PA 2LLEA 3VCNA 4DAFA 1UA3A 1KKRA 2WLYA 1CECA 1NEYA 1UOZA 3DBPA 4HTBA 1B1YA 1RZMA 2NQHA 3CHEA 2XIBA 4K7YA 1TX0A 3RR1A 4PMXA 4HQVA 2CLEA 5BU9A 4NJJA 5FJTA 5HWBA 3S1UA 1YQ2A 3UZJA 3DUGA 5E0FA 5LNVA 4QTGA 4H8HA 4NJKA 3S46A 3A64A 3OQ8A 3HA1A 3CQ0A 4HK6A 3VFCA 5ABFB 1TKKA 2OT0A 1YPFA 2IXUA 3ZR5A 1BPLB 2ISVA 1RA5A 4F0KA 1ZK6A 3WQGA 4LV9A 3TR9A 3IKDA 3WK1A 1UJQA 1FX6A 3UG3A 5BXTA 3EX3A 2WZIA 3VD5A 3F4VA 6XIAA 3N04A 1ITQA 1YX1A 1PX8A 2NZLA 3SRHA 5AC4A 1DQWA 3SO7A 4J3XA 3EA2A 1RCOB 1UKOA 1BAGA 3R7MA 1H3GA 2X0SA 3NG3A 2MNRA 1DIDA 2FTYA 1AL8A 1XP3A 4ZPWR 3RITA 2OYLA 3TU9A 5F2IA 1J6OA 1U83A 2DT1A 1S38A 4OBTA 1FKXA 1O5RA 2AGKA 2WSKA 3K8LA 4OOZA 1VJZA 4IGHA 3PAJA 1G4EA 2QIIA 4H9UA 1FWGC 3EY6A 3C8NA 2I16A 2QKFA 1MUMA 3IVSA 2EJ1A 1SO5A 3C3UA 5ABTA 1H7WA 1T99A 5E5CA 3M44A 5HATA 4LALA 3GBDA 3R25A 3OA3A 5EKYA 3S4TA 1E0UA 4PGLA 2J7GA 1R0MA 1LP6A 2OZTA 1WDRA 5AFDA 1BL4A 2D2JA 4GIAA 5LIXX 4L1WA 1F07A 1G67A 2PLJA 3FFSA 1I2NA 4F0HA 2J25A 4ZR8A 1KLYA 3BSMA 4YWSA 1VR6A 2GK1B 5CBBA 1WQ5A 1OX6A 3LHWA 1I1WA 3C0QA 2ZUMA 2ACSA 4BY3A 5K9CA 1GTHA 2V5CA 2EEXA 3TQKA 4QLJA 3H23A 1GYMA 1W9XA 3ZR4A 4FNPA 3NL5A 1POJA 2FDSA 4Q32A 5AVNA 1FWBC 2GUYA 3A3XA 4IP4A 5ABGA 3T78A 1GW9A 3GPKA 1XLCA 2GGIA 1EIBA 1V79A 3ITVA 4G7FA 1XUUA 3V4BA 2RAGA 4DWSD 4UUIA 4MVAA 2Q01A 1NDZA 4TVUA 1KXTA 3TOPA 4IIEA 1EXPA 4FNRA 4CCZA 1E4NA 1V02A 1V3HA 4JTIA 2Z2BA 1Q66A 5LHFA 3HQ1A 5CZKA 1J8VA 3TAOA 2NX9A 1HJXA 1D7IA 4JQ2A 2QPXA 4AD5A 2ZKMX 4LYKA 3GH4A 4JS3A 4J5NA 2PUZA 1AODA 3F4DA 1A47A 3V1PA 2A3AA 2BHYA 3A4WA 3BC9A 3VOCA 2VFDA 2XPAA 5DT5A 3R8GA 1S1RA 2YLAA 3GVRA 1C91A 2ZX9A 4XZ9A 3QXBA 3HGJA 4KGLA 1U2YA 3OU8A 4U5IA 1E4LA 3EDFA 1XG4A 1GZGA 4LUSA 4NP7A 5D03A 3B9EA 3TLLA 1IYXA 3I7SA 1NF0A 5FSDC 2GGEA 3BSHA 3MI3A 1LROA 2F8QA 2YDRA 3AXMA 4AY7A 2XPKA 4S3FA 4UOZA 4WX2A 1HW6A 2QMJA 3CUHA 2AKZA 3W1XA 2DH2A 3AIQA 1TTJA 5TQLA 5IBXA 1IXQA 1AH3A 3W1RA 5BNKA 4O4VA 4UFIA 1US2A 4FN2A 1N7KA 4XUGA 2CHNA 1OADA 4R7WA 3CZ8A 4JTHA 3MVIA 2F2HA 1PINA 4W86A 1FCBA 3S2MA 3M0VA 4IOTA 3PTDA 3B9AA 2E9MA 2Z6IA 1WB0A 1UC4A 2GSHA 2JIWA 2PDWA 4QBXA 1IWPA 3ARQA 4H7VA 2PDNA 4ONVA 3WH5A 4O17A 4RE0A 3WLHA 3A5VA 3NQBA 3ZYZA 2PDQA 3FX4A 1XPYA 2J75A 2ZVRA 2EG7A 4D6JA 1RHCA 1YDOA 3BQ5A 1G4TA 2X1IA 4Y90A 5AC5A 2O9TA 1KFKA 4O1AA 4IIHA 2DIJA 3ARRA 1PJ9A 2DVUA 1IHIA 1WAUA 5T91A 3IK8A 3BURA 1YPXA 3PZQA 2B7NA 3WD2A 3ZLFA 1NSGA 1XIDA 1Y5XA 1IXNA 3L12A 3T4WA 2Q3OA 3W1LA 4PMUA 3T08A 1R7AA 1DE5A 4QJ1A 1G7VA 2FMOA 2PC4A 1JCJA 5E6ZA 1B54A 3N4AA 3R58A 4E8GA 5I0DA 4FI4A 4P7OA 3R0KA 4JEQA 4RK8A 4DJFD 4S3EA 4ZQPA 3WF0A 3AMDA 3D47A 4E38A 1MNSA 1XYMA 3R0UA 4EX4A 3W7NA 1EYEA 1BQCA 3CMJA 3O5RA 2C14A 1OD8A 3DC8A 1XBYA 3BDKA 2PWHA 4DELA 1W5MA 4J2PA 4G1KA 4W85A 2G95A 1B0IA 3VMNA 4IIGA 1Y8BA 1H49A 2RUDA 4JYDA 1R3SA 3K2GA 3KHJA 3KCLA 4IQLA 3G3DA 2GUBA 3ME3A 2BXVA 1TX2A 1NWUA 3SN1A 3E96A 2E3ZA 3HF3A 4HN4A 4F0LA 1F05A 2KR7A 1NELA 3W7LA 1IT8A 1V0MA 2ALRA 1BKFA 1FWIC 3LRMA 4O18A 4DB7A 3K4DA 2P8CA 2W0UA 4BK9A 1A5KC 1Y5VA 5GPGA 2A3HA 3MKVA 3THAA 2WWDA 2Z1SA 1SZEA 4IMDA 3DYOA 3CIXA 3GX9A 3WH6A 4HBOA 5CSSA 1LG2A 1ZY9A 3G6MA 2WPGA 1VFSA 1W9BM 5C9XA 2QCCA 4LUTA 3WK0A 4U10A 1QBAA 3PUGA 2YFNA 3FDGA 3GK0A 1QI4A 2CHRA 3KM8A 3GDBA 2IF4A 4W7WA 4QAWA 4BI5A 3TSBA 4OTKA 3LPGA 3CGNA 1EXBA 4JR5A 3BMVA 2ALDA 1V6YA 2DSZA 1T11A 3OGSA 3G1HA 2ZR5A 3RM4A 4XZNX 1PDYA 1R9HA 3BQ6A 5TIMA 4CNTA 3KTCA 1M5WA 3BLDA 4QISA 3W72A 1FKIA 4HSNA 3U57A 4FSAA 1BF2A 1G4SA 4OFCA 5FIPA 4M7SA 1UC5A 2AMGA 2VDHA 4A3RA 1F8AB 2PPGA 3GG8A 3AZRA 4B92A 1QPRA 3POHA 3WL0A 1VBJA 2DG9A 3QQ0A 2C1GA 2OG9A 4U84A 3MU7A 5FJOA 1EHAA 1SW3A 2XVKA 3DOPA 3NZRA 4PMOA 4OVXA 4IGMA 2ZX7A 1JZ5A 1OBAA 4IH3A 3IHZA 4QT2A 3N9KA 4MUPA 3STGA 1KM6A 4UQ9A 3W7HA 3WDRA 1LL6A 4PEKA 3C3NA 3O5IA 3RRAA 2P50A 3VPLA 4DZ5A 4Q8VA 3L65A 3AXXA 2V8ZA 2ZXBA 1Q6FA 4MWAE 4PMZA 5L9FA 1QK2A 1DJNA 3OTRA 2D2HA 4HB7A 4V33A 1JYWA 5D2WA 1SMDA 1M5YA 2WVSA 3WQ8A 4TW6A 1LF1A 1X39A 1G7UA 3ALGA 4W9TA 4M6QA 4LXFA 3EXSA 1KXVA 5CZTA 1L0PA 4R34A 1F6PA 3UZZA 2O4QA 3MW7A 4MSSA 1QATA 1Z69A 3HQPA 1E72M 2VGGA 3OOBA 1K7FA 3BLFA 2B5UB 3MP4A 3W84A 3KEHA 4GY0A 4UCFA 4KCUA 2VCAA 3R10A 3AMLA 5I3KA 2G97A 3GFYA 1OC5A 3ARUA 3VGHA 1TQJA 4LU0A 3ANUA 5CGQA 3B04A 3ATZA 4LAMA 2F23A 4HK7A 3V16A 1XG3A 1UG6A 2X16A 1SGJA 4PMYA 3QMSA 4LEQA 3W2LA 1UUQA 4IUOA 3GB6A 1IZJA 2A79A 3LB0A 1SJDA 1WKEA 1AH4A 1FDZA 2A4AA 4ZOBA 2VZTA 1OFPA 3IIXA 3UYCA 5BXJA 3POCA 4UFJA 4EF9A 3M0LA 1SJAA 3BSGA 3OLIA 2HWGA 1YPIA 2I9UA 3CUGA 1KBBA 2XH0A 1HT6A 1TV3A 1GVOA 1AW2A 2Z25A 4KRUA 1TJ0A 1U5VA 2NX1A 1EHNA 2BHUA 3HPZA 3WEZA 3OGRA 2HQAA 3G1YA 1U30A 3QZAA 1JULA 3ICJA 1TWZA 3P7YA 1ZBVA 1Q7MA 1RY8A 4XO7A 5ENLA 1KR1A 3LU2A 2TSYA 1FWHC 3SIMA 4JTSA 3VC6A 3UXDA 3VI2A 1SPQA 1VENA 3M9YA 4NIRA 3G24A 4H2CA 2ACRA 2NSXA 1A53A 2E68A 1TPFA 2BY0A 2RUCA 3VZZA 1FUYA 7REQB 4J1OA 2O56A 1TV7A 4MJMA 4TW7A 5K9XA 3VGGA 5H8PA 3CMFA 1ZAIA 4GA8A 3S5NA 1J0HA 3VNMA 1X97A 2ZOXA 4QR6A 2Z4GA 2XM1A 3GU1A 2A6LA 2VWTA 4WLCA 1I8JA 1ESWA 3CUZA 5DELA 1XH0A 1HP5A 2WB5A 3AU2A 4NX0A 1UIPA 5U7SA 3UG5A 1RLDA 5AC6A 1CB2A 2EQDA 4RZBA 4DEFA 2XHYA 4YPJA 1TMHA 2LPVA 3I7QA 4C6NA 1XD0A 1XQKA 1XXXA 1R38A 4PUMA 5BRBA 1IE7C 3NQVA 4IX0A 3RDKA 4MY1A 5LIWX 2DJXA 4O4WA 2J7BA 3HQOA 4H9XA 5C6MA 1KRBC 3S1GA 4I6VA 2WNWA 1NP2A 3GQYA 2VEIA 2G3MA 4YJ5A 3C2OA 1K4HA 4GGBA 1E5NA 3I6RA 4DF0A 3VILA 2HEJA 2HE5A 4MLJA 1O95A 3PZTA 3E12A 3WQ5A 1TIMA 1E40A 4A22A 3VGDA 1CIUA 1UWIA 4KERA 4XTDA 4AWTA 1HGWA 1YNYA 1ZLPA 1CI1A 3MCMA 1EOMA 1ADSA 2OKOA 2YDAA 4UNIA 4AG0A 1X1OA 3W7PA 4MFDA 3CZGA 3PZVA 1O5XA 1XL9A 5A3HA 3N73A 4KEUA 3QC3A 1QPKA 3S2JA 4GIRA 3ZZ1A 4MDOA 3N11A 4CKQA 5DCDA 4MHBA 1JRBA 2GVLA 2VKZG 2QJNA 3TW9A 2NT1A 1L8NA 1JZ4A 3LI1A 2HJPA 1G1YA 2VC7A 4GPNA 1V0NA 4GINA 1YATA 3W82A 5I06A 3QQWA 1YBQB 1GVRA 3WBEA 1V03A 1DE6A 1B3XA 1TELA 4AIEA 1CNVA 4TQTA 2WC7A 2QCFA 2J6VA 4J27A 5D9MA 3H2NA 1BWKA 1AH0A 1DJYA 1DWFM 2C8NA 1BGGA 4WD0A 2PBOA 4IPLA 2D69A 2EPHA 4K38A 4YL2A 3W2JA 4AUBA 4GK8A 4R9OA 4H6KA 1KGXA 1JUEA 4JFTA 5AC8A 3GAKA 4POCA 4GI8A 3THUA 2OWCA 1LCOA 4ACYA 5CBIA 3IVUA 3QHNA 4D72A 3AJXA 5JBDA 2YXXA 3ARZA 2PTZA 3TN5A 4NNRA 1QHOA 5AOUA 4L9XA 1FKBA 3KE0A 2YB4A 4WXZA 3NYDA 4WGHA 5D9PA 2POTA 1O66A 2VX5A 1CDGA 4GCAA 4WDTA 1LOSA 5H6HA 1F76A 3UYIA 3RCYA 3PUOA 2FHCA 1C8YA 3ITTA 4XTIA 4PB3A 1ME9A 1JYNA 3P93A 1GG1A 4PN2A 3UNTA 4Q4KA 2PGFA 3NPWA 4IZGA 4JTUA 4O11A 3L4XA 4XQ6A 2CHOA 1Q6IA 3WK2A 4QITA 4E2BA 1XH1A 2AAMA 4IM4A 3TUUA 3O8AA 3PN8A 4XUYA 5U4NA 5HR7A 2HS6A 5C9ZA 4KQZA 3UCCA 4XV0A 1A5UA 3AOFA 2OSYA 1L1PA 5DMMA 3WLJA 1CW2A 5TBOA 4UQAA 1HKJA 4DI8A 1D3GA 1PVNA 2PV2A 4JFKA 1QCWA 1LT8A 2UZ9A 2QV5A 1Y5WA 3LCHA 2OYMA 3SECA 5IFPA 4LTSA 4HOZA 4KH2A 7PTDA 4DUXA 5I3HA 3VTRA 4NNBA 1DJGA 4LC6A 4B3KA 4L65A 4CEUC 4JYFA 1E6QM 5EL1A 1OFAA 3LCLA 2NVDA 1NIUA 1BHGA 3WFZA 1NM9A 3Q45A 4PTMA 2VRQA 5C7VA 2ZWZA 4Y9NA 2VDGA 4Q8QA 2RKXA 4J3SA 5CCZA 5AYZA 3ZSTA 4KRTA 4ES4A 4YS1A 1WP6A 1O5QA 4QLLA 2QLYA 3UXKA 1J0YA 3HBLA 5FJJA 4HOXA 5HMEA 2O9RA 5FOOA 4ZO6A 1A49A 3SFKA 4UTKA 2NLYA 3NR0A 1FWSA 2V69A 2VM8A 2WMIB 3WKZA 3TKFA 3TMQA 5GVJA 1W1A1 5FCZA 4JFSA 2ESCA 2OXNA 5C54A 4G2DA 4GY7A 1D3HA 4R0XA 5BW6A 4JYEA 1XWYA 2M1IA 5JU6A 1JVNA 4NG3A 3DFHA 3VOIA 4N02A 2G8ZA 1XJBA 3GH5A 2R8WA 1WDSA 3MMWA 4G8TA 1ZP3A 1KTBA 3W1PA 1TWIA 1OGSA 4J9JA 1JYVA 5AHLA 3OLGA 2DSVA 3LXAA 3DHDA 3QEZA 5M3WA 4D9PA 3ZFHA 4J4OA 2DIEA 4EACA 3BGGA 5C9WA 1L6FA 3WDHA 2AOSA 1BVZA 2VX6A 2R1PA 4RNIA 4DPPA 2Z2AA 2X1UA 1J4EA 1CXKA 3EMCA 1GNXA 3V35A 3WLLA 3GC2A 3O6CA 2H8ZA 2XIQA 3ITLA 5E9XA 3O7UA 5F1VA 1U1HA 5BOFA 1QVBA 2P10A 4UTTA 1KBLA 2A3EA 1GK8A 3AQUA 3KFTA 4J2MA 4XZIA 1C7SA 1P7TA 4GNJA 1XDMA 3GFZA 3D6NA 2BBFA 3A5FA 4XZWA 3TVAA 5ABEA 4IX2A 2NXGA 3T2QA 3O2LA 2YCEA 1RJPA 4FPSA 1JJKA 2ZZ6A 3ITOA 2IS7A 3GZAA 2ZC1A 4NY2A 2OT1A 3TA9A 2GVEA 5IRPA 4GI6A 1MW3A 1N8FA 3NDYA 1VZWA 1W3LA 2I17A 1W5NA 4WRHA 3BUVA 3OJGA 5A2CA 5D4YA 1R87A 2PP0A 2PTWA 1IWAA 5GNXA 4OKDA 2VR2A 4JPGA 3GXIA 2D20A 4C7GA 4JDBA 2FTPA 5LNSA 3TAKA 3FHAA 3QV9A 3ITXA 2DT3A 2WM0A 4ICCX 4IMAA 2WJEA 1W1IE 5REQA 3W7RA 4IPXA 2Z2UA 3QV6A 1G4PA 1ZPTA 4LGXA 5CLTA 1HKKA 1ZZMA 2DSKA 3GDRA 4UNKA 2B7QA 1EJRC 3EKGA 3Q4DA 2QJGA 1P4CA 3LNPA 5M1TA 3FY1A 1NOUA 3VOJA 3RILA 1AD4A 1JQVA 4OECA 1TYGA 1NMWA 2QCDA 4HJWA 1AMYA 1QAPA 3DZ1A 2RH9A 1EBHA 1TJPA 2CETA 1QR7A 1W31A 1RVKA 3EOEA 1UYQA 2NT0A 3UPMA 2IKJA 2Y6ZA 3WYZA 2EPKX 2E77A 2XSAA 3KRBA 4ZVJA 1OY0A 1TE6A 2PA6A 5I79A 3OYZA 2ICSA 1V51A 1FA2A 1AW5A 4TVCA 2OOGA 2PWGA 4Q8WA 1DIKA 3IGXA 3R79A 3TROA 2NSOA 4N19A 4EF8A 3WH9A 4TUFA 4I7VA 4N9BA 4ZO9A 3QFWA 3VIKA 1K8ZA 3L4YA 2AMXA 2E6FA 5ABHA 5BU6A 4F4RA 5F2GA 3AMKA 3P80A 4GXMA 3C4UA 2BB0A 2X30A 4ADSA 1VCVA 3W76A 4MMWA 4QROA 4WDWA 4K1WA 6XIMA 4D6DA 2WJDA 3W02A 3EMZA 4W8LA 3BMBA 2PDCA 2DVTA 1XHGA 1AQ0A 2V5BA 1YHTA 2D22A 1JI2A 3IJLA 1SZGA 3AHVA 4ZCWA 2QR6A 3N2TA 1ISXA 2NQLA 1FQ0A 5HNTA 4AW7A 4Q33A 1Z42A 4J28A 4DXKA 3PPGA 4DIPA 3I6CA 3TW7A 2ZA1A 1ONXA 4DY1A 1J96A 3IPWA 5DIVA 3VFLA 1K02A 1XIFA 3VDCA 1BTMA 1HG3A 5FI8A 2V81A 3NM1A 3U2CA 1ZCCA 4G5DA 3W9ZA 1M68A 2FPTA 3T8QA 2VZSA 4X61A 1A0DA 1WZKA 5FAJA 4EPDC 2GDQA 5LNWA 4ERAA 2CNCA 4ZPVR 4MJ4A 4NAEB 4IT6A 1RPKA 5C7HA 5GPRA 4R9XA 4CU7A 4ZQRA 3H2AA 2FZNA 3T0CA 2GDUA 2WZHA 3JXVA 3OZPA 1E9LA 1Q1CA 3VOFA 2VQTA 3NQDA 1WXYA 3NVTA 3NDOA 1V0KA 1ZHAA 4HPXA 2PTXA 2WQPA 1QOQA 1J5SA 4UC5A 3SN0A 4RV3A 4KFOA 5LIUX 3VGEA 1UKSA 4D8ZA 2PV1A 1T0OA 1Q6QA 2QJIA 2WHMA 2OX4A 1EP3A 4S3DA 1IR1A 2XJ7A 3O5PA 4BKNA 3F5LA 4C6OA 3HFYA 3KACA 4JX5A 4Z1YA 2FIQA 4GUFA 3O5GA 1X7IA 3LPOA 4AD0A 1A50A 3N9RA 5A1AA 1KRAC 3TNOA 3CYVA 1H11A 3UWEA 1V6UA 4C5YA 2NX3A 1MUCA 2PP3A 5EBAA 3ZOAA 1GQNA 3ZMRA 5HKGA 2PCQA 1TUXA 3II1A 5KMYA 5IM51 3UY7A 3WNOA 5IBXC 1XLEA 4IPJA 4KWSA 4RXFA 4QFUA 2OU4A 3O05A 1JPHA 2CFFA 4J7RA 4O0QA 3W7KA 4Q7IA 4R5EA 3OIHA 1PX4A 5FEZA 3VA8A 1ODUA 2ZDRA 2E9LA 4UZSA 5C2XA 2R1KA 3MY9A 3ARTA 2TMDA 1CLXA 4IGNA 4K3ZA 1LBMA 1ZUAX 2G41A 1DXFA 3GIPA 1H62A 2D73A 4AH7A 1GOIA 3CXOA 2GFTA 4CCEA 3RU8X 4C1NB 1NQKA 2I9EA 3M7WA 1AJZA 4JDYA 4IIBA 3QBUA 1UP2A 2GQAA 1UCWA 4FA3A 4LJ3A 1GJWA 1E1EA 3MUZ1 4EAYA 4Y8FA 4E3VA 4LH8A 3O15A 4FR1A 2BV9A 3LQGA 4PR4A 3DERA 5FKYA 4U28A 1N1AA 4HU0A 4NSBA 1WX0A 4KCWA 4DIAA 2WMKA 1DWJM 4MAVA 1EDGA 2DZWA 4OBRA 4E4PA 1OSEA 4GI9A 5LGZA 4BF8A 4BI6A 1DEDA 3WCZA 1V4YA 2PPOA 2V38A 2PU1A 1EPXA 1RCXB 1WYIA 3TIMA 1BSLA 4ZGYA 1OFOA 3N6QA 3G1AA 4LNCA 2YW3A 4L9YA 4PZVA 2TAAA 5GJPA 2GVJA 2ZE3A 1YYAA 3G1SA 1OG6A 3BJFA 2A7PA 4YVPA 1C9HA 2P1FA 2Z1XA 3GTFA 4GC4A 1KCKA 3PTQA 4L1XA 5HULA 4MYAA 1E6PA 2BGNE 2EG8A 3W87A 4E4FA 4UTLA 4JX4A 1FXQA 2F2KA 3GLCA 4QS6A 5CC7A 3MKKA 4NZ5A 4O1CA 3VNYA 3MUCA 5DXYA 4I90A 3CUFA 1U1UA 2Q02A 2XP5A 5IHRA 1KM3A 2DW7A 2WKJA 4FXSA 3W1UA 2SFPA 3UCQA 1JD9A 1P0EA 2B7PA 4NAFB 2UBPC 3VC5A 4H3DA 5A2BA 2V5JA 4AMAA 1REQB 3V75A 3B7XA 1JXKA 3CZKA 3M5YA 3IUIA 1FFQA 3THCA 1R5YA 2WVUA 1KO0A 3ITCA 1R8LA 3APYA 3P62A 1Z89A 4W7UA 1ZRQA 2J8FA 1J6PA 1FKKA 3QW4B 1JGIA 4DYKA 1KGWA 2Y8UA 4P2VA 3EIPA 1UR9A 2E09A 3DEQA 1TUFA 2WVVA 2BDQA 3VYLA 4LBRA 1BWVA 1FCQA 2VGFA 4S23A 1JPDX 1KCXA 4O10A 1QO5A 2WVTA 5A2AA 1UD2A 1KKOA 2ADAA 1JR1A 4WOQA 3IIOA 1E43A 1K9TA 3UWVA 1ONRA 4DVOA 1GYLA 3NO5A 3F4WA 2W27A 3G5EA 4XD5A 3TXVA 5DIUA 3U2OA 1EC8A 1W8SA 1GQLA 1UQYA 3G8RA 2CLMA 3LSCA 4ZFCA 2BGQA 1K9EA 1VS1A 1JI1A 3OVGA 4OV9A 3TMLA 4AQLA 1JCTA 1ENUA 4LY4A 2CLPA 3GC4A 5HPOA 5EB8A 1GEQA 3TEVA 3QM3A 2R1LA 3I4KA 1UD4A 4YVXA 3LN3A 1QTWA 1LUCA 3NYZA 2G5WA 3PWGA 3S9YA 3LZ5A 4D2JA 4XD4A 3WD3A 1I2QA 2RUSA 5A8PA 4Q4PA 4IMCA 4YYFA 3HPAA 4MWAB 3F4CA 2PDHA 8XIAA 2TODA 1XQLA 2E4TA 3RYSA 2Z1KA 1GKPA 2E6AA 1S2TA 2YGYA 1RXOB 3GTIA 3FVMA 3N25A 2WMFA 4JTFA 3I68A 3VE9A 2PDYA 1DL3A 2ZRWA 1AD1A 4JD4A 4I6KA 4U31A 1LBLA 3DG6A 3VUPA 4EIVA 5FACA 3DHPA 5DF0A 3TN4A 4GABA 3KL0A 4XVEA 3USBA 3GM8A 3SUVA 4D1JA 4H4IA 4DWSA 2WMJA 5H2ZA 1NWSA 4XAZA 3UR7A 3INPA 1ELSA 4GIEA 1X1NA 4PBEA 1F40A 3TN3A 4BR1A 2O0TA 4KR0B 1YE6A 5DRCA 3WLMA 3IK2A 2PWDA 6REQB 3AAMA 3RUBL 5HQMA 4UR8A 1KTCA 1HKWA