4MAVA

Crystal structure of signaling protein spb-40 complexed with 5-hydroxymethyl oxalanetriol at 2.80 a resolution
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of signaling protein SPB-40 complexed with 5-hydroxymethyl oxalanetriol at 2.80 A resolution
rcsb
total genus 121
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mavA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mavA01
1JZ6A 3MKKA 2CBIA 2V3DA 3WN6A 2EJ1A 5IFTA 5GNZA 3WFLA 4AEEA 3LPPA 4B9YA 5HPCA 1XSIA 2E8YA 4IM4A 2G3IA 3W26A 3W6MA 1XSJA 8A3HA 1HJVA 1QW8A 3VO0A 4HMCA 4BF7A 1BYAA 4ZXLA 3OLEA 1PX4A 3GYCA 1QBAA 2EXOA 3PHAA 3L4WA 4JFTA 1H41A 4CD5A 3AXIA 4H7VA 1BTCA 1TA3B 4W87A 1CZ1A 3ECQA 2YJQA 3BCDA 3MO4A 4TTGA 1EH9A 4HZ8A 1R85A 1JG9A 5C8BB 1EOMA 1KXHA 2OSWA 2G3NA 1UWIA 4UFKA 1GOMA 3M46A 5JIWA 4J27A 2A3EA 1CGWA 3U57A 3ZJ7A 1C93A 3SCUA 2WCAA 3CZEA 1YHTA 1VEOA 2UY2A 4OUEA 4JFSA 3VGDA 4P8UA 3AMKA 1QBBA 4HPHA 2VZVA 3N18A 1UZ1A 5ABFA 3ZJKA 1CEOA 3N1AA 3WUEA 2JEQA 4C7FA 1OM0A 1B3YA 1VJZA 2WMIA 1UH2A 2XVKA 1E40A 2E40A 1BPLB 4UOQA 3AHXA 3KZSA 3TOPA 4U5IA 3A4WA 2FH6A 3BAXA 3VVGA 1HVXA 3AS1A 1JAKA 4CGTA 3EDEA 4FLRA 3VMPA 5M17A 3VX0A 1JI1A 1XC6A 1LQ0A 5IFPA 5A6SA 4FLSA 3T2OA 4D1JA 3BAWA 1H4PA 1WDPA 4NZCA 2ZUWA 2CITA 4AZCA 4ATLA 1I1XA 2WMHA 4M24A 4XUYA 4BCEA 5A2CA 2A3CA 1A3HA 2GSJA 5CGTA 1W9BM 3MS8A 1NOFA 2J25A 3BMVA 2CETA 4FF5A 3AIBA 3B9DA 1G5AA 1KWGA 2XWDA 1VFUA 3KE0A 1HIZA 4TTUA 2XG9A 3D3AA 1E55A 1JF6A 3FNDA 2X0YA 2W62A 3WEMA 5CLWA 4PBGA 1JZ2A 2CBJA 2V5CA 4IISA 3A4XA 3AMDA 4QLJA 4U31A 3PZ9A 1LL6A 2ZXDA 5FIPA 5F7UA 3K4AA 4AC1X 5AC4A 1NP2A 2CYGA 1JNDA 3IJ8A 3PBGA 3W0KA 3W53A 2O92A 3AHYA 4NRRA 2EBNA 3AS2A 2Y4SA 3RPMA 2OWCA 3ARYA 2PF0A 3U7BA 1MXDA 3WUBA 1HF6A 4Z2IA 1UWSA 1WZKA 3RM8A 1H11A 3ZOAA 4QCFA 1PIFA 3W38A 1R87A 1UG6A 3PZQA 1KCLA 1QNSA 2BY1A 3RJYA 3U7VA 1WAWA 2DEPA 2HISA 4OOUA 4CVWA 1W3HA 4F79A 3PZMA 3GH4A 4HOXA 1TVPA 2CBUA 4E4PA 1CLVA 1E6XM 1E73M 1PIGA 3T2PA 2VQTA 4LPCA 3WBEA 2FHFA 3FXYA 1TUXA 4XV0A 5BXSA 1J11A 4PTXA 2YL6A 2E0PA 2ZICA 1V3LA 1E5JA 1OGSA 3AIWA 4B15A 4P7QA 3VTRA 3WF4A 4TUFA 2BY0A 1JZ3A 4AW7A 1J12A 1NQ6A 2WZEA 3W81A 3L4UA 3MV01 2F2HA 4QLKA 3AIUA 3K8LA 1QI5A 5A6JA 2W91A 1ISYA 1ZJBA 2C7FA 3VDHA 4PEEA 4J3TA 5BRPA 3CZ8A 4AY1A 4U2ZA 2NSXA 1CGVA 1WPCA 4MPKA 4A3YA 2VVSA 4WKAA 2J62A 4WJXA 4UCFA 1WP6A 4UR9A 3RM4A 1JFHA 1X6LA 3AOFA 3ARTA 2WC4A 3ALFA 3OGRA 4AD3A 1FFRA 2CXGA 4W8BA 2VRKA 4HU8A 3WF0A 1J0IA 1LWJA 1MW3A 2BS9A 3WD1A 3W82A 4M1RA 1PX3A 4PMVA 2DSUA 1NOUA 2J75A 2UY4A 4U3AA 1UKPA 1R7OA 7A3HA 4HU0A 1GOWA 4F9DA 2FGLA 3N12A 3UCQA 2OSYA 1VFMA 3U5UA 2ZOXA 2VRQA 4Q7NA 3FAWA 4AD1A 1UD5A 2VOTA 3ARUA 4UTFA 2OLHA 2GK1B 2VL4A 3ARPA 1QHOA 5I23A 1OD0A 4EAMA 1KGXA 2ZIDA 4HMEA 1KBKA 7CGTA 5LA2A 5IHRA 3AICA 4DUXA 2D23A 3SUVA 3WMSA 3TA9A 3T0AA 1E4IA 1VEPA 5A6AA 3AS3A 4MJ2A 3ZJ8A 1D3CA 3GXDA 3ZR5A 1QNQA 4AZGA 4CD8A 1PZ3A 4W7VA 4W7WA 1M04A 2XSAA 2AOSA 1JZ7A 3EDKA 1CTNA 5DT5A 1U33A 1W1YA 4CCEA 1V0LA 3OZPA 3EDDA 3FHQA 3OLDA 3W25A 1ZU8A 4JKKA 2G41A 1B3XA 1LF1A 3GNPA 2OSXA 3AYRA 1E4NA 3CO4A 4QAWA 1HVQA 3AS0A 2ZUNA 4MTVA 1W2VA 3VIMA 5CGMA 1E6SM 3OBAA 3O9NA 2WNWA 4TX6A 4B9ZA 1MXGA 2OWXA 2WZIA 1WKYA 5CPQA 1CDGA 5FOOA 2VTFA 3MUY1 3QHMA 3QHOA 3MV11 1EQCA 4KRTA 2NT0A 4GQQA 4H8UA 3G6MA 3SCVA 2J7BA 2XM2A 1FA2A 1CECA 1JZ8A 1D2KA 4UQAA 2BVTA 2ZWZA 1ZB5A 4Q22A 4JAWA 2QPUA 3EMCA 2PB1A 2ZX6A 3CBWA 2EO7A 2ZUUA 2VX6A 2XFFA 3AQUA 3ZT6A 5A1AA 3MMWA 3SCRA 1V3MA 4TXEA 4R27A 1GVYA 1E6QM 4J28A 3I3BA 3L4XA 1CGUA 1PJ9A 2WCSA 1NH6A 3VIJA 3WEOA 1AQMA 2RGLA 2XVNA 1NOWA 4GI9A 3VIOA 2VT0A 3OZOA 3OGVA 4U5KA 1XGZA 3UERA 1JDCA 4YHGA 5BROA 2XGIA 3RDKA 4LYQA 2VO5A 2VCAA 2WHJA 4OJYA 4UZSA 1Q4NX 4J3WA 1BGGA 1B9ZA 2XPKA 5A6LA 2JIWA 1H0IA 3LPOA 3N17A 3UG3A 3L2LA 2GJPA 2GDUA 3BC9A 3WQ8A 3POHA 1ZL1A 3DYMA 5C71A 1E4LA 1B30A 1BYCA 1VF8A 1GJWA 4JZ5A 2FGZA 1CBGA 4D71A 1B90A 2XVGA 3AIQA 3L4ZA 2UY3A 2WWCA 1R86A 3GXIA 1B3VA 5JUVA 1TFVA 1QHZA 4HZ7A 3I3DA 3FN9A 1OB0A 4IUGA 1DTUA 2D2OA 3HJEA 2QV4A 5A94A 4H8HA 3S2CA 1PBGA 4JL1A 2G4FA 2V5DA 2E8ZA 5A2BA 1W3JA 4AZIA 2YBTA 1BG4A 1KR0A 4JFUA 1OSEA 2PI6A 1H2JA 3WH7A 2BXYA 3NCOA 2YA2A 5A8QA 1E0VA 1BQCA 4UQCA 1VBRA 4OBRA 2X1IA 1LL4A 5DMYA 4QFUA 3WENA 4D6DA 1NARA 5KZ6A 2VC9A 2G3JA 3GM8A 2GUYA 2ZWYA 1VBUA 1UR9A 3M07A 3N11A 1HX0A 4GKLA 1KQYA 1R8LA 1JYVA 1UH4A 3ARZA 3RIKA 2AMGA 1K9FA 3VUPA 2VR5A 3EDJA 1RH9A 2DGAA 1MFUA 3N15A 4GO8A 4WSKA 5FL1A 5FKYA 5FL0A 4MB5A 3VGFA 1M7XA 1ZBWA 2JF7A 3VIIA 1H5VA 3WL0A 3RCNA 1W3LA 3QOKA 2GDVA 4J3XA 2GVYA 3N04A 1ZS2A 2VNCA 5A6BA 1AQHA 3DYOA 3WD3A 2ZUSA 2VUYA 3IAQA 3WH9A 1NM9A 5E0FA 2J8GA 5HBFA 3N9KA 5D8WA 3VIKA 3WSUA 2VR4A 3NIYA 3VPLA 1SMAA 2ZE0A 1TE1A 4PMOA 4AYSA 1UR8A 1WZLA 2WKLA 2J47A 1JI2A 1JYXA 1KXQA 3L4TA 5D9NA 2PBGA 3ARRA 3L4VA 4CN1A 2YL5A 1OIMA 3AXXA 3SUWA 2XYLA 4PSRA 1V0MA 1V08A 5ABFB 4HA1A 4MB1A 5GNYA 5IXEA 1EDQA 4UFHA 1KGUA 2WMIB 3MSGA 1JDDA 2WANA 1OINA 1CYGA 4BS0A 6CGTA 3WQVA 1UR2A 5DO8A 1CXIA 1JNEA 1HL8A 1BHGA 1DWJM 1O7AA 3E1F1 5BXRA 3AIRA 1UA3A 4R5EA 3CHCA 2GJRA 5AC5A 1Y7VA 3WF3A 1H0GA 2C0HA 2J7GA 2QMKA 4XB3A 1DWIM 2DIEA 1TVNA 4RE2A 1UYQA 4M81A 3OIHA 3AI0A 1HJSA 4D6JA 2ZUMA 2VCCA 4P7OA 4AZCB 4MDPA 2J79A 1WNOA 1HP4A 1K9TA 1C8QA 4DWSD 3NSXA 3AHZA 2X0HA 3T0DA 4ACZB 6A3HA 1UWTA 4Z2JA 3OA5A 3CUHA 3ARXA 1O6IA 3AHTA 4UOJA 1ZBCA 3WUGA 1B3WA 3WNPA 1IZKA 1RD6A 1VFOA 2E9LA 3KL5A 2WYSA 5A2AA 2WMGA 4V27A 8CGTA 3K46A 1E3ZA 3CMGA 1U2YA 3EDFA 1E71M 2JALA 1ZBKA 3AZRA 4QLLA 4X0VA 4TX8A 1PX8A 3MUIA 3PZTA 1QVBA 3DHPA 3IJ9A 4IPLA 2FHCA 1KFWA 3CLWA 5BWFA 2O9OA 3SURA 5A6BD 2EPKX 4Z2LA 3PZVA 4W89A 3RJXA 3UG4A 2UWFA 3MUZ1 4JKMA 5JIPA 3AZTA 4W86A 2Z1SA 3SUSA 4PMDA 1W32A 1BAGA 1A47A 3SCSA 5JBFA 4RE3A 3CZJA 2WB5A 3F5JA 1Q6FA 2BNJA 2E9BA 4MADA 1Q6CA 3EMZA 1J0KA 1JDAA 1JGIA 1US2A 1GQKA 3WY1A 1YQ2A 1OD8A 4HOZA 1XH2A 4GZEA 2WPGA 2XGBA 1VEMA 1ODUA 2PBOA 4P7LA 2J74A 4ZE4A 4PSPA 1B1YA 2DSZA 1V3IA 4YN5A 2VZSA 3TONA 5HXMA 4UQ9A 1GOKA 2VRJA 1G1YA 4PMQA 1TCMA 3PTQA 1HNYA 4WK9A 1OIFA 5HNNA 4AWEA 3TTYA 1ODZA 3MANA 3SUUA 4TVCA 3AJ7A 1PPIA 4OIFA 2W66A 5I79A 4AZ7A 4YHEA 1V02E 5EFFA 5LA1A 1V0KA 1UKTA 1X6NA 3GH7A 3NSNA 3WD4A 1GQIA 2WC7A 3VINA 2VURA 2DT2A 5IDIA 3VD5A 3BAJA 5CPSA 3WELA 4PMRA 2EPMX 1FFQA 3O2LA 3W28A 2XIIA 5I6SA 1EA9C 2MANA 3ZO9A 5I0DA 2WW5A 2WWDA 1IT0A 1XD1A 3PZUA 2W61A 5DT7A 4JIEA 3W27A 1OT2A 2BHZA 1L8NA 4GI6A 1MW0A 1HXJA 4FK9A 5HDRA 2WLYA 4U33A 4XX6A 2XVPA 1V6XA 3QR3A 5KEZA 1OGBA 3ZT7A 1KB3A 1MW2A 4JCMA 1XD0A 3KL0A 1KXVA 4D72A 3PZIA 1J0HA 3DC0A 2XHYA 4PYSA 4HMDA 5BRQA 3IK2A 2DSWA 3BCFA 2OWWA 1UR1A 3ARVA 1VB9A 1CGXA 2EPOA 2YIHA 3AFBA 5FCZA 2ZX9A 2DH3A 3WMBA 1QPKA 1LJYA 2YDRA 3RM9A 1GOOA 3PN8A 2WC3A 4ZFMA 1OT1A 3VIPA 1DWGM 4QDMA 1WDSA 3ZMRA 4P8VA 2ZUVA 4LX4A 2DH2A 2E3ZA 2AAAA 1ECEA 4GZIA 4UQDA 3OG2A 1CLXA 5E0CA 3ZIZA 1BSIA 1FHDA 1JZ4A 3WQ5A 1DWHM 4UZUA 2RGMA 2QHAA 4TVDA 3AIEA 4PTWA 5FD0A 4CKQA 3SCTA 4KGLA 3VDAA 4QCEA 3BH4A 2J8FA 3UETA 3VU2A 1E3XA 1EO5A 3CIVA 1RPKA 2CNCA 2VZTA 3W24A 4MNMA 4MNLA 3CGTA 1J9YA 1MVYA 1JF5A 3PZNA 2JE8A 1GHRA 1W9PA 4UFMA 3ARSA 1UWRA 1WB0A 2JIEA 1HKJA 3QOMA 1CXLA 1B3ZA 2WHLA 3ZM8A 2V3GA 2DQXA 2WMKA 1FHLA 4UQBA 2XWEA 3PTKA 3BXWA 1UA7A 1MWOA 2GJXB 2QMJA 1LWHA 2EQDA 3ZSSA 5M5DA 3OLIA 4KH2A 1HT6A 2WVTA 3ARWA 3MU7A 3CUGA 1BYDA 5I77A 4EE9A 2GK1A 4XZBA 1H49A 3SCQA 4BQ3A 3F4VA 2J7EA 4EANA 4FLOA 1JD7A 1H09A 2VVNA 4H2CA 4JKLA 2Y5EA 3A3HA 1CPUA 3WD0A 3VMNA 1UKQA 4L4PA 1JIBA 1GQLA 5LA0A 3CUJA 1ITCA 1XCWA 4W85A 1H3GA 1K9DA 1W9VA 2BFGA 3EMQA 4MB3A 2WK2A 9CGTA 2V3EA 1C91A 1W1PA 2DDXA 4D6GA 1Q6DA 3SEPA 2DSVA 1EDGA 4GXPA 5CZKA 3GH5A 5BYWA 1EIBA 4J3SA 4NSBA 3PZOA 4PMXA 1K9EA 2BVDA 3AZSA 4AIEA 3VOCA 3VNZA 1M53A 4B16A 2YOCA 1BGAA 4X0NA 3GBEA 3WNOA 4M80A 4J7RA 4P8XA 1CIUA 1JFXA 1M03A 1XSKA 1EHNA 4UFIA 4KMQA 1WE5A 2CHNA 3VD9A 1XHGA 1JXKA 2WKGA 4FLQA 1CXFA 4MAZA 3SCOA 2EPLX 2XUCA 2F61A 2VX7A 1IV8A 1QNPA 2WAGA 4H04A 3FY1A 5ECUA 3EYPA 2Z1KA 1UR4A 2NW0A 7TAAA 2VJXA 1UQYA 5EMYA 1EXPA 4AZ6A 1PAMA 1GHSA 4U3CA 1NWRA 1AMYA 1TG7A 3OLGA 3VKKA 1J0JA 1NWTA 2WVVA 2CKSA 1W9DM 4AEFA 1QOXA 2BVYA 1HKIA 2ZX7A 3THCA 1KCKA 1W9UA 5JH8A 3JUGA 2CERA 2CPUA 2J7FA 3T08A 4PMUA 3WMCA 1RP9A 1BG9A 1C7TA 4ZE5A 2WVUA 1OWQA 2ZUTA 4DWSB 2VMFA 3B8SA 1EOKA 2QLYA 3N13A 5D8ZA 3K1DA 2W4XA 5D9PA 1S46A 2B31A 4AZBA 1P6WA 2ZXAA 1HJXA 5I24A 2XFYA 3WQ4A 3WDJA 4LXFA 3TP4A 2Y8VA 3DECA 3VD7A 3VGGA 3AHVA 5I2UA 1E43A 2J7CA 3CPUA 2PWHA 2UY5A 2CCRA 4E8DA 1WCGA 1GJUA 3SUTA 1XV8A 2VI0A 1FP8A 5A8NA 1QHPA 1GORA 4LYRA 1CGTA 2D22A 1C8XA 1LLOA 4PUDA 1GUVA 3BAIA 1OGGA 4PCTA 1RP8A 4X9YA 5EB8A 5A6KA 1XYZA 2ESCA 1OBAA 1VJSA 1G9HA 1C90A 1HJWA 1AVAA 4PTVA 3AIVA 4GO9A 1BYBA 5CSYA 3NDYA 4CU8A 3SCWA 4N42A 2Q8XA 4CUCA 1C7SA 1UQZA 3AISA 1HN1A 1UWUA 1MQQA 1LL7A 1UD2A 1BVNP 1KXTA 1UUQA 4Z2GA 2XFRA 1VENA 1XRVA 3VNYA 2VZOA 1HJUA 2W5FA 4BA0A 2XSBA 2IUZA 2J77A 4E2OA 2WM0A 3T2QA 1BFNA 3THDA 5A3HA 3BLPX 1UR0A 4CU6A 1UWQA 2DT1A 1E1FA 4V2XA 3WNMA 1CXKA 1TR1A 3ZJ6A 2YL9A 3RILA 1E6RA 1KR1A 1I1WA 4OZOA 5M3WA 4BQ4A 3GTNA 3WUFA 5E6ZA 3M6DA 3AMLA 4DUVA 4Z2HA 2YDSA 3MUAA 4CCDA 3WL1A 3CH9A 3BSHA 1I75A 1J0ZA 1LG2A 3WDIA 4N0RA 4OKDA 2ZX5A 3SIMA 1NWUA 3CHEA 1GPFA 2WZHA 4MDOA 2YA1A 4ML4A 4W5UA 2EEXA 2QPSA 5CLTA 1DWFM 2W67A 3T0BA 2ZXBA 3FAXA 1W91A 2G3MA 4MNKA 2IXUA 4MB4A 1TA3A 5HOSA 4CCCA 2YLAA 1GOIA 3WQWA 2W92A 1PEZA 1V6VA 1C3FA 1OCQA 4CVUA 4UOZA 1F4HA 2X05A 1E70M 2FHBA 3RO8A 4PUEA 1E0WA 2C8NA 1NP0A 5A95A 3CZLA 3WDQA 1HJQA 4A3HA 1BLIA 4PMYA 1MFVA 2WSPA 4MNJA 2X8RA 4AD5A 1UOKA 2XJ7A 3GBDA 4AD2A 4CD4A 4AD4A 2E9MA 3NUKA 1GW1A 4D6EA 2FDMA 1HKKA 3NYDA 3VIFA 4D6CA 1WDRA 5D9MA 4DUWA 3IANA 2WMJA 4A4AA 4W8AA 3TTOA 2Y8KA 3VDCA 1FH9A 4E8CA 2XTKA 1KGWA 2YDQA 4UQEA 5E9AA 1GQJA 1EQPA 3RMEA 3O6AA 2WBGA 2DIJA 2O9PA 3GDBA 4ACZA 3B9EA 4WSJA 1E5NA 2YA0A 2VQUA 1D7FA 3F5KA 4AZ5A 2VX4A 5CQ1A 3LPGA 1JYWA 3A47A 1Q6GA 1IZJA 4ZEPA 3PTMA 5BXPA 1V3HA 4WKHA 1F4AA 1US3A 3UESA 2CKRA 4M29A 1NWSA 2CEQA 3CZKA 4WLCA 1TMQA 4PCSA 4ZENA 3ALGA 3WFZA 1ISXA 4TOQA 3GNRA 1EHAA 2XIBA 1SYTA 3I3EA 1E1EA 2DPEA 4HPGA 2XM1A 1JZ5A 1CXEA 3AYSA 3KWXA 3KL3A 1GVIA 1V6WA 1FOBA 2EPNA 2IXVA 4UNIA 3VD4A 1FH8A 3VGEA 4M8UA 4PRWA 1J01A 1QI2A 1UKSA 4XZWA 4CD7A 1BVZA 1AQ0A 2CIPA 5ABGA 1ZBVA 3WDPP 5CPTA 1B0IA 2YBUA 3VD3A 5DF0A 2J78A 2Y2WA 3VM5A 5BCAA 2DT0A 1E15A 3UEQA 1G01A 5D9OA 5I5RA 4H41A 5BXTA 4GPNA 4PN2A 3L2MA 3D5HA 1HKMA 2OYLA 4J3VA 1DHKA 3WD2A 4AD0A 1KQZA 3LMYA 3WH5A 4NRSA 3WDRA 1K6AA 1Q6EA 4JFWA 1QI0A 4W88A 3CTTA 4JHOA 3GZAA 6TAAA 2CHOA 1SR0A 1MYRA 1Z32X 2CESA 3CHDA 1CNVA 2OYKA 3F5LA 2ZX8A 3LPFA 1N82A 1UD4A 4LQ1A 3WNKA 3WQ6A 4OBSA 4HP5A 2G8ZA 3VIHA 2TAAA 1WZMA 5AY7A 4P8WA 1CXHA 3WBAA 3WNNA 1DP0A 3L4YA 1XH1A 1B2YA 2V3FA 2CBVA 4URIA 4GQRA 1UD3A 3UG5A 4C7DA 2BV9A 2J7HA 3NDZA 5A8OA 3IJ7A 5DEZA 4EK7A 1MQRA 1CWYA 1EGZA 1J18A 4F66A 5DFAA 3A4AA 1XYFA 4PMNA 3VGHA 1W9XA 2BY3A 4HA4A 5I78A 3BGAA 5GPRA 3MSDA 4FMVA 3VM7A 1ITXA 4CD6A 1ESWA 3ZQ9A 4DM2A 1KWKA 4AIOA 2A3HA 1LG1A 4HA3A 4F8XA 4MAVA 5A8PA 4JL2A 2Y24A 4QP0A 2DT3A 4JHZA 5LYRA 3WF2A 3VMOA 2OYMA 1G0CA 4Y7EA 3HU7A 3CHFA 1EDTA 2BY2A 3GXFA 3TTQA 2J7DA 1W3KA 1V03A 1G94A 3ZT5A 4RL3A 4CN4A 2WCGA 3QHNA 3G6LA 5HPOA 3WKZA 4C7GA 4BQ2A 1M01A 1E4MM 3CZGA 1W2PA 3DHUA 4KGJA 2XVLA 1VAHA 2JEPA 2WMFA 1V3KA 1DWAM 4B3KA 1WDQA 5ABEA 2JFEX 3BMWA 1J0YA 4UFJA 2VX5A 1E6NA 3CUIA 1X1NA 1JD9A 3K8KA 1UD6A 4KRUA 1UKOA 2WXDM 4S3JA 2WSKA 1V3JA 4LYPA 4HOWA 1BF2A 4D1IA 3EBVA 1HP5A 4W84A 3SCNA 3BSGA 5CJ5A 1W1TA 1L0PA 4H8VA 2WHKA 2PC8A 4WIWA 3DYPA 1TZ7A 1JL8A 4F9JA 3W6LA 4GINA 1E6PA 3POCA 5A6MA 1U30A 3VIGA 5A69A 4HTYA 2GJXA 1ISVA 1CGYA 2E4TA 4OOZA 4KWUA 2D0HA 1CENA 1MQPA 1QI3A 2W63A 4YPJA 2QF8A 4ZXOA 5D4YA 3K8MA 4WKFA 3FW6A 4J3UA 4CN6A 1UZ4A 4DWSC 1E56A 2A3BA 4M56A 3NSMA 3WNLA 1MW1A 3WH8A 5CSUA 2JF6A 1JAEA 3GXMA 4AIUA 2F8QA 1GZJA 2D3NA 3APGA 3QGVA 5A8MA 3SCPA 3ARQA 3W29A 3OB8A 1VFFA 1E72M 2DSKA 3WEZA 3KEHA 2J4GA 1C92A 3CUFA 3U5YA 3A6OA 4JFVA 2WLZA 2BHUA 5ABHA 2BXZA 1FH7A 4GZJA 3WF1A 2VCBA 5CG0A 1QNRA 3AMCA 4LGXA 2WBKA 4DM1A 1W1VA 1FP9A 2WVVB 2PWFA 1UHVA 4D6FA 2D20A 3S6TA 4RE4A 3TTSA 1H1NA 1E9LA 4M82A 3IAPA 5I3DA 2YLLA 5E09A 4AZHA 3VDBA 4W5ZA 3BLKA 5CXPA 3UR8A 4ACYA 2FH8A 3K4DA 2O9TA 1SFSA 1GONA 5GQBA 1GOQA 4L4OA 1PZ2A 1R7AA 1UD8A 3MMDA 4IPNB 2HVMA 4P7NA 5EFDA 1V6UA 3ZR6A 1QI4A 1ZJAA 4AISA 1ISZA 1XCXA 1GCYA 1HL9A 2YL8A 2X09A 1C8YA 5C70A 4Z2KA 3WDHA 5AYIA 1E0XA 1QW9A 3J7HA 4GI8A 3HMCA 4P7RA 2D3LA 3ZSTA 2VZUA 4WF7A 2YKKA 3PZGA 3VX1A 3T09A 4U2YA 5IHSA 3HN3A 5AYBA 4TVUA 4HZ6A 1V0NA 1ISWA 1V02A 2WVSA 2BHYA 3BAYA 1QNOA 4MJ4A 5E6YA 1WO2A 1JXJA 2WHMA 3AMGA 4NF7A 4ATDA 4D6HA 3GNOA 5EBAA 4S3KA 3OGSA 3FHAA 3B9AA 4GIAA 3II1A 2D1ZA 3M7SA 4W93A 1VRXA 4K68A 4AXNA 2PWDA 3UR7A 1SMDA 2O9RA 4B3LA 3W37A 1WZAA 5JBDA 2D0GA 1DEDA 2V38A 2NT1A 2D0FA 5M03A 3VGBA 4ATWA 1V6YA 3BAKA 4UFLA 1XH0A 4DWSA 1KBBA 3NJ3A 5JBEA 3WIJA 4BZYA 4W7UA 3W4RA 4BQ5A 2PWEA 1JYNA 2ZXQA 1UH3A 4NI3A 5GNXA 2PWGA 1B31A 4D6IA 4AMCA 2A3AA 3VILA 3AXHA 2GFTA 4EKJA 4JCLA 3CMJA 1VIWA 1J10A 4CU7A 2D24A 5E70A 4V28A 1EO7A 3AROA 1GNXA 1E6ZA 4PMZA 2X2YA 4W8LA 3WH6A 3MMUA 4PTMA 5TD4A
chains in the Genus database with same CATH superfamily
1VPYA 1UZHA 1ZAIA 2PUZA 1PWMA 3MKKA 3GC4A 2XISA 3WFLA 4AEEA 2NQJA 4KRZA 1GYNA 2NLYA 1BRLB 1X39A 4DJED 4LAYA 1HJVA 2CLKA 3NTPA 3ANUA 4HMCA 4YVXA 4DJDA 2ZBTA 3OLEA 1QBAA 4R34A 3L4WA 4JFTA 1JULA 1B3OA 1H41A 1J5TA 1PDYA 1ZHAA 2PP1A 1J2BA 3UI4A 3AXIA 3QR0A 1DV7A 1CZ1A 4TTGA 1V7AA 4RW3A 5D32A 4HZ8A 1JG9A 1EOMA 1KXHA 4HYWA 2X2GA 3LCIA 5JIWA 3KBJA 5GJPA 1CGWA 3ZJ7A 3SCUA 3OYXA 3VGDA 5SWUA 1S1RA 1VYSX 4R85A 3AMKA 4K7YA 4MY8A 3FSTA 2VZVA 1UZ1A 3ZJKA 1CEOA 3I6CA 3STPA 3PBVA 2JEQA 2RDTA 1Q6HA 1VJZA 1ROUA 3WG6A 1BPLB 3AHXA 3KZSA 3LA4A 3TW9A 9RUBA 4L61A 2FZBA 3A4WA 3NQ2A 3WFAA 3OPSA 3AS1A 1A3XA 1M7JA 1JAKA 4S39A 3U4AA 3EDEA 4C6PA 4O19A 4EXAA 2OLAA 3FDGA 4RJEA 1JI1A 3I7QA 1LQ0A 2X1UA 4ICCX 1H4PA 4JPGA 1RAKA 3LHZA 1BKFA 4NZCA 3KRBA 3LRLA 1EBGA 3PJTA 4E4FA 3D0CA 2KI3A 2W79A 3KZPA 2A3CA 4LFYA 2IKJA 5CGTA 5C7HA 1W9BM 3CO8A 1DJZA 2CETA 3U9IA 2Y7FA 2XWDA 5FF0A 2CLEA 1E55A 3NL2A 1OYBA 3PBYA 4RDYA 4YTSA 1KRBC 1QTWA 8XIMA 5CLWA 3NQDA 1AZ2A 2E67A 4IISA 3MBDA 3GK0A 1DJHA 3OODA 2ZXDA 3RFWA 2R9RA 2ANUA 5F7UA 3KCEA 4Q8WA 3MUXA 4AC1X 3NNTA 5AC4A 3LEPA 3TNOA 1NP2A 2CYGA 4ODLA 4L9XA 3PBGA 3W53A 2O92A 3AHYA 2Y4SA 2OWCA 3L0GA 5AC6A 4R3UA 5CAHA 1EA0A 2NX1A 1XX1A 3G0UA 4B91A 1Q45A 3N2TA 4Q8NA 1VJIA 3QZEA 3GY1A 3W38A 1R87A 1UG6A 3DOPA 4DI9A 2BY1A 2DJXA 3ITCA 1WAWA 4PGLA 4CVWA 1WV2A 2ISSA 4O18A 1YDOA 4J9JA 2D73A 2CBUA 3I6RA 2RKXA 4E4PA 3LV5A 3VOJA 1WBJA 3FX4A 2QCDB 4M19A 5AVHA 1L6SA 5CEWA 4PA8A 1J11A 4ZBCA 1TV5A 1TWDA 5HINA 3U2EA 1Z41A 1UMLA 1EX1A 4P7QA 3FCPA 1PKNA 5AKQA 3WF4A 3TUUA 3F4CA 4AW7A 2PN0A 1J12A 2O55A 1NQ6A 3B03A 3QF0A 2F2HA 4H7ZA 4QLKA 3KAOA 4HPJA 1NDYA 3IJDA 2W91A 5BOFA 3QGAC 2C7FA 1KD0A 5BRPA 1GQNA 4U2ZA 4ZB5A 1UOZA 4O8AA 2EF9A 3URAA 4O50A 4YMZA 1Y8BA 2HNEA 1NF0A 3ARTA 3SRHA 4RNJA 3AUJA 1FFRA 2ABBA 3BUVA 2CXGA 4W8BA 1KRCC 1F2JA 3COTA 1LWJA 1O95A 3OZMA 1J8VA 4PMVA 2DSUA 2J75A 1R7OA 1SVDA 1Q6QA 4RNFA 2YCLB 1K8XA 4F9DA 3UCQA 1ICSA 4C91A 2R1PA 2ZOXA 2VOTA 1ONEA 3O5QA 2VL4A 4HYVA 3GNXA 3T0CA 5CZSA 4HMEA 2H9AA 1KBKA 5I3HA 3IGHX 5IHRA 1Z9AA 4EXBA 2POTA 3WMSA 4O8RA 3T0AA 1E4IA 4GY0A 3AS3A 4IOTA 3ZR5A 4S3DA 2AOSA 2ATSA 2JKEA 5DT5A 1W1YA 3R94A 4B5TA 3W25A 1ZU8A 1I0BA 1RVGA 1B3XA 3NQVA 4F48A 3PFRA 2OSXA 3TWBA 4QAWA 1RJRA 2ZUNA 5LHEA 5FF4A 3S1XA 2FZ8A 4GJ1A 4GYKA 5ENLA 2EJAA 4TX6A 1GVFA 4FI4A 3P60A 2WZIA 3GW3A 3VE7A 3QHMA 3WO8A 1J6YA 1YATA 4BEUA 1XRFA 3SCVA 2XM2A 3CQIA 1JZ8A 1TZ9A 3SRKA 2BVTA 4NXSA 4N9BA 2FPYA 1F07A 2J8TA 3IRSA 1NY1A 2QPUA 1SUXA 4WJ8A 4QS5A 2J27A 4F2UA 1R6WA 2PPGA 3MA8A 2RUQA 5T9BG 3DG6A 4EP8C 1PHWA 5LXXA 1W1A1 2P88A 2Y7DA 1Q85A 1LQAA 4R27A 3QM3A 1RA5A 4KEZA 2FJKA 2J9YA 1JRBA 1E9IA 3QH2A 2NVCA 3D47A 2WCSA 3WEOA 2RGLA 3ENLA 3APYA 5K9XA 2VT0A 3OZOA 1JPMA 3W2NA 4U5KA 3UERA 5BROA 3PP7A 3E96A 4O0QA 4I8DA 3E3HA 3B3DA 4LU0A 1Q4NX 4J3WA 5A6LA 3IIZA 2VGGA 2QJJA 3C86A 3KOFA 3R1ZA 2CXEA 1OG6A 3UG3A 2GJPA 5C0QA 3WQ8A 1ZL1A 1YNQA 3RF9A 1MMFA 4C1KA 4EIVA 1VF8A 1GJWA 4YIWA 4C6KA 5JXQA 4Z1DA 1B57A 4HU4A 4D71A 1I2OA 1B90A 2XVGA 4ZQMA 2UY3A 1T7LA 2WWCA 4NT0A 1B3VA 4X9SA 4EOUA 1UB3A 3FN9A 1DTUA 1UW9A 4D2JA 4O57A 1Q7ZA 1SJDA 3UQBA 4JL1A 2VEMA 2BVWA 4AZIA 1LZOA 1OSEA 1LLZA 1H2JA 3WH7A 1QR7A 2YA2A 3O06A 1E0VA 4UQCA 5DITA 3E5PA 1TPUA 3OBEA 3VKAA 1IIGA 2NQLA 5C7VA 3WENA 1UROA 4D6DA 3R13A 2A1YA 4R7WA 4KEVA 5EMJA 2QIWA 4DZ5A 4INFA 3GG7A 5HKGA 3HFTA 4C1LA 1H7RA 2OJPA 3LHWA 4RW5A 5CZJA 4JD4A 1HX0A 3KAGA 3UNTA 4RLIA 1KQYA 1R8LA 2GYIA 2ACSA 1UH4A 3LZ3A 3RIKA 1D8CA 1I9CB 5J5DA 5J04A 3VUPA 2HVOA 4P2VA 3TCZA 1FBAA 2TSYA 3N15A 2QULA 1F7BA 4F0RA 4NX5A 7TIMA 1M7XA 5HNRA 4POCA 1H5VA 3CB8A 4DI8A 3RCNA 3QOKA 2JK2A 1CB7B 2POZA 3W02A 2Q5AA 2GVYA 2PDJA 1IWAA 2FTPA 2J66A 3N04A 3O0KA 1JPHA 5A6BA 3DYOA 3WD3A 3ITVA 3MCNA 2VUYA 3IAQA 3PS7A 4L5ZA 5D8WA 4IT4A 3RX4A 3VIKA 3R2GA 4E5TA 3NEVA 4LVBA 4BHYA 2ZE0A 1TE1A 2WKLA 1VLIA 3L4TA 1KKRA 3O16A 4RZ6A 4CN1A 1DL3A 2YL5A 1OIMA 3AXXA 4QJ4B 3GU2A 2XYLA 4PSRA 1V0MA 1OX4A 3SBFA 5XIAA 3R89A 2CFFA 1FKRA 3MSGA 3MKVA 2VEPA 4HSNA 4GFSA 1JDDA 4MLJA 4LY4A 3EOUA 5DO8A 3LERA 4ZR8A 2VFGA 1DIEA 2YDAA 1A5BA 1O7AA 5BXRA 3AIRA 1UA3A 1FWHC 4IIEA 4JDBA 4GRSA 2GJRA 5AC5A 1Y7VA 4ONVA 3DERA 1H0GA 1BRLA 5CH9A 4HNVA 4RE2A 3LCHA 3TA6A 1H63A 3AI0A 4MWAA 2VCCA 4I7VA 3BOXA 1R3TA 1ZZMA 2HCVA 2Y89A 2PP3A 2Z7GA 2XP6A 3W2UA 3AU2A 1H50A 4J40A 3CGMA 2VFHA 4KCVA 3RMJA 3AHTA 4KFPA 3HGSA 3WUGA 3AAMA 4LAZA 4OHQA 3W87A 4EWND 4ZFCA 3VC6A 4AHOA 3KL5A 1KFEA 1U1HA 2WMGA 2YCJA 4O14A 3UXDA 3CMGA 4ZTYA 2ZZ4A 3EDFA 1E71M 3N2XA 1EUAA 4QLLA 3VNJA 2P4VA 3DHPA 5BWFA 3EWZA 1KFWA 2O9OA 1RV8A 2FZMA 5A6BD 3CIWA 4GXMA 1CB2A 3T55A 1EX5A 4JNMA 3LMZA 3LQGA 4W89A 5HT1A 1T40A 2UWFA 3YPIA 3AC0A 3SUSA 4PMDA 3B40A 2ZE3A 1VH7A 3C8FA 1PWLA 1W32A 3I68A 4IFKB 4O4VA 3MSRA 1JR1A 3UWVA 3FVMA 1MUWA 1E0UA 5JH2A 3WLPA 1C9DA 1OD8A 1YQ2A 4JQ4A 4GZEA 2F21A 3SADA 2O56A 2WPGA 2XGBA 3PG9A 4P7LA 3OHMB 5AHIA 4BWLC 5CKSA 4L64A 2GGGA 4V1XA 2VYOA 2VRJA 1G1YA 3GKFA 1ZJIA 2REQA 4FX6M 1TCMA 3QPZA 5D38A 3PTQA 3PK7A 2QUVA 2CHRA 4S2BA 3VFCA 3MANA 4I6VA 1XGEA 1D7JA 1PPIA 5C9RA 4F0SA 1GPWA 4ZSUA 1TJRA 1A0EA 2OKOA 2WQDA 4ZO9A 4ZOBA 3S2NA 1V02E 5EFFA 1V0KA 3IJ6A 4YYCA 1RK6A 4MWAD 4GCAA 3BMXA 3H2EA 3ID7A 2VURA 2QCGA 2DT2A 3SFWA 1V93A 3BAJA 4NP7A 4R9OA 1BKSA 5I6SA 3S2MA 1EA9C 1X7FA 2RUSA 4V33A 5I0DA 4FF7A 4QTGA 2WWDA 3SM0A 1EL3A 1DYSA 3KVKA 1L8NA 4YL2A 4TW8A 3LNMA 4CNSA 3OW1A 2XVPA 4LF1A 4DIPA 4MKSA 3QR3A 5KEZA 3WBXA 1XF0A 2QCDA 3GW0A 1MW2A 3TLLA 4D72A 1KXVA 1R47A 3I7RA 4IQLA 4A35A 1POJA 4PYSA 1BVWA 4LF2A 1QUMA 3BCFA 2OWWA 1UR1A 1TPH1 1G4EA 2I57A 2AQOA 3EA2A 1RR2A 4FS9A 4QSFA 4X60A 4EF9A 2DZUA 4JQAA 1QPKA 3RGTA 2YDRA 3G1RA 4NXKA 4L1XA 5GVJA 1DWGM 1DXIA 1V4YA 4P8VA 2GOUA 4JIQA 4LX4A 3H54A 1MSSA 1Q6UA 5E0CA 3PPGA 3ZIZA 1FHDA 4CQAA 4O12A 1JPKA 1JZ4A 3WQ5A 4UZUA 2QHAA 1I45A 4GQGA 4TVDA 1Q3NA 3LYEA 4PTWA 3M64A 3C2RA 4KGLA 1XIFA 1FWBC 3BH4A 2QKFA 3CIVA 2CNCA 1RBAA 4C5YA 2Q3RA 3RCMA 1QNVA 4RDVA 3PZNA 2JE8A 3U3HA 2OMAA 5CZTA 1IT8A 4OVXA 3HV9A 2WHLA 2DQXA 3TR2A 3W1AA 3PTKA 3SFKA 3B8IA 4XVEA 1UA7A 1MWOA 4JDYA 2QMJA 1LWHA 5C5YA 2EQDA 5TAOA 1JUEA 2ITKA 2RAGA 4XVDA 3LENA 2BZNA 2DQWA 4KH2A 4QNWA 1HT6A 4OV4A 2BLEA 3S1UA 7PTDA 3WQPA 2C14A 1QO2A 4DYKA 1OCNA 3E5BA 4BQ3A 3KWSA 3KCJA 3EXSA 4QT2A 1JD7A 3G22A 1U5HA 2PDCA 5F2IA 2V0TA 1VHCA 3QTGA 3M0VA 1U1UA 1RQEA 3HF3A 3UNDA 4RX0A 1ITCA 1XCWA 1K9DA 1W9VA 2P8BA 1W1PA 3BARA 1BXBA 1SSDA 2FB3A 3LSBA 1Q6DA 2GQ8A 3JU2A 3C2FA 1JCMP 1EDGA 1NU5A 5G2IA 3GH5A 4HCDA 1XG3A 1R3YA 4NSBA 2GQ3A 2QUMA 1O12A 3H2AA 2YOCA 5REQB 4F40A 2X40A 3UQIA 5LGXA 3EX1A 3GXPA 2V5BA 5FI8A 1KFBA 4M80A 3FA3A 1M03A 3A3XA 1H60A 4KMQA 2XGZA 2CHNA 1JXKA 3GE7A 3GNDA 1CXFA 1XBXA 8XIAA 2VX7A 2WAGA 4AYGA 1GGOA 4H04A 3FY1A 4IIFA 3RGCA 3W75A 1UR4A 2NW0A 1TJ2A 3CL7A 1BWKA 1UQYA 1LBFA 1W5PA 3G1YA 2Y8UA 1NWRA 2EULA 1J0JA 4UBPC 1TE6A 2OCZA 3NZ1A 1F73A 3NZGA 2BVYA 1KC7A 4G50A 3KTCA 1AL8A 1KCKA 5CPLA 2CERA 3ES8A 2CPUA 4LUTA 4GACA 3T08A 4PMUA 3C6CA 1JQXA 4ZE5A 2ZUTA 2VMFA 1DJXA 3N3TA 1ADSA 3SQSA 4AIBA 4IH3A 2CLPA 2A7PA 5D9PA 1JPIA 3CJPA 1Q63A 4AZBA 1P6WA 2ZXAA 1QPQA 3M0YA 1EEPA 4LXFA 2Y8VA 3RU6A 3HFYA 4UTIA 2PD9A 2PWHA 2UY5A 2PDNA 1ADDA 1WCGA 3O5OA 4C6IA 2VI0A 5A8NA 4D9PA 1TPB1 3H22A 5J8LA 3BJSA 3FSUA 1LLOA 3DFSA 3GVWA 1C8VA 3UZXA 3JXVA 1W5MA 5EB8A 3MY9A 1XYZA 2G0WA 2CZVA 4MUPA 4FB7A 4RXGA 4PTVA 4D8ZA 4G5DA 3GFZA 3DI1A 1NTHA 3N29A 1OFDA 4N42A 4E3VA 1XLKA 3UY7A 1R30A 4CUCA 1HN1A 1UWUA 3FJLA 1LL7A 1XJBA 5EPDA 4E2OA 4FOUA 3GFYA 1EJWC 1UR0A 5D2XA 3W7QA 4QX4A 4R33A 5HWMA 1GZGA 1UWQA 3WNMA 3VOFA 2D2GA 5DCBA 5DLCA 5I3IA 4QBXA 1ZAJA 4OZOA 3GTNA 3V7PA 4ZQOA 3AMLA 3S46A 4IPXA 3O05A 1KM4A 3BQ6A 4NJHA 3PULA 3WL1A 1WKDA 3BSHA 1J0ZA 1BTMA 1SO3A 4N0RA 1GPFA 4JTHA 4MDOA 4ML4A 1ZLPA 2QPSA 1F3XA 1W91A 3G2GA 3S0CA 3T44A 4MB4A 2YLAA 1JCLA 2CLHA 2W92A 3E0VA 4JN7A 1DQXA 3FKRA 1PEZA 3W1RA 1F4HA 2ZTJA 5HQEA 3F2DA 4A05A 1E70M 2FHBA 4KF1A 3LTYA 2OZ0A 4BKNA 2OOGA 4ORIA 2C8NA 2DVUA 4MVAA 3CZLA 4IHCA 3MHFA 1X7IA 4A3HA 4PMYA 4BJHA 1EYWA 3KFTA 5EMMA 4TW6A 1OG0A 3I7SA 4JY8A 1UOKA 4NJIA 1OCJA 4DNHA 3SY1A 4CD4A 4AD4A 2E9MA 3M0HA 3NYDA 2V82A 1J2WA 4D6CA 4M7SA 3IANA 3GHTA 4F4RA 4MYAA 3H9RB 2YDQA 3W70A 1VD6A 1XC4A 4BF5A 1UUOA 4DXVA 1E5NA 4QIUA 3QPYA 1J6OA 4H6KA 3F5KA 4AZ5A 2FB2A 3A47A 5KINA 1BF6A 5HWJA 1FD9A 4KETA 3VOGA 2WPBA 4XBSA 1US3A 1K8ZA 2CKRA 4H01A 1DJWA 4M29A 4XAZA 3I4KA 2E7FA 4NL1A 2CEQA 2VGIA 3CZKA 1S2TA 1EWEA 2VEKA 1ISXA 2BOFX 3GNRA 5E0KA 1EHAA 2Z00A 3NQFA 1SYTA 4HZMA 1DORA 2PDIA 4ZOEA 3H2MA 2NXGA 3WQOA 3TYDA 3E38A 4Y9NA 4LAOA 3GTFA 3KL3A 1Y65A 4Z1AA 3GVGA 1FOBA 4UNIA 1FH8A 2PDGA 3VGEA 3KADA 3DUGA 3H26A 4PH6A 1EYEA 1ML1A 1J01A 4ALDA 2V30A 3G8RA 1QI2A 1UKSA 2IQ0A 4XZWA 4CD7A 1YDYA 5ABGA 2QVNA 1NF7A 1YPIA 4EXQA 3EOOA 1B0IA 2J78A 4A8RA 4NNAA 1IXPA 2PDWA 5BCAA 4DELA 4ROPA 5I5RA 4DB7A 3N14A 2PDYA 2WOQA 5BXTA 4PN2A 2HE5A 2E6YA 3LN3A 1HKMA 1P0DA 3FGCB 3L0KA 3EPNA 3L67A 1KM5A 3WDRA 4W88A 4XZ9A 4EPBC 3GZAA 2CHOA 4L6HA 3UQAA 1MYRA 4TV6A 1J5SA 4MGGA 4OBSA 3LTSA 1A5MC 1FWFC 3IS4A 4ZODA 1WDWA 3MQTA 1WZMA 5AY7A 3CQKA 2E5BA 5BMXA 2GPTA 2ATMA 4ADTA 3MI6A 1B2YA 3UCCA 2V3FA 4URIA 4LAUA 1UD3A 4C7DA 4AHQA 3W1TA 4CCZA 2BV9A 2J7HA 3SRFA 4US5D 4GE8A 5MHBA 2BY3A 4XZHA 2Y61A 2VN1A 1T96A 2P76A 5I78A 3MSDA 1XS2A 4OE7A 2V63A 1UBPC 3EOLA 4DM2A 3CIXA 3IVUA 5BW6A 2A3HA 1LG1A 5G1MA 4NJGA 3T7VA 1AH3A 2XH4A 1QT1A 4B5SA 3WF2A 2C19A 3VMOA 4NNBA 1U5VA 3CHFA 3RITA 2BY2A 3GXFA 4KFOA 1LTDA 1W3KA 3OU8A 4OUIA 4CLMA 4IZGA 3G6LA 3BE7A 1M01A 3UF9A 3PRAA 3CZGA 1W2PA 3JRKA 3DFYA 4O16A 2XVLA 4PRTA 2WMFA 4ROQA 1WDQA 3HPXA 4Y9PA 1J0YA 4DO5A 1YKWA 2QYGA 1E6NA 1X1NA 2ZR4A 3IUIA 1Q6RA 1UD6A 4Y9AA 4QG9A 1AODA 1UKOA 1FWRA 1Z8AA 3FFSA 3PVFA 1BF2A 3TH6A 3EBVA 3TJXA 3W7LA 3FYPA 1FWCC 1PO9A 2WHKA 4QQUA 2WSRA 4WIWA 4DEFA 3DYPA 3IHZA 1TZ7A 4ZQCA 3IUDA 3UZ5A 3WLOA 5A6MA 3FOKA 4HTYA 3AU6A 4HPXA 2E4TA 2HJPA 3F4WA 1NMVA 3OYZA 4KWUA 2I9EA 3QXBA 1FRBA 1QI3A 3TMQA 1P5BA 1SO5A 3H70A 1W3TA 2X1TA 2OEMA 4JTEA 3RO6A 1JRCA 2OODA 4M56A 5CSUA 1JAEA 1E51A 4HBOA 4AIUA 3QGVA 3OVGA 1B6CA 3BURA 3QYQA 3WEZA 5DMLA 4JFVA 4RCXA 4Y8EA 3TN6A 2AGKA 2BHUA 2ZR6A 2BXZA 2DIKA 2VCBA 3AMCA 4LGXA 2I7GA 1W1VA 2WVVB 2D20A 3QW4B 1SGJA 3O5EA 1OFBA 4M82A 1R2RA 3G3DA 1HXVA 5I3DA 3VKDA 1KBLA 1XIBA 3LUTA 3VDBA 4W5ZA 3E12A 4NAFA 3BLKA 5CXPA 2FH8A 3K4DA 4G1NA 1GONA 3EWWA 1R7AA 1UD8A 1QPNA 3TXZA 3FA4A 4IPNB 4GI4A 4O54A 2H8ZA 2PBCA 2YL8A 4YNGA 2X09A 3WQCA 1H5YA 4Z2KA 3W7IA 2ETNA 3MT1A 1E0XA 5FF3A 3SDOA 2PODA 4IQ2A 2NXHA 2VZUA 2VWTA 4B92A 2YKKA 1OFAA 3MKCA 3PZGA 3VX1A 1TRIA 3T09A 4N7QA 1AUSL 1DIOA 1ISWA 2A7RA 3QQWA 1V02A 1TJPA 5C9ZA 2V81A 4I9AA 2WHMA 1KM1A 1Y5WA 3GG1A 1SU5A 4FALA 2R6OA 3DFHA 1FKXA 1IXQA 5EGRA 1EJRC 4S3KA 1AQFA 3FHAA 1AL7A 3B9AA 3MUCA 4GIAA 1GG1A 1O60A 4W93A 4HK5A 1AD1A 1H7WA 3CU2A 2O9RA 3LG3A 3M0JA 2PDBA 3NXFA 2ALDA 2D0FA 1K1DA 3VGBA 4KEMA 1WXJA 3KM8A 1YDNA 2EG7A 4BQ5A 3MC5A 2GVGA 1JYNA 1UH3A 4ERAA 3O5MA 1TB3A 2M1IA 3EB3A 1JUBA 3WZ0E 1DXFA 3TKFA 4EKJA 2OOFA 3N9RA 2XP9A 3TW6A 4LVDA 1XLJA 2XIJA 5E70A 4V28A 1IHIA 3V1HA 4B5UA 3C2VA 1E6ZA 3ABSA 1TWWA 4QE5A 4NUWA 3M0LA 2PZ0A 4PTMA 5J6EA 4CQBA 1A0CA 1X6UA 2UZ5A 2XP5A 2PDXA 2CBIA 3WN6A 2EJ1A 5A5WA 5G1YA 4JN8A 5HPCA 2E8YA 5KZMA 3C5QA 4DZ3A 2G96A 3EWYA 8A3HA 3T05A 3ABZA 4BF7A 5E9XA 1BYAA 4ZXLA 3GYCA 1QWKA 2VFEA 4CD5A 1GVSA 2YW4A 1BTCA 1TA3B 3ECQA 7REQA 2OO0A 2AQWA 1EIXA 5C8BB 1XIJA 2OSWA 2G3NA 1LBLA 1GOMA 2HVNA 1YPFA 3P2VA 2DW7A 1XIIA 4GK8A 1FHVA 1C93A 1DIKA 1T0OA 4OUEA 4JFSA 4HPHA 1QBBA 2A5HA 5ABFA 3N1AA 3IKGA 2ABAA 3WUEA 3DDMA 4C7FA 1B3YA 1S2CA 1E40A 2PTWA 4IPIA 4KKXA 2PRLA 2PPOA 1JPDX 4U4MA 4IFRA 3CUXA 4XQ6A 3IGUA 3V4BA 2FQIA 3S9ZA 5HWCA 4ZQNA 4LVGA 4FR1A 3TYAA 3HIJA 4IP5A 5FESA 2C13A 4GBUA 3TZFA 3I6TA 5IFPA 5A6SA 3T2OA 4D1JA 1MRQA 3C0SA 3QV6A 4DPPA 5F1UA 4PCNA 4C6LA 2WMHA 2X30A 2C18A 1W8SA 3R79A 3R8HA 1QOQA 1RQBA 1QCWA 5LKYA 2Z6JA 3LV6A 3HPFA 1NFBA 1TVLA 2INEA 3BMVA 3EX6A 4I9MA 4QITA 4I90A 3H55A 3ICJA 1U22A 3AIBA 3B9DA 1G5AA 1KWGA 1X8FA 1LROA 1KTNA 2E77A 2DZAA 1S5VA 2XG9A 1IWBA 4UXDA 4QAIA 1JF6A 1KM6A 2J6XA 3FNDA 4J5NA 4B2DA 2W62A 1XLLA 3PSWA 5TQLA 3G1SA 4PBGA 3W6YA 4XO7A 2A3LA 2ZA2A 4CQCA 4L7ZA 3Q2DA 2EHHA 3INPA 3GU0A 2ZKMX 5FAJA 3K4AA 3VE9A 4JHMA 1JCHB 2OX1A 3IJ8A 4DLMA 4NRRA 1JEZA 2CZDA 3RPMA 2XINA 3MYPA 2PF0A 3U7BA 4A3QA 1MXDA 4Z2IA 1FWTA 1WZKA 3UT0A 3ZOAA 4XD6A 3H12A 4QCFA 1PIFA 5LNSA 3PZQA 1WA3A 1KCLA 2OZTA 1VCVA 3IACA 3RJYA 2N87A 1EGVA 2HISA 4OOUA 1W3HA 4F79A 3SJNA 4LT9A 1TVPA 1CLVA 2GUUA 1E73M 1VPQA 1GEHA 5U4NA 3TN3A 1I2PA 4LPCA 1S5MA 3WLLA 4B5NA 4MYXA 3R25A 3TROA 3FXYA 2CZ5A 2IPJA 4PTXA 4MY1A 1V3LA 3CWOX 1W8GA 1OGSA 4GUFA 4W9OA 1E44A 4DF0A 4DQWA 3KAHA 4TUFA 3IPWA 4LS0A 4AEOA 1QZ2A 3Q45A 1TZZA 5FF2A 2PURA 2WZEA 3W81A 5EU9A 3NFUA 1N7KA 2QUNA 3MV01 2P10A 4QT3A 3AIUA 3K8LA 3W74A 1QI5A 5A6JA 1ZP3A 3S42A 4CNUA 3WK3A 3QC0A 1XLEA 4J3TA 3HQOA 3FGCA 3ZLGA 4MPKA 4ILSA 4EAYA 1ALDA 4RNHA 1TCOC 4WKAA 4IXXA 2V69A 4UR9A 3RM4A 4E2VA 1HKWA 2HBVA 1YE6A 4AD3A 3LBOA 3W1UA 2VRKA 2J88A 1J0IA 2TYSA 4PBFA 4C60A 3WD1A 3G1HA 3RX2A 1ZCNA 2Z1BA 1NOUA 5CC3A 4U3AA 5DELA 1UKPA 3NTYA 7A3HA 3GU1A 4HU0A 5F2LA 3UWQA 3RFAA 2OSYA 5FJOA 3FAWA 4AD1A 3ARUA 4UTFA 2A85A 1QHOA 4KERA 5I23A 1H1YA 2ZIDA 2C79A 1FWAC 4Y96A 2QCCA 3U6WA 3AICA 3EEGA 3M0MA 4M6QA 4DUXA 1S1PA 2ZADA 4JR5A 2AL2B 3SUVA 3VUSA 3ZJ8A 3GFXA 1DVJA 1D3CA 3HA1A 1OY0A 3WQDA 1QNQA 4AUBA 4W7WA 3F2CA 2XSAA 3DKJA 3CAQA 1L6FA 4Y9MA 3TEVA 3GD6A 1L9WA 3W2KA 5DBTA 1OCBA 2G41A 2ZZ5A 3MSYA 4YWSA 3GNPA 3AYRA 1E4NA 1OQFA 5BRBA 1IXNA 4GUIA 5D75A 1H7NA 4GKTA 1F8MA 1O5QA 2D69A 5CGMA 4IIDA 1ADOA 3CWHA 4DBWA 3O9NA 1QPRA 2WNWA 4ZOAA 2ZVIA 3NM1A 4TNSA 3G8EA 1FKDA 1WKYA 4GG9A 5FOOA 3QHOA 3GHUA 3MV11 4KRTA 1P0KA 4H8UA 2B7PA 3G6MA 4HJFA 1D2KA 1QU4A 3GIQA 3R0UA 2Q09A 3A24A 1PVNA 3SECA 4IL2A 4MSSA 3CBWA 2MF9A 1J6PA 1RK5A 3AQUA 4YVVA 5A1AA 2FYMA 1I6NA 2QZRA 1W1IE 4LC6A 1CGUA 1PJ9A 1XUUA 4HIBA 1AQMA 1NOWA 2XVNA 1RUSA 2ZZ1A 4Q8UA 3BCJA 5BU9A 4JGDA 3C0QA 4GHRA 3RDKA 4LYQA 1VP5A 2G4JA 3U4FA 1TPDA 3APTA 4KW2A 1ZCOA 4UZSA 1Z3NA 2E28A 1TTPA 3N17A 4ZCWA 3L2LA 5EYWA 1YYAA 3E0IA 3EKGA 5LNUA 4YTRA 3WLTA 2QCEA 2F38A 1YTEA 2FGZA 4NX0A 1RBLA 4LUYA 5K3VA 3H4GA 3W1XA 1R86A 3GXIA 5JUVA 1J4EA 1PE1A 3EOSA 6XIAA 1O68A 3WQFA 2D2OA 3HJEA 2QV4A 2AQVA 5A94A 2G4FA 1L2QA 3STFA 4X61A 3PF3A 1W3JA 2YBTA 4HPNA 4K38A 1BQCA 4AVNA 3EX4A 1VBRA 3M9YA 4OBRA 4LB3A 4XKYB 4TV5A 4QFUA 3TYCA 3AWOA 3S2JA 3CUZA 1S2UA 2C3ZA 4LOCA 4AU0A 4H19A 5KZ6A 4AF0B 1VQTA 1XFBA 3GM8A 3R0KA 3R6IA 2QJHA 1TV8A 3DENA 1EXBA 2I9UA 3UZYA 2G50A 1QRQA 1FWIC 3N11A 4GKLA 4NJKA 5CJNA 1JYVA 1ZGDA 3ARZA 4O1BA 2Z4GA 1K9FA 3ZR4A 2VR5A 4G2PA 3O6YX 2F6KA 3STGA 4L1GA 4MB5A 3IIOA 4FSAA 1S38A 3PJXA 2JF7A 1XXXA 3WL0A 1P6BA 3TX9A 3BGGA 3B04A 3HGOA 1W17A 5HUAA 3NPWA 7ODCA 2RDUA 1C9HA 1WXYA 3H53A 1AQHA 1MXSA 4WZHA 4LBRA 2ZUSA 4O0KA 2WJZA 3Q58A 4O53A 5E0FA 3VPLA 1SMAA 1FWSA 4AYSA 3GDRA 1I8JA 2OELA 2H6RA 5DXYA 3T8QA 2PDMA 3ARRA 3GIYA 3L4VA 4L9ZA 3SUWA 4IG2A 3URBA 2UZ9A 5GNYA 1NAL1 3NA8A 3KP0A 4UFHA 1H7OA 1KGUA 3ZFHA 2WSYA 2W0UA 1CYGA 4BS0A 1GG0A 1UR2A 1VFHA 1TV3A 1VIZA 2E25A 4R5EA 1SFLA 3VCNA 3ES7A 2DUXA 1ZTVA 4GX8A 2V9DA 3WF3A 3Q94A 2PTDA 2YCEA 3NQ8A 4F3HA 2M2AA 1UASA 2X16A 2DIEA 4LS1A 4UNKA 1T99A 1TVNA 5D09A 1LWIA 3OIHA 3NPUA 1HJSA 2ZUMA 4NZ1A 2QEZA 3URNA 1IGWA 1TTQA 3M0KA 4MDPA 3WMLA 1XQKA 1WNOA 1MEIA 1K9TA 5KSWA 3R11A 4OQVA 4CEUC 3NSXA 2OEJA 2ZC1A 3B0XA 2RJHA 4NZ4A 2QJGA 3KACA 4ACZB 6A3HA 3CV7A 4Z2JA 3CUHA 3TNBA 3DH7A 1IZKA 1VFOA 1KRAC 1RJPA 5A2AA 3MPGA 1A5OC 8CGTA 3K46A 4AAJA 4X0VA 1QVBA 4HSOA 3GAKA 3IJ9A 3LS9A 2FHCA 3EWCA 4LBSA 4OWGA 4KCUA 3SURA 2EPKX 4HNCA 2HE8A 5EMKA 3RCYA 1R0MA 2Q6ZA 3PZVA 1F6PA 4PUWA 3RJXA 4Y6GA 4ZQPA 3N19B 3SN0A 3MUZ1 4JKMA 3TLQA 5JIPA 2ZRWA 5FEZA 4QS6A 2IW0A 2TRSA 6XIMA 5I3GA 1LLWA 4O10A 4GIVA 1BAGA 2Q02A 3SCSA 3MDYB 3M5XA 4RE3A 3V5FA 3CZJA 3F5JA 2BNJA 1F61A 5I02A 2IPWA 4XG1A 1Q6CA 3EMZA 1JGIA 1JDAA 4KWVA 5D37A 1XH2A 4QM1A 1VEMA 2PBOA 1S3HA 1B1YA 1X8CA 4H83A 4CNTA 2QNEA 3QLLA 3QLDA 4Q32A 2ZQVA 3UJSA 5HMFA 1OIFA 4GNJA 1THFD 3PA7A 3AJ7A 2NUYA 4FIRA 4OIFA 2W66A 1A5UA 2Z28A 4FZIA 5IDZA 1F40A 2J13A 2VWSA 2Y6ZA 4Z1YA 2ZZ6A 1KNWA 3GH7A 2VOMA 3NPVA 1NDWA 2YX0A 3STCA 3B0YA 3E6EA 3HM7A 4NZFA 2XIIA 5LHFA 1XR2A 1QASA 4HJWA 1XW8A 3KDOA 4J4KA 3TJIA 1P7TB 3QEZA 1A53A 3EWXA 3SR7A 1LYXA 2BHZA 2DY3A 1KLYA 3KLLA 4Z0JA 2E5DA 5D30A 4FK9A 3LGDA 5HDRA 1EZ2A 2X1SA 1K7FA 4QXIA 3AO0A 3CTLA 1V6XA 1FKTA 1R9XA 3IIVA 2YGYA 5G2WA 3TJLA 3DC0A 2DZWA 3NVDA 2HZGA 2IKGA 4HA0A 1M1BA 4RE0A 3UP8A 3XINA 4F2BA 3W7KA 5FCZA 4J35A 1WXZA 3VNLA 5G4HC 2ZX9A 3AWNA 3WMBA 4ZFMA 2WC3A 4H9TA 3T0TA 2OXNA 2QUTA 1OT1A 3BZJA 4QDMA 1NMWA 5HATA 2AAAA 1ECEA 5KMYA 4UQDA 3EX2A 3OG2A 4WOQA 2VEGA 2PTXA 3C2YA 1QPOA 4G56A 5B80A 3R0DA 1P5QA 4PE8A 3AIEA 3T42A 4BWLA 3EEZA 1N8WA 3W7OA 5JQ9A 1RPKA 1FDJA 5D33A 1M7OA 4Y8FA 4MNMA 4ICNA 3BICA 5LIXX 5F4WA 1FWGC 1AFSA 3V1PA 1GHRA 1W9PA 4UFMA 1KCZA 4QSHA 4M6UA 1YIXA 1VYRA 4TMCA 4DUOA 1WB0A 1B3ZA 3ZM8A 2INZA 1FHLA 4UQBA 3PC0A 4E0CA 4TU1A 4WGHA 4EPEC 3W72A 4RZ5A 3TWAA 4J4NA 2W27A 1K3UA 3MU7A 1BYDA 2EG6A 3M5YA 4QHRA 2BWGA 5CSRA 4MF4A 1H49A 5HAOA 3SCQA 1EP2A 5EMUA 2J7EA 2MLYA 4OV9A 3H4WA 3VNDA 1Q13A 3A5FA 4MFDA 2AL2A 5I7GA 1EP1A 1CPUA 3WD0A 3RPDA 2VP8A 4B5WA 5LA0A 1ELSA 2RUCA 4W85A 2BFGA 2OB3A 4UDMA 2OG9A 2RDXA 5HWBA 1C91A 4HVXA 1FKIA 1GRJA 2RURA 2YCKX 3OOQA 3SEPA 2DSVA 2Y7EA 5TF0A 5CZKA 5F4XA 4J3SA 2ACQA 2BVDA 3VOCA 2AL1A 1M53A 2VD8A 3DXIA 3V36A 3AJXA 3W23A 2VEIA 1CI1A 1B5TA 1R3QA 2YFNA 4O28A 2CLIA 4YLWA 3VKBA 3WNOA 1DJYA 2F2DA 4DBDA 4P8XA 3P61A 1AW1A 3HGJA 3R10A 3W83A 2WKGA 4FLQA 2FTYA 4MAZA 2EPLX 3SSJA 2F61A 1IV8A 3MZNA 1VBHA 5K4ZA 4JNYA 1S2WA 2Z1KA 5I3KA 1ZAHA 4YVPA 4HTBA 4CEXC 3PM6A 3QY6A 1EXPA 2VXNA 4AZ6A 3T40A 4JQ3A 5KZEA 4DO4A 4MZYA 3IGXA 4MJMA 1TG7A 4LUSA 3QQ1A 3UG8A 5C54A 1W9DM 4AEFA 1QOXA 5H2ZA 1HKIA 4JYFA 2FJUB 3JUGA 4C1NB 1AG1O 2J7FA 3G77A 1PB0A 2WZTA 2ALRA 2QCLA 1SSGA 3BK0A 4NAEA 1R3WA 1FJDA 5D8ZA 1E0TA 1LT7A 1BKHA 4KQNA 1NELA 1QATA 3B97A 2BASA 2OPJA 1OFEA 3KBMA 3DHDA 3PTDA 1NVMA 2J7CA 1GKQA 3O5IA 2J24A 2CCRA 4O0ZA 5DCEA 4E8DA 1XV8A 1DBTA 1T8XA 2L5HA 3GRIA 1GORA 4GVFA 3FLUA 2D22A 2OVLA 3GNNA 3BAIA 1OGGA 1RCOB 3HQPA 5T26A 4X9YA 4JBRA 3SI9A 4FHAA 4C02B 3B0UX 1OBAA 3QMSA 3ZLHA 5CSYA 4YJ5A 5IBXC 3OBKA 4HHPA 1T5AA 4GXWA 3FEQA 3SCWA 2R82A 3UPBA 4CNPA 4ICMA 4AVOA 3GG8A 3BDKA 3LGEA 1MQQA 3VOHA 2QV5A 1UD2A 4ZS6A 4Z2GA 3HPSA 1MNZA 2XFRA 1VENA 1TTJA 1HJUA 2XSBA 3GTYX 3BJTA 2YR1A 3O5FA 2X7WA 3E02A 4CU6A 5CBBA 2B5UB 1E1FA 4V2XA 1R38A 4DAIA 5E5CA 5CAKA 4G7EA 3P7YA 3SGGA 3RILA 1E6RA 4LY8A 4LUJA 1N2VA 2DZXA 3W1LA 2NQ5A 4MWAB 3WUFA 1EKOA 3UWEA 2D2HA 3BPWA 1ZPTA 3MI2A 2G97A 1TTIA 3R4IA 1EC7A 1K7EA 4AXKA 4OTKA 4XD4A 4NHVA 4GJJA 3QMRA 5LXEA 5FF7A 1KM2A 3F1QA 2F2KA 4N9DA 2EEXA 5BOEA 1RCXB 2QJIA 1DWFM 1FX6A 1VR6A 4L4LA 3S1WA 1FKFA 2DVXA 4H6RA 3KP1A 1Q6OA 2IXUA 4CCCA 1W56A 1GVOA 2MUCA 3BG3A 3E9AA 4UOZA 1IWPA 3QQ0A 1Q65A 1E0WA 1NP0A 5A95A 3E0LA 1BLIA 4PUJA 2TODA 1A80A 2X8RA 3W73A 1XLAA 3WJZA 3RPTA 5DY2A 2XJ7A 2ZQ0A 2XZ7A 4AD2A 3NUKA 3U48A 4D6EA 5AYXA 1CX9A 4DRHA 3MP3A 3VIFA 2CLOA 3DX5A 4F0HA 1RBOB 2EGZA 2Y8KA 3KCLA 3VDCA 1FH9A 4E8CA 2XTKA 3THAA 1R9YA 1M5YA 4UQEA 5E9AA 1EQPA 1IR2A 2WBGA 2DIJA 4IQDA 1RA0A 4ACZA 1OFQA 2Y63A 1AD4A 1ENUA 9XIAA 2REQB 2YA0A 3CHVA 3PBMA 3DCPA 1D7FA 4HHHA 2VX4A 4EWJA 1IZJA 2BDQA 1ONWA 1FCUA 4H9MA 3PTMA 5BXPA 3V3WA 4DHGA 1M3UA 2YB1A 4OBTA 1F4AA 4MMWA 3DAQA 3FIGA 3UESA 1NDZA 1NWSA 4PUUA 1VCGA 4Z17A 4ZA0A 4WLCA 2QVHA 3LM3A 1XINA 1BL4A 3ALGA 4W9QA 5H91A 3W01A 2WKJA 3ZWSA 1E1EA 5FAGA 3ZXWA 1RALA 2CU0A 3KWXA 2CLFA 1GVIA 3GDLA 1V6WA 3S6OA 4QJ5B 1Q7QA 3KBWA 1F5ZA 1YXCA 3TCSA 4LAMA 4RK8A 2XH0A 3N2BA 3HGRA 3PB0A 3G0SA 3WDPP 5CPTA 5LNWA 4TO8A 2Y2WA 5F4SA 2A0NA 3TDBA 3AALA 2DT0A 1E15A 3UEQA 5D9OA 2E09A 3CAWA 4C6QA 3D5HA 2D2JA 1JCNA 4J3VA 5EMLA 2MPHA 1JNTA 1NQKA 1RCQA 1YTDA 2C15A 3KTXA 2E6DA 4C6MA 2C6QA 4NRSA 3O7UA 4KWOA 2FVKA 6TAAA 3P67A 2FFCA 3PJUA 1Z32X 2CESA 3CHDA 1CNVA 2OYKA 1N82A 4H7CA 3HBLA 1OK6A 2P0IA 1XPGA 1IT7A 2G8ZA 3NQAA 3VIHA 5EKYA 1EBHA 4QDPA 3UBPC 2YFOA 1CXHA 3WBAA 2NUWA 1DE5A 3MJMA 5FJTA 1JVNA 2LJ4A 3TFCA 4GQRA 1P7TA 4S1FA 3NZRA 1VCFA 1ZFJA 5DEZA 5A8OA 1P0EA 3O63A 1CWYA 3V0UA 1FXQA 4Q4PA 4BI6A 3LM7A 4YCOA 1UZDA 4HA4A 3G1DA 4V1YA 5HW6A 1N8IA 5AC8A 5GPRA 1JJKA 3JYJA 2XIQA 3KXQA 4U10A 1AZ1A 4AIOA 3QC3A 2G95A 4X2RA 4HA3A 4MAVA 5A8PA 1XP3A 3MDUA 5JMUA 3P62A 4JHZA 4LEQA 5LYRA 2XN2A 6PTDA 2V5LA 4PB4A 1YLVA 5G2HA 5HMSA 1G0CA 4Y7EA 3TTQA 2J7DA 1DJNA 1OEPA 1OJXA 5HR7A 3ZT5A 4RL3A 4CN4A 4H4IA 4IT6A 2EAWA 2TPSA 1OC7A 3M6YA 4BQ2A 3PG8A 2P5NA 4W9TA 4KGJA 1VAHA 1YX1A 1HKVA 3GS6A 1DWAM 4MKVA 1AJ0A 2JFEX 3BMWA 4WQ6A 4ZO6A 1TIWA 4UFJA 2VX5A 3CUIA 1EQ3A 4Q4SA 4Q8QA 3KABA 3GG0A 1JD9A 4Y90A 1FWJC 4KRUA 1OK4A 1XIEA 5DX7A 1P6CA 4JX4A 1GWJA 2WSKA 3WLMA 2YB4A 4D1IA 4HOWA 4NZJA 1FKBA 3UYIA 1POKA 3W9ZA 4IT1A 1DOSA 2BMBA 4FN2A 4F0MA 1W1TA 3P93A 1G6CA 3WH0A 4B90A 4GINA 5HULA 1E6PA 3VAWA 5A69A 3O5RA 2FGBA 1ISVA 1CGYA 3O0FA 3TN4A 4DH0A 2D0HA 1CENA 2W63A 1GJPA 5D2YA 4ZXOA 4WKFA 1MZHA 3FW6A 1ITQA 3QKEA 4J3UA 3KBSA 3PPHA 1UZ4A 1GKPA 4LVFA 3NSMA 3CYVA 1R46A 2PGFA 3NURA 3RLVA 1N55A 1A3WA 3ARQA 3W29A 2OGYA 3FJ4A 1TQJA 1VFFA 4MFEA 1H61A 3TW7A 3P8IA 2OT0A 3KEHA 2J4GA 5G4EA 2VC5A 2GZXA 3URQA 1S5TA 2WLZA 2BODX 1NEYA 3WLSA 1FH7A 5K2ZA 5CC7A 4I5RA 1QNRA 5CC6A 3QBUA 1GKRA 2F6UA 3HG3A 1S5NA 3TTSA 1DJGA 1FQ0A 3O3RA 3IAPA 4ZOCA 3W00A 3FYYA 2VUNA 4QGCA 5E09A 4DJFC 4LUTB 4AZHA 2FPVA 4FAPA 3N6JA 2O9TA 4L4OA 1PZ2A 1UC5A 3WBWA 3MMDA 3S2LA 3BG9A 2OFJA 2HVMA 3G1AA 1V6UA 3ZR6A 1KM0A 3DESA 4AISA 1ISZA 4AX7A 1F05A 3RUBL 4PMJA 2Y5SA 1WQ5A 1C8YA 4NQ1A 3BLEA 1W5OA 3GDMA 4GI8A 3ZSTA 3B06A 2V5KA 2PTYA 4H6QA 4GWEA 1YW1A 3LOTA 3EGJA 4HZ6A 1L6WA 2WVSA 2BHYA 3RAOA 5E6YA 4NF7A 4D6HA 1PKYA 3WLKX 2ACRA 3OGSA 1V51A 2VENA 1SJAA 1IEQA 3C3UA 3O6CA 1LQ2A 3M7SA 3ODKA 2CW6A 5HNUA 1XI3A 1TV2A 3UR7A 3W37A 1WZAA 4C1NA 3KVMA 2V38A 2NT1A 3W1MA 2YZRA 3TC5A 4ATWA 2HWGA 3BAKA 4UFLA 4AFYA 1RD5A 3NJ3A 4ERGA 3WIJA 4E6MA 2Z25A 4W7UA 4IP7A 4MJZA 3CAKA 1PYMA 3KOWA 3S5ZA 5GNXA 4ODOA 4XTIA 1B31A 3DN5A 1IEIA 3VILA 3AXHA 1WBHA 3ZZ1A 1VIWA 4CU7A 2D24A 4H3DA 5FSDC 1PCKA 1GNXA 1F76A 4KCTA 1XLFA 3DBNA 4W8LA 1A7XA 5TD4A 4YCPA 1XLGA 1YXDA 3UXKA 1FCQA 1PS9A 2QGYA 5IFTA 4LC8A 4HSHA 1UUMA 4QR6A 4B9YA 1XSIA 1TPFA 2G3IA 4DF2A 4X3ZA 1C9WA 5HQLA 3S9IA 2C1GA 3L5LA 3WJYA 2QCHA 2OQLA 4WY0A 4EPDC 3LY0A 4QQ3A 1NDVA 3GZ3A 5T91A 2VCDA 4H7VA 3TDFA 2FMNA 3MO4A 1R85A 1Q7MA 3H6OA 1UWIA 4UFKA 3TSDA 3M46A 3E2RA 2UBPC 2IF4A 3M0IA 1WOBA 3S9YA 3U57A 1TPWA 3CZEA 2VR2A 2ZZ7A 1YHTA 4XWUA 2UY2A 3ZWTA 4P8UA 4NYYA 3KS5A 2FTWA 1LOSA 2PDQA 3QTPA 3N18A 2HXTA 2QCFA 4PODA 1KLZA 2WMIA 1UH2A 4HN8A 2E40A 3QZ6A 5FJIA 1ONXA 4MLRA 4WDTA 5C55A 3L9CA 3QW3A 2A21A 4FLRA 5M17A 4GQ0A 3VX0A 2DORA 2IKHA 3OQ8A 4GA8A 1XC6A 4P5UA 1WDPA 1G4TA 4MOZA 3NYZA 3T9PA 2ZUWA 2CITA 4AZCA 4ATLA 3EIPA 1I1XA 4NG3A 3H4XA 4M24A 1XM3A 4BCEA 5A2CA 2QAPA 1A3HA 1X98A 2GSJA 2Q3OA 3B9NA 2YSWA 1EGMA 3PWAA 3MS8A 1IR1A 1NOFA 2R1NA 3PY2A 4FF5A 5HUPA 2ZQTA 2WJEA 2OO6A 4L65A 3TSBA 1HIZA 3CEUA 3D3AA 3SN1A 3CV2A 2X0YA 3O07A 5HNTA 4JTUA 4YWIA 5HJYA 1V6TA 2V5CA 4TX0A 3A4XA 3AMDA 3R58A 4U31A 1AH0A 3PZ9A 1ECQA 1LL6A 1MEHA 2XSXA 5FIPA 1TX2A 2HMCA 2HSAA 1JNDA 5KTLA 3S5YA 3LUOA 4GY7A 4FXRA 2EBNA 1HUVA 3U2CA 3AS2A 1R3VA 3O6DA 3SZ8A 3ARYA 6ALDA 1M5WA 3QYSA 4DBEA 3FS2A 1UWSA 4ADUA 3RM8A 3RNDA 3UZWA 5TNVA 3NQ6A 4HK7A 1QNSA 4RNIA 3ZS4A 2FKPA 1EJUC 2OR2A 4DYJA 3PZMA 3GH4A 4HOXA 2O4QA 1TV7A 5A6TC 4EACA 1VGAA 2P0OA 3MDWA 1E6XM 3OIXA 3JS3A 4UTHA 3T2PA 2VQTA 3C2OA 2CC0A 4GVHA 4RZBA 3HG4A 1H7PA 2VC7A 3BLOA 3KTSA 4XV0A 2JKAA 4REQA 2PEVA 4JTFA 2ZICA 2E6FA 2OT1A 2FZNA 3OVRA 3KX6A 5DIVA 3AIWA 2CZEA 1CT5A 2DZBA 4ML9A 4MIMA 4K37A 3NPXA 3VTRA 3AYTA 4ZZ9A 1RLDA 4FXSA 3L4UA 4PL1A 3UVIA 1AW2A 3DG3A 3GTXA 3E0WA 4RUBA 4PEEA 3N3MA 3MTWA 3CZ8A 2PLJA 2ZRVA 3RX3A 4GC3A 4AY1A 1Z69A 1CLKA 3KVLA 2NSXA 3QV8A 2VEFA 1WPCA 4A3YA 4EX4A 3LHYA 4JYSA 2J62A 3P8JA 4WJXA 2ZDSA 1Q2SA 4DWDA 1WP6A 2OQYA 4YU1A 3AOFA 2WC4A 3SSZA 3ALFA 2R94A 1IEWA 3NO5A 3R5EA 1A5LC 5GJNA 4K3ZA 1I60A 2GQ9A 3WF0A 3W7HA 2PSNA 3N9SA 1T11A 2UY4A 3OOBA 3SGZA 3H8AA 1GOWA 4NU7A 3PUEA 5AHFA 2FGLA 3H2OA 3U5UA 3AXKA 5DBUA 2OLHA 2M08A 2DZVA 1LT8A 3G5EA 4EAMA 3HPZA 1BWVA 3VI2A 1MUMA 2F84A 4IX0A 3W1PA 4O1EA 3W7JA 2D23A 1LRTA 1W37A 1X97A 4TMBA 3TA9A 1VEPA 5HWNA 2GGHA 2PRMA 3A3WA 4AZGA 4CD8A 1PZ3A 1XLCA 1M04A 1JZ7A 2KR7A 1CTNA 2QW5A 4WDWA 2NQHA 1V0LA 3OZPA 4QEEA 3HB9A 5E93A 5AFDA 2KO7A 4AG0A 3VK5A 3CO4A 1OADA 3W7NA 3AS0A 4ODNA 4MTVA 1W2VA 1E6SM 1HW6A 4ASTA 1Q8JA 3R8GA 4B9ZA 1MXGA 3PRBA 1UJPA 4XBJA 2OWXA 1F3WA 1CDGA 1QXLA 2PMQA 4KS0A 3MUY1 2NT0A 2O7SA 2ADAA 2J7BA 1FA2A 1CECA 4UQAA 2ZWZA 3BLIA 2R91A 4Q22A 1GOXA 4JFKA 4JAWA 4PTNA 5FA5A 4WR3A 2PB1A 2ZX6A 3S1GA 4KIEA 3ONCA 3NO1A 2VX6A 1ZUAX 2XFFA 1WKFA 3M1ZA 3ZT6A 4NAFB 4TXEA 2GL5A 3LK6A 1E6QM 4J28A 2B0MA 1YPXA 2P3ZA 3HQNA 3I3BA 4MG4A 3KUMA 3O5PA 3DFQA 4JTQA 3VIOA 3BG5A 1W5NA 1FY6A 3OGVA 1XGZA 2OGJA 3UFYA 1IX5A 2VCAA 4S2CA 1VS1A 3W7RA 1Q2RA 4OJYA 4N4PA 4I8YA 4BF9A 1BGGA 1B9ZA 1ZENA 2JIWA 4LCQA 2CLLA 2XH2A 3LPOA 1L6GA 1KW1A 1FWEC 4F2TA 3POHA 3H7VA 1B30A 3ONBA 1I2NA 1OYCA 3OP2A 4XD5A 2P3EA 3L4ZA 1VFSA 3ABQA 1YNPA 2CZFA 1TFVA 3I3DA 1OB0A 4U28A 2Y70A 1ZY9A 4H8HA 3S2CA 1PBGA 4RV3A 5A2BA 3B8TA 3CL6A 3TU9A 4JFUA 4RR4A 2PI6A 1HGYA 2AMXA 1XYMA 2X1IA 5MF5A 5DO2A 4LS2A 1XDLA 2X7VA 2C71A 5IRPA 3V5OA 4IQCA 2PDLA 2G3JA 4HNTA 3PR9A 1VBUA 3OZYA 4JTLA 2XIOA 1SPQA 1UR9A 2GVEA 3VZXA 5TBOA 2QS8A 2FVMA 2YPIA 4I6KA 5E1QA 3UJRA 3L65A 1GVEA 4M5PA 2DGAA 1MFUA 4GO8A 4WSKA 5FL1A 4GLEA 2F23A 5FL0A 3W22A 4KFNA 1XUZA 5F2MA 2XU2A 4O2TA 3GSMA 4MPQA 4GY1A 4DLFA 2I5GA 4H8NA 1SFJA 4ODQA 3T1GA 3CH0A 2P53A 4J3XA 4HB7A 7ENLA 2WNZA 3DFOA 4H1ZA 3KVJA 3TN5A 3WLNA 1NM9A 3OVQA 2J8GA 3UZZA 3FXGA 4JTKA 3N9KA 7REQB 1TSIA 4ITZA 3WSUA 2VR4A 3NIYA 1FVPA 1ZNNA 4ZPTR 2RHGA 4PMOA 2HPMA 1UR8A 2Y5JA 3MWAA 2J47A 2R14A 3CXOA 1JYXA 3VCCA 1KXQA 1A5AA 5D9NA 3M47A 4AY8A 2V68A 2F6XA 1F6YA 1V08A 5ABFB 1ZK6A 4HA1A 4M6VA 3C56A 5IXEA 2H3BA 3S5NA 2WANA 1XIMA 3FV9A 1HL2A 1CXIA 1JNEA 1HL8A 3ME3A 2PU1A 5AC7A 3IVSA 3CHCA 3CT2A 3T78A 1XKYA 3RRAA 4WJEA 2CLMA 2QMKA 4XB3A 3DFPA 2JGYA 3PRDA 5DIUA 2I5QA 1UIOA 4JNZA 4M81A 3MJYA 1QK0A 2VFIA 4D6JA 4MGVA 1O5KA 5AYZA 4P7OA 1K8YA 5DRCA 3NXLA 3CPRA 3OVPA 1EPVA 1HP4A 4DWSD 4JXCA 3RR4A 2X0HA 1GZ1A 1XIGA 3S8HA 2P1FA 1UWTA 3PSVA 3OA5A 1OFRA 3GIPA 1O6IA 1DXEA 4UOJA 3WNPA 5G1TA 1RD6A 2ODOA 4DAFA 2WYSA 4IF2A 5HR6A 3DGRA 1E3ZA 3EKZA 2HTMA 2BBFA 3B4YA 1EJSC 3PPCA 2A7NA 3HZ3A 4DRIA 4Z1BA 4AC7C 4TX8A 1PX8A 3MUIA 2D9FA 1P43A 4IPLA 4OT7A 1RVKA 4IIHA 2NQ9A 4Z2LA 3GTHA 2LGOA 2Y62A 4GYPC 2PZNA 4GQBA 1UMYA 3UG4A 4Z1CA 1TPEA 5I06A 1ITUA 3GDKA 4W86A 2Z1SA 3ITTA 2V8ZA 3R7MA 3W85A 2Y78A 2QCMA 3HQ1A 1A47A 5JBFA 1R9ZA 5T8GA 1TMLA 3K13A 4JFLA 3QJAA 4DJDD 5M2FX 3FKKA 1I0DA 4US5A 1SZGA 2E9BA 4MADA 1J0KA 1US2A 1GQKA 4FXFA 1W31A 3CC1A 3W7PA 4HOZA 1ODUA 4RPQA 4ZE4A 2J74A 1J93A 4DXXA 5BZAA 3S5SA 2DSZA 1V3IA 4YN5A 3B7XA 4AH7A 2UV8G 3SQLA 3TONA 4UQ9A 4ZQRA 4UTMA 3SO7A 3GX9A 4PMQA 3KCOA 1XLBA 1HNYA 4WK9A 5HNNA 3TTYA 3LBCA 3AUOA 3SUUA 4TVCA 4ZTXA 3A9BA 1KCXA 4NZ3A 3UI5A 5I79A 1P0NA 1Y5VA 4XKMA 1KKOA 4R9XA 1KTBA 5LA1A 1UKTA 1X6NA 3MCOA 3IEBA 3TYUA 3P14A 3WD4A 1EC9A 1HQTA 1GQIA 2FMOA 2WC7A 2NV9A 2ZC8A 2E1WA 3VINA 3MI3A 4TQTA 3VD5A 2BOEX 2NZLA 1HO4A 3WELA 4J4OA 3NQGA 2EPMX 4OU1A 1FFQA 3O2LA 3W28A 4A2RA 3KAIA 5FEXA 2MANA 3ZVHA 2DV0A 1W6TA 3F7JA 4HU3A 3NGJA 2OX4A 3PZUA 4JIEA 3W27A 3C0LA 2OEKA 3VXGA 3RU8X 4GI6A 1MW0A 4XSLA 2WLYA 3O1NA 2ISVA 4UMCA 1IF2A 1SM9A 3CV1A 5HMDA 3QY7A 4Q8OA 1OGBA 3CWNA 3LHUA 1RPXA 4L72B 1K77A 1WKEA 4JCMA 1J0HA 1ZP4A 2XHYA 4PCFA 1JGMA 2IS7A 1PDZA 1F3EA 1UJQA 3WQGA 5BRQA 4UTKA 2QR6A 2NUXA 1AW5A 2DSWA 2GJNA 3NM3A 4UTTC 3NQ7A 1VB9A<