4S3KA

Crystal structure of the bacillus megaterium qm b1551 spore cortex-lytic enzyme slel
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
433
structure length
429
Chain Sequence
GGFAQIYTVKAGDSIYSIAKQFRIDAGKIIRANELPNPNQLVIGQSMVIPINGTYYTVKAGDTIWKVGRKLGVSYQAIANANNVSVTAPLTPGRRILIPPSPNKRNGEFLGYVETSNRKITPQTEKMINQNAKYLTYLGPANFEVQKDGSLKAPPLNNLGSIAKENDVIFLMVLANIENGAFSDEVGRAILNNKDVQDTLLNNIVKTAKEQNFRDIHFDFEFLRPADKEAYIAFLQKAKKRLQDEQLLMSVALAPKTSRDQKGKWYEAHDYKAIGEIANFVVPMTYEGGPPMAVSPIGPVRDVLEYAVSEIPSSKIIMGQNLYGYDWTLPYKPGGEYAKAISPQRAIELAARYKVAIQYDNKAQAPFFRYKDEQQRTHEVWFEDARSIQAKFDLIKELKLRGMAYWKLGLDFPQNWLLIEDNFKITKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore germination protein YaaH
publication title Structural and functional analysis of SleL, a peptidoglycan lysin involved in germination of Bacillus spores.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Hydrolase
total genus 142
structure length 429
sequence length 433
ec nomenclature ec 3.2.1.-:
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF01476 LysM LysM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4s3kA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4s3kA02
2XYLA 4A3YA 1TG7A 3NSXA 5DT7A 3SUTA 1JD9A 5CPQA 1UYQA 1SMAA 1TUXA 2VCBA 4CN6A 1V6WA 1NP0A 5CLTA 1HXJA 3WDIA 3CUGA 3FNDA 1HVQA 2IUZA 1UD3A 1HKMA 4GZJA 1I1XA 2WMFA 3BAKA 2XVLA 2XVKA 1JI1A 2DT3A 3AHXA 5F7UA 1GVYA 1OCQA 2C8NA 2FGZA 5FD0A 3NDZA 3W29A 3ZO9A 1XHGA 3PZOA 5CPTA 5E9AA 1MXDA 4H2CA 1WCGA 1JZ2A 1JYWA 1V02E 1W1PA 1V3JA 3O6AA 4FLRA 1WO2A 2EPKX 3AS3A 4UFLA 1VF8A 3IJ7A 1JFXA 3RPMA 1WKYA 4LX4A 2YLLA 2WYSA 1E1EA 5CJ5A 5D9OA 3DECA 4DUVA 4OIFA 4W87A 5A8OA 5C8BB 1OGSA 2WKLA 2O9OA 4V28A 1XSKA 1GOIA 1BYBA 1UD4A 3PZTA 2CKRA 2VO5A 2J79A 2ZX9A 1UWTA 3AS2A 1R7AA 1UHVA 2OWXA 1SR0A 2WVTA 4ML4A 1KCKA 2CIPA 3KWXA 1UG6A 3B9EA 3BAYA 3WNPA 2DSUA 5A6KA 2WMIB 2A3BA 1GJWA 2WMJA 4XZBA 3POHA 3O2LA 4FK9A 5EBAA 1TZ7A 1BG4A 4AY1A 4PCSA 1JZ8A 2BVDA 2WSPA 1NARA 5E0CA 2D0GA 2DT0A 2VCCA 3EMZA 1RD6A 3T09A 3L2MA 1LF1A 1GUVA 2FHBA 4EAMA 1M7XA 1BPLB 3FXYA 3WNLA 3BLKA 4AISA 2FH8A 2DT1A 4PN2A 1W9XA 4V2XA 3F5JA 2GJRA 4PMOA 4LGXA 4D6FA 3HJEA 3TTYA 2W66A 4DWSB 4J3SA 5ECUA 4ZFMA 3VX0A 2BS9A 1E6PA 1LL7A 1W1TA 4PSRA 2J7DA 3WENA 5D4YA 5I2UA 4PTXA 1E70M 3CPUA 1HJXA 3QOMA 4EANA 3VM7A 4CN1A 1UH3A 4HMDA 1VJSA 1KWKA 1OD0A 1BYAA 4JCLA 4OKDA 4XUYA 2JEPA 4P7NA 4Z2IA 1QW9A 4PMNA 3ZR6A 3WD4A 1UR9A 5JBFA 3WF3A 1NH6A 2VZVA 4AIOA 2UY2A 3KL3A 1TFVA 3BMVA 1VIWA 1E5JA 1UR4A 1HL8A 1NWRA 1HKKA 1CXEA 4MTVA 1MVYA 3UCQA 1NOWA 2XSAA 3O9NA 2BY0A 4CU6A 2FHFA 5AC5A 2WZIA 1R87A 4QDMA 1UQYA 1FH8A 5JIWA 2ZUNA 3UG3A 2UWFA 5D8ZA 4D6JA 1VBRA 2WLZA 2WXDM 2XFRA 1XV8A 1XC6A 1GJUA 4HMEA 1E3XA 2GJXB 2IXUA 1UKPA 3EDDA 3AMDA 3AMCA 1V6XA 3SUSA 3BXWA 3WQVA 3GXFA 1XYFA 2VC9A 3VOCA 3VD7A 4M29A 1JFHA 4PEEA 4QP0A 5BRPA 2XHYA 2NSXA 1E6ZA 1V6VA 3ARZA 2E9BA 1R85A 2BNJA 4P8UA 4M24A 3DYOA 3NIYA 1WZAA 2BXZA 2QLYA 4M8UA 3VVGA 2WMHA 1DWHM 2WC3A 1TVPA 3WNOA 1TR1A 3N15A 3CZJA 3MSGA 4OUEA 4W93A 2ZUSA 3CHDA 4JKMA 3AMGA 4F9DA 5A8QA 4U2ZA 3FAXA 3WDRA 1EOMA 4AZHA 5AYBA 4HZ7A 2A3CA 4AYSA 5CXPA 2WW5A 3GNRA 2F61A 3OLGA 2C0HA 1CZ1A 4KGLA 1KQYA 3BAXA 1JNEA 1TA3A 3AIRA 3PBGA 5CLWA 2WPGA 5HOSA 3DHUA 1CWYA 4OOUA 4PSPA 1UD2A 1QHPA 3AOFA 4W5ZA 1QI0A 1H3GA 1KXQA 1WZMA 3WH7A 3FW6A 1VFUA 2WCSA 3UERA 1E5NA 3I3BA 4RL3A 1BGGA 2VMFA 3W28A 2XIIA 2BY1A 1K6AA 1E6XM 1E4NA 3BCFA 3VGFA 1BVZA 1J0HA 4D71A 2QPUA 3CLWA 4N42A 4P7QA 3WL1A 4HTYA 3E1F1 1OGGA 2XM2A 5E6ZA 3AISA 3QHMA 4GINA 1BG9A 1CECA 2F2HA 2DIEA 5CSUA 1NWTA 3WH5A 2Y8KA 4UFJA 1JAKA 1V3KA 2OSXA 1MWOA 3WF4A 1ZS2A 1X6NA 3GBDA 1JZ7A 2YDQA 2X0HA 3SEPA 5D8WA 3L4TA 2J75A 1FH7A 3NJ3A 2CXGA 4D6DA 4F9JA 3AZSA 1VEMA 1KWGA 1Q4NX 1XGZA 1WNOA 3WNMA 1E6SM 1C8XA 2J7EA 1CPUA 1QPKA 2WB5A 3S6TA 4JCMA 1CBGA 4QCFA 1BQCA 1V08A 1QBAA 2DSVA 1PBGA 3WELA 1JZ6A 2X0YA 3CUFA 1B2YA 1XH0A 2CESA 5I0DA 3SCPA 2ZXDA 1PIGA 1VBUA 4CCDA 1KCLA 3T0AA 2WHMA 1UKTA 3WQ8A 2EEXA 4CVUA 4H8UA 3L2LA 2PBOA 3OG2A 1MW1A 4HA4A 4M80A 4H8HA 1GOOA 1BYCA 2PWGA 4BQ5A 1US3A 2WMKA 3AZRA 2JIEA 1BLIA 4KRUA 4UOZA 3ZJ6A 6TAAA 1KGXA 4MJ2A 1GZJA 4YHEA 4PBGA 4KRTA 3S2CA 1EXPA 3ZT6A 2VR5A 4AEEA 4N0RA 3VIHA 1VENA 3WUGA 3MMDA 4NRRA 4BS0A 1UA3A 1C93A 1C8QA 2V5DA 2W61A 1QOXA 2G41A 1CEOA 1DWGM 1V0KA 1W3LA 4UFHA 1LL6A 1B31A 2YBUA 4B16A 1DWAM 1CGXA 1QBBA 1H41A 2WVUA 4GQQA 5D9PA 2E9MA 2Y24A 2J62A 5A6SA 2J77A 4W7WA 1TVNA 3ZJ8A 3PN8A 1JDDA 5BRQA 4R5EA 4R27A 4DWSC 1ITXA 4C7DA 1M03A 4M82A 1ISWA 3EDEA 1B30A 4TX8A 1H5VA 4Y7EA 4AD2A 1EQCA 5CG0A 1VFOA 5ABGA 2UY4A 5GPRA 3AIQA 2PI6A 2GUYA 2G8ZA 4JL2A 2WHLA 4JIEA 3UEQA 5A6AA 1ZBCA 1V3IA 5IFPA 3TOPA 1Y7VA 4AXNA 3GYCA 3AS0A 1E4MM 1DTUA 4WLCA 5ABFA 2XWDA 5I79A 5I23A 4DUWA 2XVNA 3VDAA 4PMVA 1NQ6A 3QHOA 2ZX6A 5JBEA 4CU8A 3WBAA 5D9NA 1JDCA 3GZAA 3HU7A 4GZEA 2GK1A 4PYSA 5FOOA 1MQRA 4M56A 1B3WA 1H2JA 4UQCA 1K9FA 4CD5A 3U57A 2YKKA 3OLDA 3A6OA 1QHZA 4PRWA 2WVSA 4BF7A 1NP2A 4NRSA 5BXTA 3WUBA 4AIUA 4E4PA 2ZX8A 4U3AA 4C7FA 3MUY1 3ZJ7A 2G4FA 4MB4A 2DEPA 3LPPA 3G6MA 1XSJA 3EMCA 3GBEA 1SFSA 3OLIA 4MDPA 4W8LA 3VTRA 1HP5A 5CZKA 4RE2A 3WF1A 3GDBA 3VMNA 2YL8A 3PZNA 4NI3A 1E4IA 1E71M 3WEZA 3AHYA 1I1WA 1XCWA 2ZWYA 4NF7A 1V3LA 7CGTA 1AQMA 2X05A 1RH9A 5A2AA 3MV01 2OWWA 2HVMA 2CBVA 3VIMA 1CDGA 1L8NA 3QHNA 4CVWA 1C8YA 1VB9A 1XD0A 1BF2A 3CZGA 4QLJA 4X9YA 4TVCA 5KEZA 2CHNA 2Z1SA 1AVAA 1LQ0A 2Y5EA 2W67A 1JG9A 3BSGA 1QI2A 5DEZA 3AHTA 2XSBA 4UZUA 4M81A 4MB1A 1GONA 5CPSA 2NT1A 3FHQA 1UKQA 4UTFA 3ZQ9A 1H0GA 1KBKA 4BA0A 2XG9A 1PPIA 3WH8A 1CNVA 3L4YA 3L4WA 3BAIA 1XD1A 1UZ1A 3OGSA 2WZEA 5FL1A 2VVNA 4Q7NA 1GQLA 1M53A 4L4OA 7A3HA 5BXRA 1QHOA 1KR1A 1XCXA 2FH6A 1QW8A 3HMCA 1GOWA 1HVXA 1KR0A 1GPFA 2W91A 3VD5A 3RCNA 5DF0A 4MDOA 1KGUA 2CERA 1E43A 3TA9A 2Z1KA 4CKQA 3NUKA 3SCWA 1VRXA 4W7VA 1J0JA 2WBKA 3AIUA 3W53A 4AWEA 5E0FA 3VM5A 2CPUA 2WBGA 4JKKA 3EBVA 3M46A 3ZJKA 1OB0A 3RDKA 1DWJM 1CGWA 2VRJA 1BFNA 3IK2A 3RM8A 3AMLA 2OWCA 1ISXA 3N11A 2W4XA 2WM0A 5EMYA 3BAWA 2HISA 3GXDA 5BROA 1E6NA 1FOBA 1UD8A 2GFTA 3PZVA 4LPCA 3RMEA 5A8NA 4AD3A 2D20A 5DFAA 4HP5A 2B31A 2DSZA 4PMUA 2QMJA 2CETA 4JAWA 2D1ZA 4V27A 3SUWA 5AC4A 4B9ZA 1OD8A 4W8AA 1NOUA 1G0CA 3WMCA 3ARTA 3N9KA 1UR8A 5A94A 4UQAA 4S3JA 3W0KA 1CGVA 3AYRA 1UWUA 3F5LA 1Q6DA 1ZBVA 4J3XA 2CYGA 1JYVA 4UFKA 4M1RA 3T0DA 1OT1A 1WPCA 2BV9A 4AIEA 4X0NA 2XVGA 4HA3A 2WVVB 3NSNA 1RPKA 2BHYA 4D6GA 5LA2A 1CXFA 3TP4A 3VO0A 1JYNA 1ODZA 3KL0A 3CBWA 1J18A 4UNIA 2E4TA 5A8PA 1UWSA 3EMQA 1GQIA 4QFUA 2OYLA 2AMGA 3N13A 2EQDA 1W3JA 1PX8A 2CITA 2VI0A 4D6HA 3BMWA 5I5RA 4JZ5A 3DC0A 4FLQA 4Z2GA 3W27A 3VINA 3AROA 3WD2A 4UOJA 1J11A 2JFEX 1JF6A 1DWFM 3AFBA 1J01A 4OOZA 4PTVA 3QOKA 1DWIM 3JUGA 3AXXA 1TA3B 3LMYA 1UKSA 1D7FA 3AIBA 4CUCA 3WQWA 1ECEA 3VNYA 3T0BA 1GOMA 2GSJA 3SCQA 1CLXA 3IAQA 3AI0A 4TX6A 3CH9A 3CMGA 3F4VA 2J78A 3OLEA 1HJQA 1E15A 1V0LA 3IJ9A 5LYRA 3WD0A 3WDQA 5I78A 4D72A 3CZKA 4CU7A 5M17A 2WNWA 4HPGA 1G5AA 5E70A 4L4PA 4WSJA 1R7OA 1XYZA 4CD8A 1C90A 3W6LA 3MKKA 1O7AA 3VD9A 1H0IA 4MADA 1LG1A 4GXPA 4MAZA 4E8CA 3AZTA 4TXEA 4KGJA 3AHZA 4PCTA 1AMYA 3ARPA 5GNYA 3AS1A 2WHKA 1JYXA 3ZSSA 3F5KA 3CHFA 3VIKA 3THDA 5M03A 2ZUUA 3VGGA 2WZHA 4PTMA 2DH2A 1V6UA 2CEQA 3NYDA 3WMBA 1HIZA 3GM8A 3DYMA 3AQUA 4LYRA 2VZUA 3AXIA 3OBAA 1W9PA 3T2PA 1QVBA 3U7VA 2PWHA 3W6MA 2V3EA 1E0WA 4MB5A 1UA7A 3KZSA 4W8BA 1UR2A 1OSEA 1C7SA 3VGEA 1HP4A 3UR8A 1FHLA 4J27A 4PMRA 4LYQA 1BSIA 5IFTA 1W1YA 2YA2A 1OIFA 2OLHA 1CYGA 1IT0A 4IISA 1Q6EA 2UY5A 3GTNA 3RO8A 5DO8A 3ALFA 3PZ9A 2RGMA 3CZEA 3ZM8A 2X09A 3ZIZA 4W84A 2PWDA 3RIKA 5HNNA 1UKOA 3ZR5A 1DP0A 1V0MA 3PZUA 4H04A 1OINA 3TTSA 3K8KA 4ZXLA 3VILA 4TVUA 4JL1A 3CZ8A 5AYIA 1Z32X 2O9PA 3ZT7A 4WKFA 4ATDA 3MS8A 4TOQA 3T2QA 4P8XA 1HJVA 4UQBA 3ZMRA 1IZJA 1LWJA 4XZWA 1G9HA 4PTWA 3SCVA 1M01A 3VMPA 3RJYA 1EOKA 4NZCA 5A6JA 2CCRA 2J7GA 5I77A 3GH5A 4NSBA 4FLOA 4AD5A 4GO8A 5EB8A 3ZOAA 2VNCA 3MV11 1J0IA 1M04A 2D3NA 1FP8A 1B3XA 2GJXA 3L4UA 3IANA 5IXEA 4P8VA 4U33A 1HJUA 4AZIA 4QCEA 2OYMA 1JZ4A 2YDSA 2OYKA 3W4RA 3UG4A 2XUCA 4PMDA 4D1JA 4UZSA 2IXVA 3A4WA 5A6LA 1UD6A 4MNJA 4J28A 2E0PA 2ZWZA 3W26A 3W82A 1W9UA 1GOKA 2PF0A 3CO4A 1OWQA 1GNXA 1ZL1A 3OB8A 1GQKA 3A4XA 3BCDA 1W3HA 3WY1A 1BYDA 2CBJA 4FMVA 5DMYA 2XTKA 2EJ1A 2YL6A 5D9MA 3KEHA 4ACZA 5ABFB 3MUZ1 3WSUA 1PJ9A 2VX6A 1KB3A 2DPEA 2BHZA 5I24A 2O9RA 1E6QM 1A3HA 2DH3A 4HU0A 2GK1B 3MU7A 1FHDA 2VQTA 1FA2A 1BVNP 4CD4A 3WQ6A 2UY3A 5IDIA 3A47A 4U5IA 1J12A 2X2YA 4CN4A 2D2OA 3K1DA 4EE9A 1JXJA 3AHVA 1TCMA 1JIBA 2VX7A 1P6WA 3AIWA 3EDKA 3VDBA 3WKZA 2X1IA 1WE5A 1HKJA 5JIPA 3N17A 2V3DA 2D0FA 3B8SA 4JFTA 4AMCA 3UG5A 1VEOA 3WH9A 4AW7A 2VX5A 4Z2JA 3AYSA 4WK9A 3QR3A 5A69A 3MANA 5EFFA 1UH2A 1MYRA 3VMOA 4MNKA 1UOKA 3WNKA 3DHPA 4OBRA 5FL0A 1V03A 1AQ0A 4A3HA 3WL0A 3GNPA 2WLYA 1RP9A 2BXYA 3CUIA 5KZ6A 3WEOA 3NCOA 3N18A 3M07A 1BGAA 1VFMA 3VNZA 3L4ZA 3AJ7A 1JD7A 2XIBA 2C7FA 1EHNA 4P7LA 3WQ5A 5A6BA 2V3FA 2NW0A 1WZKA 5IHRA 2YJQA 1E55A 4E2OA 1QI4A 3TTQA 1HF6A 4AZCA 1UWQA 2E8YA 2G3IA 4CGTA 1E72M 1UUQA 1UWIA 3THCA 2AOSA 4D6IA 4WKHA 1GVIA 1BHGA 4WIWA 1E0VA 3I3DA 3VDCA 5CGMA 1GCYA 3ALGA 4X0VA 1GQJA 5E6YA 1K9TA 3SUUA 3SURA 2NT0A 4PMYA 2OSYA 1B9ZA 3CUHA 6CGTA 1B3VA 3W24A 2YIHA 1B3YA 1JL8A 1SYTA 4J3VA 2ZICA 5A6BD 1X1NA 1VEPA 1CXLA 3AIEA 1CENA 2J7CA 5CGTA 4WKAA 4F79A 2QHAA 3WFZA 1HX0A 1IV8A 1HKIA 3A4AA 3U7BA 4B9YA 2VZTA 1DHKA 1H1NA 4MB3A 3MMUA 1H49A 4GO9A 4ATWA 2XWEA 2O92A 2FDMA 3IJ8A 4FF5A 1VAHA 3BH4A 5EFDA 4P7RA 2VX4A 2WC4A 2PBGA 2A3EA 2G3NA 2XFYA 1BAGA 4W88A 1B90A 3PTQA 2PWEA 1CGTA 4YPJA 4MPKA 2YA0A 1JI2A 4BZYA 2PB1A 4PMZA 1Q6GA 4AD4A 4HOWA 1W9BM 1L0PA 3SCSA 3L4XA 1B0IA 1U33A 4ZEPA 1ISVA 1VFFA 3U5YA 3PTMA 5JUVA 2GDUA 1GHSA 3RM9A 4AZ5A 3A3HA 2E8ZA 3AMKA 3CGTA 1B1YA 1ZJBA 4AZ7A 4CD7A 3UETA 4PMQA 3VIIA 1C91A 1HL9A 3CTTA 3FHAA 4F66A 3K4DA 1WDSA 2J74A 4U5KA 4DM1A 1Q6CA 2ZUVA 3DYPA 4TTGA 1PEZA 2WAGA 2F8QA 1DEDA 1E4LA 1QNPA 3HN3A 4Z2HA 2E3ZA 3VGBA 3N04A 3W37A 3WD1A 1JZ3A 2W62A 3FAWA 2EXOA 4W86A 3VGDA 3MMWA 4BQ2A 3VX1A 2VT0A 1ESWA 4AD1A 1QI3A 3PTKA 1FP9A 1EH9A 4ACYA 3ARWA 2VURA 2XGIA 3T2OA 4AD0A 4HPHA 1KQZA 4OBSA 4YHGA 2YL5A 1TE1A 5BWFA 1WP6A 1EA9C 4W89A 1MQPA 3K46A 3RILA 4E8DA 2VL4A 3LPOA 2VZOA 3ARUA 4HU8A 2TAAA 3WQ4A 4BQ3A 5A95A 4DM2A 4UFMA 1J0KA 3WDPP 1G1YA 1V0NA 1ISZA 3OGRA 4J3WA 4UFIA 6A3HA 1FFRA 2CNCA 1EDGA 5I3DA 2BHUA 1QNQA 2X8RA 2JIWA 1KXTA 4KH2A 1S46A 4Q22A 1G01A 4MNLA 1H11A 2EPNA 3WMSA 4B15A 4WF7A 1OBAA 4JFSA 2BFGA 2VOTA 3ECQA 2ZOXA 1ITCA 2OSWA 1HT6A 1R86A 4IM4A 1X6LA 2WCGA 2DQXA 1WDQA 3G6LA 1GW1A 5HDRA 3GXMA 4KMQA 4WSKA 1H09A 1V3MA 3WBEA 2ZUMA 4UQEA 1LJYA 2O9TA 4HZ8A 2E9LA 2ZXAA 4LXFA 2J4GA 2XM1A 2BVTA 2YDRA 3PHAA 3TONA 3LPFA 1CTNA 3OGVA 4JKLA 1E40A 4GPNA 3SCRA 1JF5A 4D6CA 1SMDA 1EDQA 4CCCA 2PWFA 1G94A 4J3UA 2DGAA 3I3EA 2WC7A 1KFWA 4U31A 3B9DA 4HOXA 1NM9A 4CD6A 2Q8XA 2YOCA 5IHSA 3U5UA 1F4HA 1GHRA 1OIMA 4UQDA 2XPKA 1J10A 4LQ1A 3ARXA 2BVYA 2J7BA 1GOQA 1EGZA 3RM4A 3W25A 2JALA 4IPLA 3CIVA 2J47A 5E09A 1H4PA 2PC8A 3VUPA 4TUFA 8CGTA 4HZ6A 1W3KA 4RE4A 3VIFA 1YHTA 2JF6A 1I75A 2WMIA 2EPMX 2VVSA 2EO7A 3ZSTA 1ZU8A 2GJPA 3MO4A 1C92A 2VR4A 4P7OA 1JXKA 2CKSA 2BY2A 3WN6A 1OT2A 5GNXA 1NOFA 3VDHA 3VIPA 5BXSA 2W5FA 1ISYA 1JAEA 5ABHA 5DT5A 2D0HA 3ARQA 3ARYA 3BAJA 1JDAA 2D3LA 7TAAA 2DSWA 1MQQA 2YLAA 3BGAA 5M5DA 1W2PA 5JBDA 4CCEA 4JFUA 1E0XA 1D3CA 3PZGA 4XV0A 2ZXQA 4URIA 1W9DM 2WANA 1HJWA 1V6YA 3APGA 4GKLA 4DWSA 4HA1A 3SCNA 1D2KA 2MANA 2VUYA 3BLPX 4LYPA 2EPLX 1GORA 2WVVA 4GI8A 2WWCA 4DUXA 5A2BA 2VCAA 3D5HA 1E3ZA 4IPNB 1TMQA 1PX3A 2DT2A 2W92A 1MW3A 4ACZB 3OIHA 3ARRA 2VRQA 1Q6FA 2ZIDA 1ZBWA 3VD4A 2VRKA 4ZXOA 2XVPA 2XFFA 3MUAA 4ZENA 4B3LA 3WD3A 2D24A 3L4VA 3WH6A 4QLKA 2E40A 3BC9A 5FKYA 1PZ3A 3WNNA 1ZJAA 4EKJA 5HXMA 2Y2WA 2WK2A 1W91A 2DDXA 1XSIA 1C7TA 1UR0A 2VZSA 2WSKA 3W38A 1HNYA 3VD3A 5JH8A 3GH7A 3UESA 4S3KA 4DWSD 5HBFA 1XH1A 3OZOA 3PZIA 1AQHA 4IUGA 2GDVA 1RP8A 5M3WA 2XGBA 3EDJA 3K8LA 1E1FA 1HJSA 1ODUA 1PZ2A 1CIUA 3SCOA 3K4AA 1B3ZA 4B3KA 4FLSA 1UH4A 1EIBA 1BTCA 3EYPA 4Z2KA 1WB0A 4PUEA 2WCAA 2JF7A 4RE3A 3GXIA 1V3HA 2CBUA 3KL5A 1EO5A 4YN5A 1F4AA 1KBBA 1J0ZA 5AY7A 3PZMA 5CQ1A 1IZKA 4WJXA 2CBIA 2CHOA 5BCAA 3MSDA 1LWHA 2G3MA 3VU2A 4ATLA 5FIPA 2YL9A 4H8VA 1N82A 1E56A 3WUEA 1FH9A 4AEFA 4C7GA 2WWDA 1MFUA 1KXHA 2D22A 3KE0A 3M6DA 1JNDA 3BSHA 3ARSA 2BY3A 4OJYA 4U2YA 2ESCA 3OZPA 1ZBKA 1MW0A 4AZCB 1PIFA 3CHEA 2QMKA 2V3GA 3B9AA 1US2A 3MUIA 1U2YA 2W63A 1PAMA 4QAWA 2A3HA 1CXIA 2ZX7A 2J25A 4UQ9A 4BQ4A 1WAWA 3EDFA 2V5CA 1QI5A 1QNSA 1UZ4A 2FGLA 4GI6A 3VIGA 9CGTA 2Y8VA 4U3CA 4H41A 2XJ7A 4GZIA 5A2CA 3AICA 1E6RA 3VKKA 2ZX5A 1C3FA 3WEMA 3T08A 5HPCA 2A3AA 5GNZA 2WKGA 3GH4A 3LPGA 3M7SA 2WMGA 1EDTA 3FN9A 5A1AA 1CGUA 4D1IA 1OM0A 5I6SA 1NWUA 3WIJA 2AAAA 3CZLA 3D3AA 1EHAA 5GQBA 1CXHA 2FHCA 4HOZA 3IAPA 2QV4A 4H7VA 4TVDA 4W85A 3W81A 2QF8A 1XH2A 4K68A 2JEQA 1CGYA 2VQUA 4UOQA 1QNOA 1W2VA 3II1A 3NSMA 5FCZA 2DIJA 5C71A 3PZQA 2GVYA 4D6EA 5A6MA 4P8WA 2ZXBA 4W7UA 3VGHA 1O6IA 1U30A 5TD4A 1LLOA 4Z2LA 1MFVA 1WDPA 3RJXA 2J7HA 4J3TA 1XRVA 3OA5A 1WZLA 8A3HA 4HMCA 5LA0A 4PUDA 2J7FA 2WHJA 1LG2A 1J0YA 1K9DA 3POCA 1LL4A 4AZGA 4EK7A 5C70A 1YQ2A 4QLLA 1A47A 1CXKA 1VJZA 4KWUA 1OGBA 1FFQA 2VJXA 1E73M 1J9YA 2RGLA 1UQZA 4XX6A 4BCEA 4ZE4A 2JE8A 3CUJA 1WDRA 2ZE0A 4GI9A 2Y4SA 5ABEA 4JFVA 3N1AA 4OZOA 1W9VA 5LA1A 1W1VA 3WUFA 2YBTA 1KXVA 4XB3A 3WF2A 3CMJA 3K8MA 4JHZA 4GIAA 4J7RA 1MXGA 4UCFA 1JZ5A 2EPOA 4PMXA 3ZT5A 1E9LA 4TTUA 4ZE5A 3SCUA 1UWRA 1EO7A 4W5UA 1UR1A 3AIVA 3ARVA 2YA1A 3TTOA 2ZUTA 4AZBA 2DSKA 3FY1A 2V38A 4UR9A 2D23A 1JGIA 3N12A 2EBNA 3SCTA 5A8MA 3WFLA 1ZB5A 3QGVA 4F8XA 2J8FA 1HN1A 3VIOA 5A3HA 4MJ4A 4MNMA 5CSYA 4AC1X 4A4AA 5BXPA 2G3JA 4AZ6A 3VIJA 3AXHA 3SIMA 2ZUWA 4JFWA 3GNOA 1PX4A 3CHCA 1KGWA 3VPLA 3WDJA 2VTFA 3J7HA 1UD5A 3UR7A 4MAVA 3WDHA 1MW2A 5BYWA 4GQRA 5HPOA 2J8GA 1EQPA 1CLVA 1QNRA 1R8LA 2QPSA 4JHOA 3SUVA 1K9EA 1V02A 1W32A 3NDYA 1NWSA 3WF0A
chains in the Genus database with same CATH superfamily
4IGNA 4LC8A 1TG7A 4FXJA 5DT7A 3TQ0A 3CQIA 4FS9A 1WKFA 3BSMA 4CN6A 3E2QA 1NP0A 3NURA 2JZVA 4LAKA 1XGEA 3M4HA 1UD3A 4N9CA 4ZMGA 3U2EA 2PLJA 4LV9A 1EQ3A 1JRCA 4JTGA 1K4HA 1FDZA 3BG9A 5D75A 2PGWA 5F7UA 1OCQA 2VFIA 4HHMA 3MSRA 2FGZA 5FD0A 3W1NA 3NDZA 3W29A 1KRCC 1NMVA 2GL5A 2L2SA 2BBFA 1FKXA 3UXKA 1W54A 4H2CA 2WZTA 1ZENA 1JZ2A 5I06A 3CGMA 1KV8A 1JYWA 1V3JA 1LTDA 1JVWA 4FLRA 1B4EA 1WO2A 3WK0A 4UFLA 4UDMA 4FHAA 5DBTA 5I3IA 1KBLA 3E0VA 4DY1A 1HTIA 1CI1A 2YSWA 4LALA 4LX4A 2WYSA 1E1EA 5D9OA 1J4HA 4OIFA 2ON3A 5HMDA 1OGSA 2O9OA 2P1FA 4JTQA 3H23A 3TSMA 1XSKA 4MF4A 4JDYA 3PZTA 4Q4RA 5HJYA 2ZX9A 2J79A 2VGGA 1YEYA 4ML4A 3KWXA 4BEQA 3B9EA 1ZUAX 2Q01A 5KZEA 2NV1A 5A6KA 2WSRA 2B7NA 3R5EA 2WMJA 3POHA 4RDYA 3W7GA 3OIXA 2V5JA 5EBAA 1TZ7A 2VWTA 2BVDA 2WSPA 1TPH1 3KW3A 3TROA 3PPCA 5GJPA 3W7MA 2KI3A 4ZPVR 1XYCA 2YCLB 5EKYA 2FHBA 1LOLA 2ZA1A 2FTPA 4C91A 3WNLA 3BLKA 3H22A 1ZP3A 2FH8A 5AYXA 4RJEA 4GH3A 2GJRA 1BWKA 3KS6A 4PMOA 4UTHA 2FDSA 3HJEA 3TTYA 1AZ2A 2IPWA 2RAGA 4ZFMA 3CC1A 3STEA 3VX0A 1OX4B 4PSRA 2WNNA 5D4YA 3TW7A 3NL6A 2JKPA 3CPUA 5CG7A 1L6FA 2OTDA 3QOMA 3LV5A 1UH3A 2Y7DA 5I3KA 1SJDA 4HARA 2JEPA 4P7NA 3CQ0A 3UNDA 3THUA 3F2CA 4BWLA 3ZR6A 3WD4A 3B8UA 2OCZA 4LW7A 4GCAA 3DH7A 4JNMA 4QG6A 4AIOA 1FCBA 4MWAA 1TFVA 3ORWA 3BMVA 2TSYA 3P81A 3B7XA 1V5XA 3B9NA 2AKZA 1NU5A 3UZXA 3DDMA 1J5TA 2XSAA 1S38A 2FMNA 4RNHA 3PC0A 3R12A 4REQB 1AFSA 2FHFA 2NX3A 3UF8A 4D2JA 1DBTA 8TIMA 4QDMA 2C3ZA 2DVXA 3MKVA 3TJXA 4ES4A 5HNUA 4GUGA 5JIWA 2UWFA 3QZEA 5D8ZA 4D6JA 4J4KA 4DAFA 2MLYA 5D2TA 3OOBA 4HVXA 1XC6A 3SM0A 1GJUA 4DZ3A 1UKPA 2ZZ6A 3SUSA 2QQ6A 1H50A 3GXFA 2KGJA 3IGXA 4WX2A 3WJYA 2VC9A 4MFDA 4RXFA 2W0UA 1XJBA 3NI6A 4DYJA 2XZ7A 4QP0A 2XHYA 2HS6A 1V6VA 2PDGA 4P8UA 4M24A 1REQB 3DYOA 3O63A 3V18A 2V2CA 4M8UA 3WNOA 3GVWA 2A3LA 4XBSA 3N15A 2IPJA 2VHLA 3CZJA 1YBQA 2XIJA 4OUEA 3T9PA 2V30A 3L12A 1WXYA 1W5MA 4AVFA 4C1NA 3PUDA 5EA9A 4F9DA 3O05A 1XKYA 4U2ZA 4HPJA 4PH6A 5CZSA 3CV6A 2PU1A 4P61A 3W9ZA 4HZ7A 3RO6A 4IL2A 3L5MA 3CWHA 1AD1A 3REQB 4BI7A 2ODOA 3H4WA 1VKFA 3DKJA 3H4XA 1SW0A 3MWCA 2YFOA 3OLGA 3QTPA 1OK4A 3NWRA 4KGLA 1TA3A 1Z6KA 2WPGA 3DHUA 3SRDA 1CWYA 1QHPA 3AOFA 4W5ZA 2DZUA 2OMAA 1H3GA 1KT1A 2ZDSA 2DZBA 2ZADA 1KXQA 4LUTA 5AECA 1QPNA 4KPLA 4NYYA 1RQHA 1XRTA 4S3GA 3O5KA 1U1HA 3TK7A 3QGKC 3LCLA 1E6XM 2DJLA 2P76A 1N2VA 1BVZA 2YXXA 1J0HA 4MYAA 4D71A 1J6YA 4D8LA 3CLWA 4P7QA 3WL1A 3H24A 3E1F1 3KAHA 3AISA 4ADSA 4GINA 4LANA 2F2HA 5CSUA 1NWTA 4LH8A 2Y8KA 1JAKA 4JQ4A 4G5DA 3NR0A 1T5AA 1OX5A 2PDJA 1DIKA 1SO5A 1RSCA 3BL3A 2ZZ5A 4XTDA 2X16A 3NOEA 2J7EA 1W5QA 3AC0A 1V08A 1ZJIA 2FZDA 4QCFA 4UB9A 4R9XA 1XH0A 2CESA 3NGJA 2WHMA 3CAQA 3WQ8A 3L2LA 1DORA 4E38A 2PWGA 4BQ5A 1US3A 3SQSA 4QG9A 2JIEA 3KVLA 4EPEC 4KRUA 3FJNA 2ZZ3A 4XG1A 1YXDA 3BW3A 1Z69A 4XK2A 6TAAA 2ACRA 4PBGA 2O56A 4IMAA 3NL2A 4KRTA 4MSPA 3S2CA 1EXPA 2VEGA 2VXNA 4POCA 3ZT6A 4R7WA 4AEEA 4N0RA 2BOEX 2Y63A 5FSDC 1RA5A 4AX6A 1CEOA 1GVQA 1W3LA 1Z9AA 4G2DA 1EP1A 2YBUA 4B16A 2RH9A 1VD6A 5CPLA 4Q7IA 1H41A 1KKRA 2WVUA 4NASA 2QCHA 5D9PA 2GGGA 1D7JA 2ETNA 4IH3A 4JY9A 4FSAA 3NZQA 4L56A 5A6SA 3GD6A 4YXGA 2J77A 4JICA 3ZJ8A 3ZWTA 1ZQ5A 2VD8A 4NKCA 3IV3A 5BRQA 4DWSC 1D3HA 1K8XA 1I9CB 3EDEA 4Y7EA 4AD2A 2AMXA 3UWYA 3GXNA 2I5QA 5ABGA 3G1VA 2AL2A 3IHZA 2G96A 4GJJA 2ACSA 3GRIA 1Q6QA 4Y96A 3RPDA 2HXUA 1ZBCA 5FJJA 1EJXC 3NOYA 3NQ6A 4AXNA 1E4MM 2PODA 1DL3A 2ZA2A 4ASTA 4NHVA 2XWDA 2R1LA 3VDAA 1NQ6A 5K9XA 1LYXA 4UXDA 1XQLA 4DHGA 3GZAA 5FOOA 1TPFA 1H2JA 1S2CA 4QT3A 2XN1A 3TLLA 5FF4A 1S3HA 2V2HA 4IGSA 4JHMA 1W6TA 5JH2A 1POKA 1UASA 4A3UA 4CNTA 2IPFA 3KBWA 2I7GA 3W7KA 3G8EA 3W74A 2VEMA 3ZJ7A 4ZQNA 3BGGA 2G4FA 3TYUA 2C6QA 3G6MA 1XSJA 3EOSA 1XFBA 3OLIA 1RUSA 2Z1BA 1HP5A 3CV1A 1MNSA 4YS1A 1UW9A 3PZNA 1E4IA 1E71M 3N2XA 3WEZA 2X05A 1RH9A 2QCFA 1H1ZA 5HR6A 4KWWA 3VIMA 3FJ6A 4QE4A 3I65A 1F74A 1L8NA 3BOFA 1XBXA 5DIVA 3V5CA 4M6PA 3GU0A 1BF2A 4QLJA 5AHIA 4DXXA 4TVCA 5L9FA 4C6QA 3L68A 4E4FA 1Z44A 1EJTC 1JCHB 4YIWA 2FVKA 1Q5MA 2ISSA 4KCUA 4I3GA 4IG2B 3AHTA 3H2NA 1DYSA 3GG1A 2E6YA 2PZ0A 2RDUA 3QMSA 3CPGA 3GUGA 1GONA 5CPSA 4F0SA 3IJQA 4ZB5A 5D37A 3FHQA 4ADTA 1UP3A 5F1UA 1VYRA 1H7NA 2PAJA 1K70A 1MEIA 2F6XA 1CNVA 4ZOBA 3L4WA 3A4JA 3S2MA 1KC7A 1UZ1A 1VFLA 2NQLA 5IDZA 1XL9A 4L4OA 4P2VA 5K2ZA 2XP9A 4FNUA 3NG3A 1X39A 2FH6A 3TCEA 3HMCA 4KRZA 2W91A 4F2UA 3SY1A 3USBA 1A0DA 1ITUA 1JPHA 3C3UA 5DF0A 1E43A 4E0CA 2OQLA 3GC5A 4JN8A 1PINA 1VRXA 3MI6A 4W7VA 4O12A 4IMCA 4FR1A 5E0FA 1TB3A 2XN0A 3PBUA 3RDKA 3QLDA 3V16A 1CGWA 1XKJA 3MQTA 3RM8A 1KCXA 4ITZA 4JFMA 2E67A 2FJKA 2PV1A 5K7JA 5BROA 1JCYA 3C2FA 1FOBA 3PZVA 1A5CA 1FCVA 1N7KA 4LPCA 1DIDA 2C0AA 2WQPA 1XISA 1EEXA 2QDGA 2DSZA 3S2NA 3NZ1A 4W8AA 5HULA 3GNDA 2ACQA 3L7RA 3ARTA 2V9DA 3O6DA 4H19A 1UR8A 5A94A 2OU4A 2ZQVA 3AYRA 1NDYA 2X40A 3AXKA 2ZKMX 1ZBVA 2CYGA 3GNNA 4Q6JA 3T0DA 3AJXA 3CYVA 3OEXA 4X0NA 7REQB 1SZRA 4O18A 4GD0A 3JU2A 1UIOA 1RPKA 1A50A 1CXFA 1R47A 4BFAA 1ODZA 5HJLA 1Q7QA 2WJZA 1J18A 1Q66A 4R0XA 2GSEA 2AMGA 2HCVA 4EVZA 2P3EA 2VI0A 4LCQA 1QAPA 3VA8A 3W75A 4YJ5A 3W27A 1UZHA 4HJFA 3WD2A 5D2WA 3C0LA 4PTVA 2E1DA 3HPXA 3LN3A 3AXXA 5DITA 2WNZA 3MP4A 4R33A 4WUIA 1HQTA 1UKSA 2OX1A 3DKLA 3QR0A 2Q8LA 4CUCA 1QUMA 3N4FA 1FCUA 2NV9A 1GOMA 5REQB 4UMAA 3IJ6A 3UR5A 2HRWA 3CH9A 2QAPA 4J4OA 2VC7A 2B81A 3OLEA 1E15A 3IJ9A 1DJXA 4OHQA 1RQEA 3WDQA 3CZKA 1A53A 1BXCA 4FXRA 9XIMA 4CNOA 4HPGA 1G5AA 5E70A 1R7OA 3W6LA 2GGHA 1M3UA 3VD9A 1H0IA 4MAZA 1OFRA 3AZTA 4HU4A 3AHZA 3LTYA 2ZRXA 2E09A 3UI4A 4O4WA 1W31A 2WHKA 3ZSSA 3F5KA 3CHFA 2Y0FA 2ZUUA 2WZHA 2DH2A 1BRLA 1JCNA 4PRTA 2W27A 1EYMA 1HIZA 3GM8A 3PSWA 2VZUA 3OBAA 2OEMA 3T2PA 3M5ZA 4AF0A 1DJNA 1E0WA 4L64A 4MB5A 1UA7A 3PG8A 4W8BA 1KFKA 1OSEA 1WBJA 1HP4A 5I7GA 1V93A 4CQDA 1P0DA 4W9QA 4CQ9A 4XZNX 4OU1A 2YA2A 1GRJA 1CYGA 4KIEA 3UY8A 3P67A 1Q6EA 3GTNA 4JTHA 5DO8A 3G1YA 2PDIA 5HK4A 3CL7A 4ZGYA 3ZIZA 4MKNA 4W84A 1LDCA 3RIKA 3FEQA 1NF7A 1V0MA 4H04A 1OINA 2ALRA 3C3NA 1Z32X 1WKEA 3PB2A 3MS8A 1SQ7A 3C56A 2PCQA 3B97A 3GXTA 4XZWA 4PTWA 2FIQA 1M01A 2IKIA 3TN6A 4Q4KA 2HS8A 2P88A 5A6JA 4GNVA 1IGWA 2OKOA 4ICCX 4GO8A 5EB8A 2Y85A 3KVMA 2VNCA 2YYUA 2W3ZA 2D3NA 4KFOA 3K2GA 3BW4A 3P8IA 5IXEA 2Q6ZA 4U33A 4Y6GA 3UPMA 2VFGA 1EJRC 3L5LA 4UCGA 1JZ4A 2YDSA 4JD4A 2OYKA 1JUEA 3OU8A 4D1JA 1F05A 4UZSA 3M5VA 4MNJA 3XIMA 1KFJA 4IQEA 4MMWA 1GKQA 2A4AA 1DJIA 1JNSA 1EXBA 1GNXA 4Z1CA 5BU6A 2ZR5A 3BCDA 1W3HA 4PCPA 2EKCA 2CBJA 2XTKA 2YL6A 3H7VA 1T11A 5D9MA 3WLKX 2JKEA 3KDNA 3MUZ1 5JMUA 3NQDA 4LS2A 1FKTA 2HK0A 1Z89A 3LBCA 2IMRA 4JTDA 1E6QM 3U4AA 3WLPA 4HU0A 4GY1A 1FHDA 1FA2A 3H12A 1BVNP 1A5KC 1TJPA 2UY3A 1XF0A 1R9ZA 1N8FA 3OZMA 1J12A 3TSDA 2UBPC 4NP7A 4WQ6A 3K1DA 1E51A 1TCMA 2VX7A 1ZPTA 1F3WA 1AH0A 3PSVA 3WKZA 3S9ZA 3GYEA 5C2GA 4PGLA 5JIPA 3LI1A 2D0FA 4JFTA 5C54A 2GUUA 3QY7A 3BV4A 3LD5A 1VFTA 4Z2JA 4C6JA 2HNEA 3MANA 5EFFA 6TIMA 4OBRA 4H8NA 5FL0A 4GIEA 5D38A 5TAOA 4HCDA 3GNPA 3IV8A 3CUIA 4NI8A 5KZ6A 3IS4A 3NCOA 4PUJA 2NQHA 1XINA 1BGAA 1VFMA 1FWIC 4WJEA 3CIWA 2DJXA 1K8ZA 3GDKA 5A6BA 4LY4A 4DRHA 2Y70A 5AHLA 2M08A 1E55A 3UGVA 3G0XA 3EA1A 2GWNA 2YW4A 1GEQA 3V36A 5G5IA 3WJWA 1UUQA 5K9DA 2AOSA 3MZ2A 1F2JA 3E2SA 1Z7AA 1JCLA 4WIWA 3I3DA 1EWEA 3BZGA 5E6YA 3SURA 1XUUA 1TIMA 2OSYA 1CX9A 6CGTA 3LZ3A 2J66A 4HJWA 2YCJA 5LHFA 4CNUA 4FN2A 4NT0A 1P43A 5AVHA 4H9UA 5A6BD 1UOZA 3LB0A 4B2DA 1E1CA 4LBUA 3NQ8A 3WFZA 4GZ7A 2IS7A 3DIPA 2PA6A 3TMLA 3Q58A 3U7BA 3Q67A 5AC6A 2Z0IA 3SJNA 5HWBA 1VFSA 1IIHA 4GO9A 3W7JA 3CEUA 4HYRA 3M47A 3W85A 4B5TA 3BH4A 3E0FA 4Q33A 3LK6A 1K4GA 2P4VA 3P0XA 2CLIA 3ZVHA 1CGTA 4B2DD 2V82A 4WOQA 2YA0A 1JI2A 2PB1A 4OV9A 4PMZA 3LG3A 4AD4A 4HOWA 2ZQSA 2Z7GA 5FACA 3CTLA 1L0PA 3SCSA 1FHVA 3L4XA 3KBSA 1QPOA 1B0IA 3R0DA 3QH2A 2BMBA 2XP8A 1ISVA 4JIRA 1VFFA 5CC7A 3LCGA 3PTMA 4JQ2A 4EPKA 4L1XA 4J4NA 4Y9NA 3STCA 3RM9A 2VDHA 2E5BA 4AZ5A 2FVMA 4WDUA 4IMFA 4RR4A 1JVNA 5DIUA 4CCZA 4QNWA 3QTGA 5TNVA 4CD7A 3UETA 3LM7A 4HB7A 3CTTA 1JUBA 1WDSA 5G1MA 1EP2A 1XW8A 4XAKA 1OG0A 2FPYA 1IZCA 1Q6CA 1VH7A 3KBVA 1BKHA 1PEZA 2PU0A 4Q4SA 5DQPA 3VABA 5IBXC 1IWBA 4O8AA 1DEDA 1EL3A 3I68A 4QE5A 3GHUA 4Z2HA 3WX7A 2E3ZA 3GDTA 3V1HA 3VGBA 3N04A 4P5UA 3FVMA 4MWAB 4F2BA 1JZ3A 3FAWA 4C6LA 3IUDA 1XWYA 1M7JA 2BOFX 3MP3A 3VGDA 4BQ2A 3VX1A 3DFNA 3H2OA 3URBA 1ESWA 4AD1A 1SO3A 2A7RA 2R82A 1QT1A 3ARWA 2VURA 2XGIA 3FLUA 4AD0A 4HPHA 4YHGA 5AFDA 1TE1A 5BWFA 3WQEA 2KO7A 1EA9C 4E8DA 2VL4A 2IQTA 2VZOA 4HU8A 2X1RA 4M7TA 3ATYA 2DP3A 4DM2A 1FXPA 4UFMA 1J0KA 2NLYA 4DO4A 4JIHA 1XXXA 1W5OA 3MWAA 4JX4A 2P53A 3IIVA 1FKLA 4DBSA 1FFRA 3E0LA 2X8RA 3LERA 4F48A 2WJDA 3BZJA 1TQXA 4MNLA 3H8AA 3GW3A 2RURA 3WMSA 4BHYA 2J24A 4F0RA 2BFGA 1JPIA 3ECQA 2ZOXA 4KWVA 2F23A 1ITCA 1Q85A 5C7HA 3GC2A 4RE0A 4IM4A 1TJ2A 3NEHA 3G6LA 1GW1A 4WSKA 3SBFA 4PCFA 2ZUMA 3GS6A 1WUEA 3EY6A 4HZ8A 4LXFA 3UYCA 3KVKA 2XM1A 2BVTA 2FZMA 2OR2A 3PHAA 1H7RA 2VEPA 4OVXA 3OGVA 4LAWA 1U5HA 1JF5A 1SMDA 2ASHA 4KR0B 4S1FA 3MCMA 2DGAA 3I3EA 3V0UA 2REQA 1NM9A 3UQAA 1Q13A 2Q8XA 4GIRA 2YOCA 3C2OA 3U5UA 3P5ZA 1GHRA 4MKVA 2CLMA 2P0IA 3ZR4A 4GNJA 4TNSA 5CCZA 4LQ1A 1PTAA 3QKEA 4QZVB 2J7BA 2QDEA 1FRBA 1YDNA 4KQNA 4B5VA 1EGZA 4K7YA 5LIXX 4LOCA 4E3TA 3TZFA 2WPBA 4C90A 1UC4A 4IPLA 4LUTB 5E09A 3BG3A 2V67A 1YRRA 8CGTA 1TV4A 3GX9A 1W3KA 4RE4A 1I75A 2EO7A 3ZSTA 3ZLHA 1RXOB 4QSHA 2G37A 2A21A 1C92A 2FFCA 4P7OA 1POJA 3WN6A 2DVUA 1NOFA 3LHTA 3VDHA 2W5FA 3BOXA 3EOUA 5ABHA 3PBWA 3N3MA 1PWMA 2D0HA 2QCLA 2X1TA 4MHBA 3LXCA 4V1XA 3BAJA 1JDAA 3LRLA 4JDBA 3QJAA 3DUGA 1V8EA 2YLAA 4CCEA 1E0XA 1D3CA 4DRSA 2LGOA 4WOZA 5HTGA 1W9DM 1HJWA 1YX1A 1BKSA 5J6EA 3APGA 3RLVA 2BG5A 2QCNA 4NIRA 1SGJA 1O12A 3UI5A 3I6RA 2EPLX 5I3FA 4AWTA 2WWCA 2R24A 5CC6A 3C5QA 4QIUA 1TMQA 1A80A 1PX3A 2DT2A 3MI3A 3W7OA 3APYA 3UQBA 3E96A 3PUOA 2LPVA 2PUZA 4ZENA 4B3LA 3WD3A 2TRSA 3BC9A 1PZ3A 3RX2A 3QYQA 1W91A 3RAOA 2DDXA 1C29A 1LQ2A 2BZNA 2YXOA 5JH8A 2VC6A 3UESA 2GWGA 3NQAA 1XH1A 5DCBA 1FUYA 4IUGA 2F84A 5K9CA 3D47A 3K8LA 1QXLA 3OG3A 2PDWA 2XZ9A 2OO6A 3N34A 3HG5A 3CJPA 1TQJA 3HB9A 4Z2KA 1WB0A 1OFBA 4PUEA 3UBPC 1LROA 3R2GA 4K8EA 1TJRA 1TWSA 3VKJA 3L0KA 4FEZA 3NL3A 5F2IA 3C2VA 2R1MA 4JN6A 3A23A 2CBIA 2CHOA 4GWEA 3QC3A 4M7SA 2G4JA 2O0TA 1P1MA 4ATLA 2CLHA 5FIPA 3UA3A 2Z28A 4H8VA 2R6OA 3STFA 1YNPA 5D04C 4F0KA 4U84A 3LTPA 2ZBTA 4GA8A 2D22A 3GC4A 1TX2A 2AL2B 4ZSUA 3P80A 1MDLA 3BSHA 2BY3A 4OJYA 1IXQA 1F3XA 2I14A 1PIFA 3CHEA 2V3GA 5MKGA 4L9ZA 4O15A 1R9HA 1U2YA 2ATMA 4UWMA 2W63A 3AWNA 4FP1A 1CXIA 2IW0A 2ZX7A 3R89A 1FY6A 4UQ9A 3EDFA 1QI5A 4UC5A 1G4EA 3VIGA 4RPQA 3NFUA 5CBJA 1KRMA 1EF3A 4XO6A 3WJZA 2VR2A 2B7QA 3AICA 3T44A 6XIMA 3T42A 4QJ1A 4JTSA 1C3FA 4A3RA 4J40A 4UR8A 2A3AA 5GNZA 1YTKA 2WKGA 4IXXA 2PDKA 2WMGA 3BQ5A 1QFEA 2PGEA 1EDTA 4R7OA 4YTSA 3FN9A 1SSGA 5DRIA 3BURA 5K4ZA 3GHTA 2FVLA 4V33A 1NWUA 3WIJA 2AAAA 3LCHA 3N3TA 2DW7A 4V1YA 1NJJA 2QV4A 3S2JA 1CB7B 3TN5A 4DZIA 1WOBA 3MZNA 2QF8A 1XH2A 1O5XA 1YTDA 1JJKA 4K39A 1W2VA 4XD5A 3W7IA 3W02A 2DIJA 4UUIA 3PZQA 2GVYA 5A6MA 4P8WA 2TYSA 3OO2A 3VGHA 4LAOA 4JNYA 1KFLA 3UJFA 4RX0A 1ZRQA 3W1PA 2OQHA 3OA5A 3W83A 2F4EA 3PBVA 2WHJA 1LL4A 1GJPA 3C6CA 4AZGA 1HW6A 2BB0A 5C70A 1CXKA 4KWUA 1OGBA 4PA8A 1J9YA 3RGTA 1FWJC 4ZE4A 1TMLA 2Y4SA 2CLOA 1HL2A 1N8IA 2FZ9A 1TV7A 5H2ZA 3Q2DA 4EPDC 4PBEA 3O5OA 3G2GA 1W1VA 2Y1HA 4XKYA 1R3RA 3WF2A 3CMJA 4JHZA 4J7RA 4GIAA 3W3OA 4ZZ9A 4Z08A 1JZ5A 5FI8A 3V0SA 3E5PA 4KERA 3SCUA 1M65A 4EXBA 3RGCA 4Z1DA 1XPGA 1UWRA 2QCMA 4CQBA 3BUVA 3W22A 3P0WA 2YA1A 2PD5A 3G1XA 2Y78A 5CZ0A 2ZUTA 2V38A 3N6JA 2EBNA 4C02B 5E0KA 1ECQA 2VD9A 3IGUA 2ZDRA 3QN3A 3WFLA 4CEUC 3QGVA 3QGAC 4F8XA 4NZ5A 1HN1A 3VIOA 5A3HA 1KTNA 1IIGA 5KTLA 3RR4A 4AZ6A 1BD0A 2DV0A 1RALA 3W07A 4AB4A 2VTFA 3M43A 3WDHA 5BYWA 5CPOA 2ZRVA 2J8GA 1EQPA 1ZP4A 1QNRA 4JHOA 2AQWA 1M7OA 2KE0A 3GSMA 3K4WA 2CZDA 3CUZA 4A3YA 4W9PA 3SUTA 1B57A 1JD9A 4IT1A 5CPQA 1VPYA 5HINA 1ZFJA 1W1ZA 3SFKA 3SJ3A 2VCBA 3BTNA 1V6WA 3FV9A 3QXBA 3WDIA 1HVQA 2IUZA 4NJJA 4H9XA 1UBPC 4C1KA 4ZQMA 1I1XA 1K3UA 4NX0A 4R9OA 2XVLA 2XVKA 1JI1A 1H61A 5HATA 3AHXA 1UMLA 5I3HA 4E5TA 2C8NA 2FKPA 3ME3A 1W26A 4N4PA 1LT8A 3IVTA 3N4EA 3R1ZA 3NO5A 4Z1AA 4H7ZA 3ABQA 5CPTA 2INFA 3CGNA 2ZTJA 1EA0A 1WCGA 2FB2A 2C18A 1V02E 1JGMA 3STPA 3TW9A 1GYMA 2XGZA 3EWDA 3LSBA 4E2VA 2OB3A 3RPMA 3DX5A 1PSCA 1WKYA 4DRQA 1W37A 3EWZA 3TC7A 3HQOA 4JX6A 3W71A 3GK0A 4IMEA 4KEMA 4GKTA 3NL5A 3IIXA 4JFIA 3PFRA 3FKKA 3HV8A 1RVGA 1Z8AA 4GOAA 1BYBA 4O57A 1UWTA 3AS2A 2OWXA 1KCKA 3RCMA 1BTMA 1EIXA 1FAPA 3BAYA 5CH9A 1B3OA 3UWZA 4WR3A 3H9RB 1XDLA 4QRNA 2NQ5A 4XZBA 4U4MA 3O2LA 4FK9A 1XIEA 1BG4A 3P62A 4PCSA 3GR7A 2Q09A 4O1DA 1XX1A 3V0TA 1OHLA 2D0GA 5BU9A 3KRZA 1TWIA 3M6YA 3LV6A 3OPSA 1RD6A 3L2MA 3DFSA 4Y8EA 4EAMA 1G4PA 1BPLB 3WLOA 1AW1A 3ONBA 4AISA 2E25A 3G18A 3MHFA 1W9XA 4V2XA 5EMLA 1LUCA 1OCJA 1MEHA 3NO3A 4H4IA 3CMFA 3C2EA 3DI1A 1HJXA 2PP3A 4OECA 4UTIA 4CN1A 1BEUA 1IXOA 5HR7A 1BYAA 5EU9A 4XQ6A 3V75A 1RBOB 5CKSA 2PPPA 3DC8A 1QW9A 2VYOA 2YZRA 3URNA 1F8MA 4BR1A 1P0EA 2VZVA 3BOLA 1UPPA 3MKCA 1RHCA 4DYEA 4XAGA 1JQXA 1VIWA 1E5JA 1IE7C 3DXIA 1HKKA 1VCFA 4MTVA 4FPSA 2ZQ0A 1YW5A 3A5FA 5AC5A 3EXRA 1Q2RA 3KTSA 3GG8A 1R87A 2I5GA 3QKZA 2DORA 4JQ1A 1UQYA 2X30A 3SIZA 3FSTA 4LVGA 3UG3A 1H7WA 3MSYA 3WQCA 2HE8A 1W3IA 2I5IA 2WXDM 3IJIA 2A7PA 3HMJG 3M0JA 3LCFA 2OG9A 4NXKA 3M0ZA 3AMCA 1IEQA 2RHGA 1NELA 4MY1A 1TRIA 1ALDA 4CQ8A 2NQJA 5LNVA 1XYFA 3NNTA 5FJTA 3A12A 4IFKA 3WLMA 2PLKA 1X7FA 1JFHA 2NUWA 4EAYA 4YCOA 3ARZA 4HIBA 2E9BA 1R85A 2V8ZA 5DXYA 3NIYA 1WZAA 1DPMA 2LKNA 1AW2A 1LRQA 1EF2A 2WC3A 1K7FA 2NZLA 1TR1A 3C61A 4HU3A 2P5NA 1GZGA 3GVQA 3HTWA 4H7CA 2QUVA 3O0KA 2Y88A 3FAXA 1IWPA 1RY0A 3I7RA 3VNLA 5DMMA 4AYSA 2OKTA 1EUNA 4ODNA 3LQLA 5C9UA 5HT1A 3R8GA 2DZAA 2F9RA 3GWQA 1XLEA 4H1ZA 1JNEA 3PBGA 4OWGA 1XYBA 3HFYA 3VE7A 3HPFA 1OCBA 4AWSA 1LLWA 3MP5A 1TMHA 1ZCOA 3UVAA 1LM1A 3BK0A 3WH7A 3HG4A 3FW6A 4HQVA 1VFUA 3K1GA 3UERA 4GUIA 3HA1A 5T26A 1BGGA 3W28A 4DJDA 2BY1A 4IFOA 3QQWA 3W1RA 1O68A 1E4NA 2H6RA 3BCFA 2QCEA 4UTMA 4N9BA 1RCXB 3FSUA 4TMBA 4HTYA 1OGGA 1BG9A 4IPPA 1CECA 3O5MA 4AC7C 2KR7A 1GW9A 5BOFA 3GDLA 3FYPA 3WH5A 1V3KA 2OSXA 1MWOA 2XH7A 1FH7A 1UWAA 4O54A 1TV2A 4DI9A 1EGMA 5GJMA 2QCDB 1NY1A 3PJXA 3S5YA 4DJDD 1C8XA 1QPKA 4JTRA 3PRAA 4FZIA 1BQCA 1QBAA 2DSVA 4IGHA 1PBGA 1PXGA 4RZ4A 2X0YA 5HWNA 1B2YA 1XI3A 2ZXDA 2WOQA 3ZLFA 1VBUA 3W73A 2OX4A 4CCDA 2EEXA 2D9FA 2PBOA 1MW1A 3N6HA 3EX3A 4M80A 3I6TA 1FBAA 3CLMA 3KVJA 1BLIA 2QJGA 4QTGA 5C5YA 4UOZA 3OBKA 2CWNA 3ZJ6A 2OZ8A 4MJ2A 1OK6A 1GZJA 1DTNA 4HNTA 5GJNA 1QWGA 1VENA 3WUGA 3MMDA 4EF9A 1C93A 2G41A 1QOXA 1DWGM 1AL7A 1V0KA 4UMCA 2B7OA 1DWAM 3LMZA 3VXGA 3TNBA 3DFYA 4GQQA 5JU6A 3QRHA 1QOQA 4HN8A 5EYWA 2H8ZA 4ICNA 2J62A 3KTCA 3WQPA 1DV7A 1TVNA 3PN8A 4R5EA 1C8VA 2QJNA 1ITXA 4QS6A 4FO4A 2QJMA 3H70A 3N2CA 1LWIA 4LS0A 2NVCA 3WQGA 4ZFCA 3S1XA 2CLPA 3QF0A 5EL1A 4ZL1A 2GUYA 3UXAA 4FXFA 1D8CA 1PL9A 2Z24A 3UEQA 4BI5A 3DU0A 1V3IA 1RVKA 1XLFA 1Y7VA 2M1IA 1P48A 3NQ7A 1DTUA 5I79A 2ABBA 4KEUA 3TE9A 4DUWA 4PMVA 2GVEA 4Y8FA 3AXMA 1QDSA 5JBEA 1K8CA 3PJUA 1BWVA 1JDCA 1H7PA 3WBXA 2GK1A 2Z27A 4M56A 3B40A 2EG7A 3OLDA 5CAKA 2E6FA 1ZCNA 4PRWA 3O5JA 1NP2A 3WUBA 1FWCC 4AIUA 5FEWA 4C7FA 3MUY1 4KS0A 3QMTA 2DEPA 3LPPA 5C7VA 3EMCA 3GBEA 4MDPA 4NL1A 4F0HA 2Y7FA 5CZKA 1FQ0A 3GDBA 3VMNA 1WYIA 4HK6A 1YIXA 3PM6A 2XU2A 4NF7A 3ZLGA 7CGTA 3Q37A 1MUMA 5A8GA 4Q3MA 5ENLA 3P61A 4AHOA 4FNRA 1C8YA 1VB9A 4X9YA 5HW7A 2CHNA 5FA5A 1LQ0A 1AJ2A 2BGQA 2G97A 1U22A 3H2MA 1YW1A 4L5ZA 3AUJA 3WG6A 3OJGA 2BGNE 2BTMA 3FGCB 1AMKA 4QSFA 1DHPA 1F5ZA 3RNDA 1O1ZA 3W88A 1XIMA 5HUPA 1AA1B 1LBMA 4HCHA 1UKQA 3NQFA 1WXZA 3NM3A 2ZC8A 2OOGA 3NTYA 3ZQ9A 3KHJA 2H90A 4BA0A 2P10A 3G1DA 3WH8A 2J88A 3LLDA 3OGSA 2VVNA 3AYVA 1GQLA 1KM1A 1ZAJA 2QYGA 2X2GA 3VNMA 7A3HA 5BXRA 3HZ3A 2HV5A 1ICPA 3CM4A 3ZWSA 2PDPA 1Q6HA 4MDOA 1KGUA 2CERA 4DO6A 2Z1KA 3NUKA 1W17A 4Q8MA 3PPFA 1PZ1A 4E2DA 1J0JA 3AIUA 2P8BA 2X42A 3MY9A 4AWEA 1X38A 4HHHA 4LAVA 1PKYA 1YKWA 2WBGA 3M46A 1OB0A 1DWJM 2VRJA 3B4UA 3RFAA 1GEHA 2WM0A 1THFD 3G1RA 4GX9A 3GXDA 3W2NA 1E6NA 3RMEA 1DOSA 4V15A 1RD5A 2PPGA 3KUMA 4AD3A 5HKGA 2G3FA 4NX5A 5BW6A 4GG9A 2DU2A 2B31A 4G7FA 5U4NA 3SO7A 2P0OA 2DZPA 2D1ZA 3TYCA 4A35A 4V27A 3RLGA 3CWNA 1G0CA 3QQ0A 2R14A 4IZGA 4NUWA 3S5ZA 1TV3A 2A79A 4UQAA 1AK5A 3W0KA 2PBCA 1S1PA 2UV8G 1JNTA 4KW2A 1PKNA 4J3XA 4ERIA 4AIBA 4UFKA 4HBEA 4M1RA 4AVNA 3G1FA 1OT1A 4AIEA 1TO3A 2DW6A 3NM1A 3PWIA 2E68A 4UNKA 4DIAA 5LA2A 1Q6IA 1XQKA 4IF2A 4KESA 2YZ5A 3VO0A 4QROA 2VWSA 4MJMA 3CBWA 1B5TA 1W0MA 2GVJA 2YW3A 3SAZA 4DLMA 2OYLA 3N13A 4JFLA 2HVNA 1PX8A 2XN2A 3P7YA 4WSHA 3UNTA 2R94A 4J2PA 3W70A 4JTJA 3O5PA 3VINA 4LNYA 3OYXA 1RZMA 1J11A 4HNLA 2JFEX 2XDFA 4XWUA 1A3WA 2FTYA 1J01A 4JNZA 3QOKA 1O5QA 3JUGA 2BODX 4IOTA 1F3TA 3LMYA 4LUIA 2FYMA 1ECEA 4O52A 1R5YA 3W7CA 2GSJA 3SCQA 1CLXA 4W9OA 3AI0A 4ZB2A 4L9XA 3FIGA 4TX6A 4N02A 2XH2A 1PV8A 3URAA 3B8TA 1V7YA 4DZHA 2D2GA 4D72A 5G1YA 1TPUA 3A13A 4XZ9A 3WJXA 2PCEA 1GKPA 4WGXA 4CD8A 3L65A 3MKKA 1O7AA 1LG1A 2WJFA 4F2TA 3P2VA 3VOGA 4NZ3A 4KGJA 3E2RA 4ODMA 2NSOA 4WEVX 4PCTA 1TJ1A 1AMYA 3ARPA 1W56A 4QE1A 5JXQA 4MLRA 2PPNA 3U2ZA 3VIKA 3THDA 1JR1A 4PTMA 3SDOA 4XAPA 5I00A 3AUOA 5AOUA 2KFWA 1PBKA 1SU5A 3R4IA 3WLQA 1UMYA 3HIJA 3L5AA 3AQUA 3SN4A 4GACA 1S2AA 2ZRYA 5HJXA 1ZJHA 3LS9A 5KSWA 3ITCA 1F8AB 3VZXA 2R91A 3JYJA 3TA6A 4PB4A 2GGIA 3NZPA 1NSGA 4O14A 2C79A 4WGHA 1UR2A 4N9DA 3P74A 1C7SA 3SI9A 3NA8A 2P3ZA 2Z4GA 1W1IE 4YVVA 1QASA 5C2CA 4LRTA 2DG9A 1W1YA 2OLHA 4YYCA 4IISA 4RW5A 3NPXA 5HW6A 1S5TA 2RGMA 5I09A 3G0SA 4RZ6A 3MJYA 4IX0A 4M1BA 3EA3A 2PWDA 4H6QA 1VBJA 2DUZA 4DN1A 1X96A 3OYZA 1DP0A 3N9SA 3ITLA 3PZUA 3K8KA 4ZXLA 3FXGA 4TVUA 3ZT7A 3CZ8A 3PF3A 3N2BA 4N2YA 4KETA 4TOQA 3T2QA 4P8XA 2MNRA 2HZGA 2PD9A 3LLFA 3W7DA 2DUXA 3ZMRA 1FXQA 4K8GA 1EB3A 4MY9A 3WLJA 2J7GA 5I77A 3BLDA 4NSBA 1DE6A 3HV9A 3T05A 1VS1A 2OLAA 3MV11 2H9AA 1FWBC 5CSSA 3L4UA 3S6OA 4G2PA 1TJ0A 3G22A 4GQBA 1GTEA 3B9OA 5LIYX 2OYMA 4JYDA 2X0SA 1L1PA 3TDBA 4IIEA 1T40A 1EX5A 5A6LA 1UD6A 3N6QA 3G1SA 1J2BA 3IGSA 2ZQUA 2E0PA 4OQVA 3QZAA 2ZWZA 1A5BA 3EIPA 2PF0A 3CO4A 2NUYA 1GQKA 1K7EA 3A4XA 3WY1A 3VCRA 1BYDA 3BMBA 1R9XA 1UJPA 5DMYA 2EJ1A 4ACZA 2Q8ZA 5ABFB 5HMSA 2DIKA 1PJ9A 2VX6A 1KB3A 3FFSA 2DPEA 3OQEA 3AO0A 4TW8A 4CNSA 1A3HA 3I4KA 1MZHA 2VQTA 5CPNA 1XS2A 3GTFA 4AX7A 2ONEA 3TJLA 3A47A 4FIRA 1KM5A 2RUDA 4E2BA 4Q8PA 1U1JA 1JXJA 3AHVA 1BVWA 3N2MA 1JIBA 3GHSA 3R10A 3QVQA 3AIWA 3VDBA 5G1TA 4O1EA 3MUCA 2X1IA 1D7IA 3MDUA 3N17A 1D9EA 4GIYA 1E0UA 2QR6A 4H01A 3UG5A 1VP5A 2PURA 2VX5A 3B0YA 4WK9A 4I9MA 2O4QA 1NIUA 4DI8A 4MNKA 5BWAA 5LIWX 1V03A 3SZ8A 1DJWA 3WL0A 2WLYA 1PYFA 3PR2A 3WEOA 4UTLA 1TVLA 3KS5A 4MIMA 1FKHA 5LGXA 4HBKA 3EOEA 5C9ZA 1JD7A 2C7FA 3CWOX 3VKDA 1FKDA 2QXWA 2V3FA 2GUBA 4Z0JA 2HQAA 1KFEA 2Z7KA 3U6WA 2Z6IA 4LY8A 1W8GA 3UD6A 3TTQA 4AZCA 2G3IA 4LCRA 1KO0A 2HJPA 3W87A 3G77A 3ZS4A 1BHGA 3EX1A 2OQYA 1Y5XA 1FKBA 3KBMA 3ZXWA 1QOPA 3SUUA 2IKHA 1OZMA 1FX6A 3H2CA 1B3VA 2YIHA 1EZWA 3C0JA 4R3UA 1JL8A 2V81A 3KAOA 3TVAA 2ZICA 2Q02A 1WX0A 2PPOA 2PDBA 1F6KA 1F3EA 1F6YA 4GVFA 2EGZA 2G5WA 1Q4WA 1XG3A 4WKAA 1CLKA 2QJHA 3B8DA 4B9YA 1W5NA 1H7XA 4MB3A 1XFCA 1EX1A 2FDMA 2F6KA 3GIQA 3IJ8A 1V6TA 1VAHA 3IKGA 2J8TA 2OELA 4QT2A 3UQIA 1I45A 3QFEA 1K03A 2G3NA 1BAGA 3PTQA 4F0MA 3DG3A 1GVEA 4MPKA 3N2OA 4GFSA 4O50A 1C9WA 1FWTA 5D09A 3TW6A 4ZS6A 1CT5A 3UXLA 1FTXA 4UMBA 2NQ9A 1P6BA 4IIFA 4L7ZA 4NNRA 4MG4A 2PGRA 2GDUA 1EPXA 2PDQA 4IPJA 3LBOA 3A3HA 3WLIA 3JR2A 4Y9MA 3S47A 1S2VA 2QZRA 3AMKA 1ZJBA 4LAXA 4QDPA 4PMQA 1PE1A 1XBVA 4HD5A 3FHAA 1B6CA 1IQ8A 1XLMA 2J74A 2A2IA 4O1FA 1E9IA 4EX4A 1F8IA 1RA0A 2WAGA 1WBHA 1OC5A 4O10A 2F8QA 1PCWA 4WY0F 4X63A 1QNPA 3M0VA 2ZYFA 1HKVA 3WD1A 4PFMA 4FOUA 2CZEA 2EXOA 4YMZA 3DGRA 4IICA 3S1UA 3MMWA 3CO8A 1W1B1 3LEPA 3SB0A 4XVDA 1FP9A 2PDNA 1EH9A 4B4FA 3V3WA 3VZYA 1ADSA 4HNVA 3IK8A 1KQZA 5AKQA 4O4VA 3W6YA 1O66A 1WP6A 4W89A 1MQPA 2EAWA 3ARUA 4X61A 2QUUA 4BQ3A 4DRNA 3COTA 4IJRA 4Q4QA 1ISZA 4UFIA 1S2UA 4NAEB 6A3HA 3TFCA 2CNCA 5D2VA 1QNQA 2RDXA 3CNYA 1S46A 2QJIA 4Q22A 3GY1A 1H11A 4DIPA 2EPNA 3O1NA 4X60A 1RK5A 2IKGA 4JFSA 4IFKB 2VOTA 3IPWA 4YNGA 2ZZ1A 4PC8A 1XLJA 2WCGA 2DQXA 1T8XA 3LYEA 4UQEA 4ZVJA 4ZTYA 2ACUA 4YTRA 5MF5A 2YB1A 1PTGA 1RPXA 3LNPA 1XLLA 2OEJA 1E40A 1S2TA 4GPNA 4GYKA 3SCRA 3ITOA 2E1WA 1G94A 5BZAA 4J3UA 1ZAIA 3A9BA 1P7TA 3F4CA 1KFWA 1A0EA 1PVNA 3BWWA 4GGBA 1ME7A 4KKXA 5IM51 3L66A 1F4HA 1F61A 1OIMA 4UQDA 1TR9A 2XPKA 4H6EA 2HVOA 4DF1A 3ARXA 3KAIA 1GOQA 4HT3A 1HFBA 3HBLA 3HGJA 1S5MA 5EGRA 3TYZA 1H4PA 4NAFB 3NQEA 4X9SA 4HZ6A 3EWCA 1OF6A 2JF6A 4PUNA 3GFXA 4LSBA 3U2OA 2YCKX 1ZU8A 4ZA0A 5D02A 4PUKA 2V2DA 1G4SA 2VR4A 2CKSA 2BY2A 1OT2A 1WAUA 1KRBC 1JAEA 4TW6A 4Y2WA 3KX6A 4Q6XA 3ARYA 3G24A 5H8MA 7TAAA 2VGFA 1I0BA 4DEFA 1XIHA 4AG0A 3VC5A 5AHFA 1W2PA 4JFUA 4GBUA 1XPYA 2OEKA 3O5FA 3PZGA 2ZXQA 3GAYA 2WANA 4ODRA 4OE7A 2C13A 1Q7MA 3TYAA 3W1TA 3UJSA 2MUCA 3O0FA 3ITXA 2MANA 2VUYA 4S3DA 3R94A 4NZ4A 2WVVA 3GIYA 4GI8A 4C5YA 5C2XA 4O11A 3PRDA 4IPNB 1FWFC 3W1XA 2ZCGA 1MW3A 3GKFA 4LJ3A 3C52A 1LLZA 3OIHA 2VRQA 1MUCA 1Q6FA 1ZBWA 4F40A 4ZXOA 2XVPA 2XFFA 2C91A 5C0QA 2E40A 5FKYA 5HXMA 4EKJA 2OOFA 2Y2WA 1Y5VA 3KABA 1XSIA 1UR0A 2WSKA 3W38A 1HNYA 3VD3A 5C9WA 4S3KA 2INEA 2Z1VA 3PZIA 1AQHA 4GUJA 4B5WA 3RHGA 4O17A 2UZ9A 4WXZA 1RP8A 4S3EA 4REQA 2XGBA 3ZYZA 3EDJA 1PUDA 1ODUA 1GVSA 3K4AA 1B3ZA 1E9YB 2A5HA 1TWZA 5FJOA 2NXGA 1N1AA 2BASA 2PRMA 5LXEA 1F40A 1SFTA 1V3HA 3CUXA 3RRAA 4JS3A 1J0ZA 5DO2A 2QS8A 2ZR4A 3AYTA 1VC4A 4UTTA 3SQMA 3SW6A 4H83A 1QATA 4WJXA 1M9HA 4M6VA 4ROQA 2G3MA 3UXIA 1K77A 1HO4A 2YL9A 5LIKX 1O5RA 4F3HA 3KCOA 4AEFA 3B03A 2WWDA 4JTFA 4XD4A 5FJUA 2DZSA 3LRKA 3PVFA 2FB3A 3PK7A 1W5PA 4KFPA 4H9ZA 1P6CA 2TODA 3OZPA 4CNNA 1REQA 5D2XA 5F4WA 4DF2A 2MF9A 1MW0A 2QMKA 3B9AA 1FKGA 3B3DA 3W72A 1JCMP 3FX4A 3FCPA 4GY0A 3KXQA 3O3RA 3QEZA 4DO5A 2HPIA 3RLUA 3VYLA 4BQ4A 1G67A 4KQZA 4O0QA 1UZ4A 5MHBA 3W1LA 2QKFA 1RLCL 2CLLA 3REQA 4GZIA 2AWGA 2GLKA 4S2BA 3SY5A 1E6RA 4H9TA 3UY7A 3XISA 1R6WA 3LPGA 3M7SA 2A1YA 2DQWA 4CQAA 5FF7A 4HSHA 5E93A 1CGUA 1OM0A 2CW6A 2PLCA 3CZLA 3D3AA 1VGAA 5IBXA 5GQBA 5DY3A 5LHEA 4XSLA 3CV2A 4HOZA 3IAPA 1QJWA 3PWGA 3W81A 3S9YA 1ME8A 2J9XA 4OBTA 4TX9A 1JQVA 1QNOA 2CZ5A 2M2AA 3II1A 3NSMA 1ITQA 5FCZA 4E4UA 4O1AA 4D6EA 3SGZA 2CZFA 3GIPA 2WSYA 4Q4OA 1R46A 4W7UA 1O6IA 2NX1A 1LLOA 1WDPA 4J3TA 4ZQCA 1XRVA 1HG3A 3G8RA 8A3HA 3TQPA 1L9WA 6XIAA 3G0UA 5E9XA 4XISA 1YQ2A 5CEWA 2QIWA 1TV5A 4QLLA 4J1OA 1FFQA 3I4EA 1E73M 4GC4A 4B3ZA 4ODOA 4H00A 4RV3A 2RGLA 1UQZA 4XX6A 3DBPA 3B0UX 3ZFHA 4ZO8A 5ABEA 3DFOA 4K6AA 1PHWA 4IJBA 4GVIA 3R6IA 4WDTA 3E12A 3TQVA 3W86A 3PP7A 3TLQA 1FKJA 3K8MA 3P8JA 4DJEA 1NFPA 5AZ0A 3PRBA 1DIEA 4HNOA 2OT0A 1FWAC 1E9LA 4DNMA 3TSBA 1KFBA 1Q1CA 3A9IA 2RUQA 4PR4A 3FY1A 5LZLA 5DX7A 2D23A 3GVRA 4KF1A 1QU4A 2XSXA 3TYBA 5A8MA 3MVIA 1B9BA 3W76A 1FHUA 1J79A 5B7YA 4MYXA 4MNMA 3W2LA 1JRBA 4AC1X 5BXPA 3AXHA 1W3NA 4DJED 1PTDA 4JBRA 1TPB1 4QBXA 1S5NA 1KGWA 3VPLA 4FAPA 3WDJA 3J7HA 3Q94A 4ECLA 1MW2A 1BF6A 2F38A 4QM1A 3C0SA 5F2LA 4JTTA 2QPSA 3SUVA 3IIPA 5I02A 3RG6A 2PTYA 1ZCCA 2ZRWA 4ZOEA 2XYLA 3NSXA 4C6BA 3WO8A 4GXMA 1M5YA 1SMAA 3NVDA 2ZZ7A 4DBEA 1HXJA 4QITA 3CUGA 3FNDA 1IR1A 1UZDA 1HKMA 1EJSC 4GZJA 3DBNA 5DRCA 1LRNA 3PUGA 1Q45A 4MJZA 4OFCA 1I2QA 1VJIA 5IOBA 3PY2A 1L6SA 1FWNA 3ZO9A 2VGBA 3LOTA 1D6OA 4HPNA 1MXDA 3W7EA 4K3ZA 3PB0A 5DCDA 4TV6A 3QY6A 3O6AA 1W1PA 4YTUA 4JTCA 2EPKX 3W1AA 5J04A 1H63A 3DFTA 2YLLA 2NQZA 3VUSA 5CJ5A 4PTDA 8XIMA 4DUVA 1PYMA 3ABXA 4W87A 4JXCA 6PTDA 2WKLA 4V28A 3SGUA 3NAVA 1GOIA 3H4GA 1UD4A 2CKRA 1R7AA 5HNRA 1S5VA 2CIPA 4HHLA 4Q8QA 3V35A 1AQFA 2DSUA 3O5QA 3ZZ1A 2WMIB 2RUCA 3BG5A 3VOIA 5IRPA 2GQ3A 4IJCA 1JZ8A 1KTBA 2YCEA 3TOYA 5E0CA 3LA4A 2DT0A 3EMZA 3KLKA 3T09A 4L65A 1OG6A 1GUVA 1M7XA 1I0DA 3B04A 4IG2A 4JTLA 3UCCA 3CS2A 4PN2A 4JFKA 5E1QA 3F5JA 4LBRA 2WJEA 4QEEA 1KLYA 4TYOA 2YPIA 4D6FA 1QO2A 3N73A 2W66A 4DWSB 5J5RA 4J3SA 1IGSA 3EEGA 5ECUA 3FDKA 2BS9A 1E6PA 4Q8WA 3LUTA 1W1TA 2YGYA 3WENA 1TZ9A 5B8IC 3W7RA 5I2UA 4PTXA 4KCWA 1PIIA 3S6DA 3H54A 4EANA 2BLEA 3EB3A 1JULA 3ICJA 2Y89A 1VJSA 5KZMA 4JCLA 1ONRA 4XUYA 1HKWA 4A3QA 1OX6A 1SZNA 4Z2IA 4HTBA 3EXTA 4LF1A 4PMNA 3LXBA 1UR9A 1VCGA 3WF3A 1NH6A 4UTJA 3HG3A 3U8GA 3PJTA 1UR4A 1HL8A 3CU2A 6REQB 1MVYA 1NOWA 1X8FA 1I2OA 3O9NA 2WZIA 3SY8A 4G7EB 3WZ0E 3EWWA 1RCOB 2ANUA 3N9RA 3O6YX 3DN5A 1L2UA 4Q32A 1ZLPA 3L2IA 3KCLA 1VBRA 1FDJA 5PTDA 3LQGA 1T99A 2XFRA 3WMLA 1XV8A 4FA3A 4A21A 5CSRA 4IPXA 1NDZA 2H9AB 3NQ2A 2PN0A 4HMEA 1E3XA 2IXUA 1V6XA 3E0WA 3BXWA 3NXFA 4RDZA 3WQVA 4IMDA 4MWAE 3UWVA 4M29A 4MUZA 5BRPA 2NSXA 1E6ZA 3FOKA 5BMWA 2XP7A 4Z0SA 1EZ2A 1I2NA 3INPA 7REQA 4GJ1A 3QV6A 3DGBA 2DFAA 2BXZA 1ZY9A 3W1MA 4NQ1A 5BMXA 2O4MA 3MSGA 4I7WA 4W93A 4DBUA 2GDQA 3BICA 2Y5SA 2ZUSA 1A7XA 4ML9A 4JKMA 3ES7A 2Z2BA 3WDRA 4EPBC 4AZHA 3PBMA 1EJVC 2A3CA 4QQUA 5CXPA 1LBFA 5HUOA 1YNQA 1Y0EA 3TC3A 1N8WA 1RAKA 4IFRA 2C0HA 1A3XA 4LRSA 1O5KA 2I57A 3TR9A 3AIRA 4ZR8A 5BOEA 5HOSA 4PSPA 1UD2A 3QV9A 3EWYA 4RLIA 2VEFA 5I3JA 1WZMA 3TXZA 4LC6A 3UI6A 2WCSA 2F2KA 1E5NA 4HK7A 3QW4B 1SPQA 3EX4A 3I3BA 3N25A 3W1UA 2W9MA 3VGFA 5I98A 1XR2A 2QPUA 2O7SA 3UT0A 4MZYA 1R2SA 2F2DA 3QHMA 2VDIA 3EX6A 4DRKA 4C6KA 3CL6A 1JDEA 3GE7A 4ZTXA 5ABTA 4UFJA 1ZS2A 3GBDA 3FA4A 2X0HA 2J75A 5CC3A 1OFQA 4D6DA 2C71A 3T78A 1P0BA 3AZSA 4F9JA 1VEMA 2Z25A 1Q4NX 3GU1A 4ZCWA 4RUBA 3WNMA 1E6SM 2X1UA 4Z1YA 2EHHA 1IX5A 1CPUA 2WB5A 3S6TA 3ABOA 4IP5A 1FD9A 3WELA 1JZ6A 4ZPTR 5EBUA 1M68A 2QUTA 1FKSA 5I0DA 3KM8A 4DT4A 2GQ8A 3H55A 4O1BA 1UKTA 4IUOA 4H8UA 3QLLA 4H8HA 3W2KA 4XKMA 1GVFA 3VCCA 3A24A 3L67A 4EWND 1VRDA 3M0LA 1P5QA 4K2SA 1KGXA 4WY0A 2QGYA 1GYNA 3NQCA 2VR5A 1F73A 1J2WA 4UTKA 4BS0A 4FNSA 5KZDA 2W61A 3B8VA 4UFHA 2VDGA 1LL6A 1RV8A 1B31A 3UWUA 3T8QA 1QBBA 4QJ3B 2HNHA 3W7HA 4IQ2A 3IRDA 5D32A 2WM1A 2V5BA 2E9MA 4XZLX 2QULA 2CLEA 4W7WA 3DFPA 1YNYA 2C1IA 3BGJA 4IIDA 4DF0A 4C7DA 2E6DA 3VCNA 1XYMA 3UYIA 1ISWA 2Z1WA 3T1GA 3JYMA 5CG0A 1VFOA 3I6CA 1XLBA 2UY4A 5GPRA 2PI6A 5LXXA 1UP0A 1GGOA 5HUAA 4JL2A 4FX8A 1UC5A 3KCEA 4N19A 1IEVA 3IIOA 3S4TA 3KOXA 1YPXA 3TOPA 3TEVA 1XG4A 4BF5A 3GYCA 1YDVA 4WLCA 4H3DA 3EEZA 3GVGA 5I23A 2ZA3A 3DOPA 2FPVA 1BKFA 1QR7A 2HWGA 3ITTA 1Q6UA 4CU8A 3WBAA 5D9NA 1Y5WA 4PYSA 1MQRA 1T8QA 4B5SA 1VYPX 1PWLA 4W4QA 4UQCA 1VHCA 4FNQA 2YKKA 4R34A 3OHMB 4BF7A 2J9ZA 3TAKA 4NRSA 3NDOA 5DELA 4E4PA 2ZX8A 3L9CA 4UTWC 5T8GA 1EC8A 4MB4A 3M5YA 1GG1A 3QFWA 2HXTA 2YB4A 2AQOA 5HMFA 4W8LA 4UTTC 4Q4MA 4HNNA 4RE2A 3KWSA 1H51A 1N55A 3QV7A 2B5UB 3NQBA 1KKOA 1DQUA 3AHYA 1I1WA 2ZWYA 1V3LA 1O4UA 1D7KA 4GCXA 5A2AA 2OWWA 2HVMA 2JGQA 2CBVA 1CDGA 4DQWA 3TR2A 2DG4A 1Q6RA 1QCWA 3QHNA 5GPGA 4IIBA 4CVWA 3GKAA 1XD0A 4LT9A 2Z1SA 1AVAA 1VPQA 5CC5A 4Q8OA 1TTQA 3B06A 4R7JA 3JW7A 1JDFA 1QI2A 2E7FA 5I03A 3W01A 1YYAA 5DEZA 1SW3A 3L0GA 4M81A 3Q4DA 4MSSA 1L2QA 4ZQOA 3N2TA 4Y9OA 1VPXA 1MRAA 3IUHA 1H0GA 3EB2A 1KBKA 1VZWA 3SN1A 2XG9A 2PDMA 2WZEA 3HGSA 5FJPA 4ZBCA 1X6UA 1P7TB 1XBYA 2N87A 1KR1A 2A85A 4C1LA 2I1OA 3TKFA 5HQEA 4WDWA 2QF7A 1XCXA 1NVMA 1HXVA 3UA4A 1GOWA 1HVXA 1KR0A 4FB7A 3KP1A 1P5BA 4KEVA 3VD5A 3CQJA 3LCXA 4G56A 2XP3A 3TA9A 1TPDA 3M64A 1DJQA 3MI2A 4EWJA 3VNDA 2E28A 4G9PA 3W53A 2FTWA 3T6CA 4JKKA 2X7WA 3EBVA 5G4WA 3RX3A 1OABA 2I9UA 4LS1A 2WSQA 1ZGDA 3IK2A 4QAIA 3ABRA 2A6LA 3AMLA 1HUVA 4GABA 2GPTA 1FWSA 4YU1A 5EPDA 5DMNA 5EMYA 3BAWA 1UD8A 2ZE3A 5M1TA 3TDFA 3E74A 2GJNA 2NVDA 2JGYA 3IACA 5A8NA 3OA3A 4A8RA 5DFAA 4HP5A 2QDDA 1NDVA 2QMJA 4ODLA 5AC4A 3LHZA 3W7PA 4B9ZA 1NOUA 1OCNA 3UJRA 4NJHA 3KRSA 3V1PA 1KD0A 1NF0A 2A7NA 4MY8A 1HO1A 4S3JA 1CGVA 3UZZA 1NEYA 1UWUA 1Q6DA 4ODQA 1KLZA 5FF3A 5F2MA 9XIAA 1EC7A 3WYZA 4DJEC 1R3VA 2QV5A 3M5XA 4DPQA 2XVGA 2WVVB 5G4HC 3NSNA 4B5UA 1NQKA 2V68A 3OTRA 3F2DA 3T55A 4I7VA 2FQIA 5XIMA 1YBQB 3KL0A 5U7SA 4H9VA 4KCTA 3UPWA 1A5MC 4Z17A 4QFUA 1VCVA 4XAZA 4RK8A 4C1NB 1Q8JA 3GDMA 2EQDA 1ZK6A 3UW6A 4D6HA 3OVPA 1XIGA 3BMWA 4FLQA 3FYOA 3AROA 4QDWA