4MAVA

Crystal structure of signaling protein spb-40 complexed with 5-hydroxymethyl oxalanetriol at 2.80 a resolution
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of signaling protein SPB-40 complexed with 5-hydroxymethyl oxalanetriol at 2.80 A resolution
rcsb
molecule tags Signaling protein
molecule keywords Chitinase-3-like protein 1
total genus 121
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mavA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mavA01
4HA4A 3T2OA 3WEOA 3VDAA 2E0PA 4ATDA 4U5IA 1RP9A 1VB9A 2NT0A 4M81A 1MW2A 5C70A 3QR3A 1XGZA 4W87A 1E5NA 3CBWA 3AXHA 3TTOA 1SYTA 3PZMA 5GPRA 5FD0A 3TOPA 4H41A 5BRPA 2BVTA 2Y24A 5EMYA 1BLIA 4GQQA 3DHPA 3I3BA 4YHEA 3SUUA 4MAVA 3IJ8A 4CN4A 3RDKA 2OLHA 5E70A 1JXJA 4P8WA 2Z1SA 5CLTA 2A3CA 3VIMA 3AZRA 4WF7A 4W8LA 1CGUA 4M82A 3K8MA 4BQ3A 1XYZA 2FHBA 1E6QM 4W7VA 2ZICA 3CHEA 1VEPA 3W25A 2F61A 2G4FA 4V2XA 3D5HA 1H09A 1TG7A 2WMIA 2OSYA 1MQPA 1E4IA 1UR2A 3ZR6A 3E1F1 1ZJBA 1CGYA 4LYPA 1BPLB 2X1IA 5BXPA 3CZKA 2VT0A 4J28A 3EDJA 4PTVA 4AISA 4JKLA 2QHAA 4HOXA 3WIJA 1B3ZA 3VNYA 5D9OA 4D6FA 4E4PA 1WZLA 2DT2A 4QAWA 3T2PA 3K4AA 3BGAA 2BHZA 1KGUA 3S2CA 4JHOA 1JYWA 2EO7A 5FIPA 5HPCA 5M3WA 3S6TA 2WHMA 2V5CA 1EQPA 4P7RA 4ZXOA 3CHFA 1R7AA 3VMNA 2ZX9A 3WH6A 4PCTA 5D9MA 4PBGA 3GH5A 3AYSA 4RE3A 2AAAA 3I3EA 3CUHA 4ZFMA 2A3HA 5M17A 1F4HA 1E55A 4LXFA 4QCEA 4U31A 5CG0A 3ZMRA 4W89A 1D3CA 2V3GA 5HNNA 1J0KA 4A3YA 2PBOA 1J0JA 1E0WA 3AMLA 3PZQA 1TCMA 4HPGA 4IPNB 2GK1B 1NOWA 1GOWA 4RL3A 3BSGA 2WSKA 5I2UA 1AQHA 3VDHA 1OD0A 4Z2JA 1R85A 2BVDA 3SUWA 4H8HA 2DSKA 4ZXLA 3ARSA 3WDJA 1FP9A 2CBIA 3L2MA 2B31A 3PZUA 5AC5A 4HMCA 4P7OA 2X05A 4OIFA 1HJQA 5A8MA 1KFWA 2D3LA 2VTFA 4W88A 1RD6A 1UH3A 3ZSTA 5M03A 2EPKX 1GPFA 4W5UA 1MW0A 2GJRA 2OYKA 2V3DA 1EO5A 3BMVA 1G0CA 3WH5A 3VTRA 4AZIA 2XPKA 1B2YA 1HKJA 3GNOA 1GVYA 1QNSA 5CPTA 2BXZA 1W9VA 1EXPA 1Q6EA 5JBDA 4J3TA 3GTNA 3ARWA 2CHNA 3VX0A 4N42A 4CU8A 1AMYA 3ZJ8A 3CTTA 4CN1A 4J3UA 1DP0A 4TVDA 2ZUSA 5A2CA 2WZHA 3AIBA 3WNKA 3WUBA 4AZ6A 1W1YA 1HN1A 3VMOA 3BAJA 3U7VA 5I5RA 1ZBVA 5LA2A 4QCFA 1C8QA 2W4XA 2Y8KA 1QNOA 2CIPA 5CSUA 3GYCA 1HX0A 4E8DA 1JAKA 1OBAA 2WWDA 3LMYA 2E4TA 4HTYA 2CNCA 1V6UA 2ZX5A 1L0PA 1QI0A 1CECA 2X8RA 2BY0A 1XD0A 3WNNA 1UHVA 1JZ2A 4JCMA 4H04A 1C7TA 2CESA 3VNZA 1EO7A 4AZCB 1J9YA 1RPKA 3UG4A 1B0IA 1E0VA 4TTUA 4C7GA 4M8UA 2Y8VA 2CKSA 1B30A 3T09A 2VX4A 1PAMA 1CDGA 1KR0A 3AS1A 1UD3A 1B3VA 1GVIA 2ZXAA 4U3AA 1JZ5A 3OG2A 3BLPX 1TZ7A 1NWRA 1X6NA 1E73M 1V02E 1LQ0A 3SCOA 1CIUA 1C3FA 3AI0A 1GJWA 3I3DA 3THCA 1DWGM 3JUGA 1CENA 3B8SA 3II1A 1UZ4A 2E9BA 2YBUA 3WD1A 2VX5A 1EH9A 4JFSA 1GOIA 4P8UA 2OSWA 4OOZA 3WNPA 2Z1KA 1VJZA 3BSHA 1P6WA 4BS0A 4E8CA 1E0XA 4JAWA 5A6LA 3VMPA 2J77A 4TX8A 4UFIA 5D9NA 1ECEA 3GXDA 3U57A 3VINA 4F66A 3ZOAA 1GOQA 2C7FA 4AD4A 3ZM8A 4J3SA 4PMQA 1TFVA 1VENA 1QW8A 1WB0A 2NW0A 1FFQA 3DECA 1RH9A 1X6LA 2J7HA 2X09A 2ZX8A 4EKJA 2WYSA 4DUXA 1CEOA 4DM1A 1PX8A 3IAPA 4YHGA 4PMYA 3CO4A 2J7FA 1UR1A 1JAEA 1H5VA 3L4VA 1E1EA 4B3LA 4A4AA 4W93A 5A6AA 1I75A 4MJ4A 1QBAA 3SUSA 1EIBA 1UKSA 3ARZA 1UOKA 5TD4A 2G41A 1QNRA 3F5JA 1HP4A 3TTYA 1B90A 3GXFA 1WKYA 4PMRA 3WF3A 2VVSA 3AMKA 1R8LA 4HA3A 5JIPA 4AD2A 3SCUA 3N11A 1UH4A 3CHCA 3NUKA 2IXUA 5A8OA 4ATWA 1PZ3A 1KGWA 1JZ4A 4CD4A 4TX6A 3WNLA 2F8QA 3AIWA 5ECUA 4D1IA 4HMDA 4HU0A 3ALFA 2EEXA 3CZJA 2DEPA 4ML4A 3BXWA 1QNQA 3DYPA 1I1WA 3MU7A 4WLCA 1E6PA 1UWTA 1WDPA 3WDPP 4PN2A 4CU7A 3AS2A 1IV8A 3IANA 1UD5A 1E15A 5BCAA 1CPUA 5DT7A 4AW7A 4RE2A 4XUYA 3SCVA 2OYLA 4AEEA 3MSGA 1NM9A 1E6SM 1IZJA 2CPUA 2FH6A 5E9AA 2PBGA 4B9YA 2XTKA 3MV11 1E4MM 2V3FA 3B9EA 1HJXA 1AVAA 4IUGA 3N9KA 4JFTA 3UEQA 3PZVA 1W2VA 2GJPA 4NRSA 3IAQA 3RPMA 5A2BA 4DWSA 4AIUA 2VRJA 3A4WA 1CXIA 1ZBWA 1WNOA 2D0HA 3WKZA 1SMAA 5E09A 1DWFM 1V3MA 5LA1A 1KCLA 3BMWA 3B9DA 1WE5A 4H2CA 1Q6FA 3WD4A 5HXMA 1QHPA 3K8LA 4PRWA 1E72M 1NQ6A 3ZSSA 3WFLA 2BY3A 3RO8A 1MFVA 1Q6DA 3AHYA 3UERA 2WAGA 3F5KA 1WDSA 1ZB5A 3UG3A 3ZIZA 4PMNA 2VR4A 5AC4A 1TUXA 5D8ZA 3T2QA 1B3XA 2VL4A 1CGVA 3F5LA 4C7FA 2YA1A 2VO5A 2DT3A 4TTGA 1GOKA 4MB3A 4WKFA 2XWEA 2E40A 2J75A 3W82A 2FDMA 2XGBA 2O9TA 4QFUA 1EGZA 4Y7EA 4MNLA 2RGMA 4HZ7A 4TVCA 3B9AA 1CNVA 5BROA 5IHSA 1KQZA 2WM0A 3VGBA 3TP4A 3RJYA 1H11A 1ZJAA 4P7QA 4PMDA 4IM4A 3EMCA 3ARYA 1V3IA 4W84A 1QHOA 2OWWA 3CZ8A 1GOMA 4HPHA 1C91A 2D20A 1TVNA 3WQ4A 4QLJA 4D71A 1WP6A 1CXKA 2JFEX 2ZUVA 2J62A 4PMVA 1W1PA 1M04A 5GNZA 1E6ZA 3SCQA 4TVUA 3CH9A 4UFMA 1BG4A 3WD0A 5CZKA 4OBRA 2CXGA 5CLWA 3BCFA 1PX4A 1HVXA 2OWCA 3N18A 3NJ3A 4UZUA 1BHGA 3BH4A 2G3IA 1E6RA 3WL1A 2WC7A 2XSAA 1FH9A 3EYPA 2BVYA 1JZ6A 5D9PA 2WCAA 4PMXA 5AY7A 1S46A 4PUEA 2W67A 4MJ2A 1LL4A 1KXTA 2XHYA 3PBGA 1US2A 3QHOA 5IFPA 5FKYA 2Q8XA 4MAZA 1W9UA 2WVSA 4BQ5A 4Z2HA 3WMCA 2D3NA 2W63A 4KMQA 4D1JA 1VBUA 1ZS2A 1DWAM 3AMDA 3BAXA 3N17A 4NRRA 3WQVA 1E4LA 1UWRA 4W85A 3AHZA 1DHKA 3A3HA 5BXTA 4HA1A 2WB5A 4HOZA 3EDFA 1CBGA 4LYQA 2WLYA 3WL0A 3N12A 1H0GA 1XC6A 1UKPA 1JZ8A 3W24A 5A2AA 5E6ZA 4U33A 1LL6A 3PTQA 2WHJA 4J27A 4UQ9A 4ZEPA 4EK7A 3T08A 1CGWA 2UY5A 2Y4SA 3A4AA 1DWIM 4YN5A 4ACYA 4BA0A 2VUYA 5IXEA 1OSEA 2YL9A 2ZUTA 3HN3A 1HKIA 2JF6A 3FXYA 3QHNA 4H7VA 8A3HA 5GQBA 1CGXA 1R86A 5I0DA 2CCRA 2XIBA 1GHSA 3FN9A 3WQ6A 1EA9C 4A3HA 4B9ZA 2DH2A 2J47A 1W1VA 5A1AA 2PWFA 2Y5EA 1OWQA 1UR8A 1UUQA 4CGTA 2V38A 1K9EA 1UA3A 1ODZA 1UWIA 3GBEA 1FOBA 4HOWA 3ARVA 1DWHM 3TONA 1H2JA 3WENA 1M01A 3WH9A 3SEPA 1KXVA 3K4DA 2HVMA 1GW1A 1PJ9A 3VGDA 2CEQA 1ITCA 4CD7A 4UQDA 2WVVA 3UG5A 5EBAA 4F8XA 3AXIA 1WZKA 2EPLX 2XIIA 1NWUA 1XYFA 1LG2A 1HXJA 2WCSA 4FLRA 4JKKA 5LYRA 4GZIA 1LWHA 2VCBA 3CZGA 3IJ7A 1W3KA 4JIEA 3OGRA 1PPIA 3TTSA 1QNPA 4UQCA 2ZXDA 2WC4A 1VEMA 2O9OA 2CYGA 1GONA 1UD2A 1QI2A 1H41A 4AZCA 1B31A 4JL1A 3BCDA 3VO0A 2E9LA 4XV0A 2A3BA 2VRQA 4ATLA 1J0ZA 2XWDA 1MW1A 1CLVA 4K68A 4W86A 2VC9A 4PTWA 4F79A 3OZOA 4GINA 3AS3A 2FGLA 4Q22A 3SUTA 1N82A 1Q6GA 4GQRA 4D6JA 1JIBA 3SCWA 4AIOA 1FHDA 4FLQA 3WH8A 3THDA 5I3DA 4UR9A 4FF5A 3WH7A 1KXHA 1QI3A 3AICA 2WMHA 3O2LA 3AHXA 1LJYA 1JDAA 2J78A 3PZNA 5A94A 3CZEA 1EQCA 9CGTA 5AYIA 4LGXA 3SIMA 3TTQA 3VM5A 4DUVA 4E2OA 1DTUA 2DIEA 2PB1A 1HF6A 5HOSA 1OGGA 5CJ5A 3POCA 4UQAA 1M53A 2DSWA 2F2HA 4Z2LA 3VGFA 1ISWA 1BVNP 1WZAA 3OLEA 1V3LA 2DSUA 3T0BA 3WF1A 4Q7NA 3MUAA 3VKKA 2D2OA 4WSKA 2E3ZA 4UQEA 3BAKA 4MTVA 1J0YA 4U3CA 2XM1A 4PSPA 2YOCA 3POHA 1ODUA 2WVUA 3TA9A 4D6DA 4OBSA 5F7UA 4MPKA 4WJXA 3MANA 3RILA 2O9RA 3UR8A 3PZ9A 2VX6A 2YIHA 1JYVA 3ZT7A 3O9NA 4XZWA 3SCPA 3L4TA 4P8VA 4B3KA 4H8UA 1O7AA 1I1XA 1W2PA 3PZTA 2J7BA 1J0IA 5I24A 2PWGA 2DDXA 1MXDA 1PIGA 4JFUA 1E71M 2EPNA 1XH0A 2WVVB 1KWGA 3M07A 2NSXA 1V6XA 4HZ8A 3AMGA 3VDBA 1E40A 3WUEA 4ACZB 1ZBCA 1XCWA 1GJUA 1NARA 2VI0A 1W91A 3UETA 2WZIA 2YJQA 1TVPA 4Z2GA 2PI6A 2XFRA 3RCNA 4AZBA 1VBRA 3FY1A 4UQBA 5HPOA 2PWDA 2WMKA 2XM2A 3ARTA 2PC8A 5FL1A 2WMFA 1W9XA 5DMYA 2AMGA 4KWUA 2PF0A 4RE4A 1CWYA 3AIVA 2VCCA 3EDDA 1WDRA 3VD4A 3CLWA 4JFVA 1UD6A 2HISA 3L4XA 3MUZ1 2YDSA 4X0NA 5CXPA 4H8VA 4LX4A 4TUFA 2XJ7A 3VD7A 3ARRA 2GJXB 4JL2A 4AC1X 1VFUA 2EJ1A 1OT1A 1WO2A 3W37A 1CXFA 4ZENA 4CKQA 4AD1A 1G1YA 3L4YA 4KGJA 1OT2A 2XVKA 1UA7A 1J11A 1M03A 4URIA 3MMWA 1B1YA 3KE0A 1QVBA 2WCGA 2VZVA 1XSJA 2XUCA 3AROA 1V02A 4R27A 5A3HA 3WD2A 2WMJA 4PEEA 5DF0A 1WDQA 3WF4A 2IUZA 1V6VA 2VZUA 3BC9A 3CGTA 3WQWA 5JBEA 2JIEA 1SR0A 3PN8A 1B3YA 3GNRA 2XVGA 3WMBA 3WNMA 1ISXA 1HT6A 1CXEA 4C7DA 1GHRA 2W5FA 3OLGA 2EBNA 4Z2IA 1BF2A 4NZCA 4HMEA 5IHRA 2XG9A 2D0FA 1UZ1A 4PTXA 7CGTA 1B9ZA 1IT0A 1VFFA 1U30A 1CXLA 2QPUA 4J7RA 4QLLA 3WDQA 4OKDA 3EDKA 4JFWA 4BF7A 3WY1A 5E0FA 4PTMA 3VU2A 3WUFA 4BCEA 3CUGA 3RMEA 5KEZA 3VIOA 1HP5A 3ZJ7A 1EHNA 1MYRA 1Q6CA 3GZAA 4KH2A 3U5YA 2GJXA 2QLYA 3VX1A 5KZ6A 3WMSA 1QI5A 3PZOA 4AD0A 4V28A 1H4PA 3L4UA 1E3XA 4FK9A 4HZ6A 1BG9A 2J7CA 3KWXA 1HJUA 2ZUWA 3NIYA 5BYWA 1W3JA 3VIJA 2GVYA 4WIWA 3T0AA 4WK9A 3MO4A 3WDIA 1MQQA 2WBKA 2ZXQA 3CMJA 4UFHA 3NCOA 1NH6A 4WKHA 1C92A 3OGVA 2FH8A 4U2YA 3UCQA 2ZUMA 3A6OA 3ZO9A 4DM2A 4JZ5A 2VZSA 1ZU8A 3AHVA 3SCRA 3M6DA 4JHZA 5CSYA 4D72A 2O9PA 1UR4A 1LF1A 2A3EA 4OZOA 4J3WA 3IJ9A 4CCEA 1GZJA 2CHOA 2UY2A 3K8KA 5HBFA 2WXDM 1E43A 4OOUA 5A6BD 2BY1A 5AYBA 3HMCA 3GDBA 4AY1A 4J3XA 3AFBA 2X2YA 1BSIA 3EMQA 4X9YA 3VGGA 1QI4A 4AYSA 2YDQA 2DPEA 5A8PA 1JZ3A 2GSJA 1OCQA 3APGA 3M7SA 1OM0A 3VGEA 2WKGA 2EXOA 2GK1A 2TAAA 3VDCA 4B16A 2YKKA 3QHMA 5M5DA 1EOMA 2J8FA 1JDDA 3ARQA 3N04A 2WW5A 3ALGA 3LPOA 5ABHA 3ARPA 3LPGA 2QPSA 3K46A 3OIHA 1HL9A 1E1FA 4UOQA 3WNOA 1K9TA 2ZOXA 3QOKA 2ZE0A 3ZR5A 1OIFA 4P7LA 4OJYA 1K9DA 1QOXA 2E8YA 2O92A 2WMIB 2YA2A 3AMCA 3PZIA 2XYLA 1UD8A 2GDUA 4CN6A 5EFFA 1GQIA 2A3AA 3WSUA 1GQLA 1UYQA 1Z32X 3AZSA 1TR1A 4GO8A 4D6HA 1D7FA 2YDRA 3WQ5A 3VD9A 1UH2A 1BTCA 3KL0A 2DGAA 4U2ZA 3VIFA 1VF8A 1HKMA 2VX7A 4F9JA 5D4YA 4ACZA 1AQ0A 1G94A 2D24A 1NP2A 1JI1A 1EHAA 3F4VA 4HP5A 3WEZA 4PCSA 2FGZA 2CBVA 2WPGA 3SCNA 3OA5A 3U5UA 4XB3A 2D23A 1Y7VA 1ISYA 3VD3A 4TXEA 3ZJ6A 3SCSA 4JCLA 2VVNA 3NDZA 4CD6A 2ZWZA 1OINA 5EB8A 1V08A 1V3JA 4KRTA 1JFXA 4PSRA 4UOJA 4UFJA 2XGIA 3UESA 3FHQA 3W29A 2ZUUA 4AWEA 3GH4A 1XHGA 1GUVA 1R87A 4DWSB 2QMJA 1JI2A 4QLKA 2DH3A 2XSBA 1W1TA 2NT1A 3MKKA 3W26A 5ABEA 3SURA 2V5DA 2YBTA 4TOQA 5A6BA 1QPKA 2YA0A 3CMGA 1KB3A 1QW9A 1W9BM 3D3AA 1EDQA 2J8GA 3BAYA 4MDOA 5ABFA 1G01A 1J18A 1BAGA 3GH7A 4GXPA 1PZ2A 3IK2A 1LG1A 3NSMA 1MW3A 1VJSA 4M29A 4UOZA 1Q4NX 2D0GA 3CUFA 4QP0A 4U5KA 3ZT5A 2J7GA 1KCKA 2CETA 4QDMA 4W8BA 3VGHA 2VOTA 1JNEA 1BYCA 3WQ8A 3ZQ9A 6A3HA 7A3HA 2E8ZA 1XV8A 2VR5A 3AIQA 1W3HA 2X0YA 3W53A 1V3KA 3AZTA 1BFNA 4GZJA 5DEZA 3MV01 4MNKA 4CVUA 4X0VA 3AIEA 3DYMA 2VNCA 1JNDA 2DT1A 1W32A 3VM7A 4W5ZA 1KWKA 4FLOA 2QV4A 1J10A 5A8NA 1FP8A 5I77A 1UR0A 3WDRA 1OB0A 1BVZA 4WKAA 1ITXA 4EANA 3VIKA 2DSVA 2G8ZA 2JALA 3A47A 1V6YA 1UG6A 4W7WA 1KR1A 1E5JA 1DWJM 3EMZA 1L8NA 4PMZA 4UZSA 4AMCA 2XFFA 4AIEA 2CKRA 1C7SA 3W27A 3L2LA 5EFDA 3VIGA 4KRUA 5GNYA 3OGSA 3FNDA 3AHTA 4BZYA 3KEHA 3QOMA 1V6WA 1SMDA 2VZTA 3AIRA 2X0HA 1WPCA 5BXRA 5CPSA 1E3ZA 4AD3A 5CQ1A 5FCZA 3CIVA 4M1RA 5A6SA 3EDEA 1WAWA 4JKMA 1EDGA 4ZE5A 1A47A 3W81A 1JFHA 1XSIA 1E9LA 3WBAA 2MANA 1HL8A 4CCDA 3CZLA 4S3KA 4WSJA 2W92A 1VFOA 4PUDA 3W28A 2D22A 1KXQA 1XH1A 1RP8A 1W3LA 2QF8A 1HNYA 5HDRA 1CXHA 3MSDA 2YL8A 3WD3A 1JYXA 2WMGA 3AISA 4FMVA 5I78A 4IISA 5IFTA 4CD5A 1UKOA 2YL5A 1J12A 2BNJA 2J25A 4GO9A 3WELA 1CLXA 2W61A 3T0DA 1MFUA 5LA0A 6CGTA 4PMUA 3DC0A 3KL5A 2J4GA 2YL6A 3CUJA 4MB1A 3ZJKA 3RM8A 1BYDA 1UQZA 4AD5A 4MNMA 4D6CA 1V03A 1BGAA 4CD8A 1TA3B 4BQ2A 3L4WA 5BRQA 4Z2KA 4DWSD 3AQUA 1A3HA 4GI9A 3WBEA 3WN6A 4P8XA 4UFLA 1JG9A 3LPFA 4UCFA 3N15A 1EDTA 2ZUNA 4MB4A 1E6NA 1XD1A 1LWJA 4OUEA 1KGXA 2WSPA 3CPUA 2ESCA 3GXMA 1HVQA 2JEPA 4MADA 2DSZA 1OIMA 2WZEA 3RM4A 2ZWYA 3VOCA 2J79A 4DWSC 1XCXA 1NWTA 1V3HA 2WHLA 3PTMA 1V0MA 2ZX6A 2CERA 2VJXA 3N13A 3VPLA 2WC3A 1QBBA 1HJSA 1ISVA 1JYNA 1C93A 1ESWA 3WDHA 3SCTA 2FHFA 3MS8A 3G6LA 4MDPA 1MVYA 2C8NA 1CGTA 1UR9A 2UWFA 2V3EA 1F4AA 1J0HA 3GNPA 6TAAA 5IDIA 5ABFB 3GXIA 1V0LA 1NOFA 1H0IA 2BY2A 4F9DA 3AOFA 4LQ1A 2XVLA 1VEOA 3MMUA 1JF5A 3PTKA 1ZBKA 1K6AA 1CTNA 2OYMA 2WANA 5FL0A 1JL8A 2IXVA 4EAMA 3N1AA 1OD8A 3BAIA 1NWSA 1G5AA 5A69A 2W62A 1HKKA 4W8AA 4GKLA 1OGBA 4P7NA 1GQKA 3K1DA 1ISZA 1M7XA 1PEZA 3ZT6A 1H1NA 1ZL1A 1NP0A 1C90A 1JD9A 3LPPA 3PZGA 4D6IA 1VRXA 4J3VA 3AS0A 4AZGA 3SUVA 4AZHA 5DO8A 1GOOA 4S3JA 2D1ZA 3KL3A 2OSXA 3FHAA 1E4NA 4UNIA 2E9MA 3OZPA 1U2YA 1V0NA 2BS9A 1FHLA 1XH2A 5A6KA 3HJEA 4W7UA 1KQYA 3W38A 1NOUA 4L4PA 1US3A 3VUPA 3GM8A 1WCGA 2GUYA 3EBVA 1JGIA 2ZXBA 3WF0A 2Y2WA 4M56A 1HIZA 4V27A 1MQRA 2WNWA 5C8BB 1B3WA 1KBKA 2WWCA 3VIHA 2VRKA 1K9FA 2G3MA 3L4ZA 3A4XA 3RM9A 1R7OA 2CITA 2BFGA 1UWSA 5A8QA 8CGTA 1YQ2A 4FLSA 1E56A 4GIAA 3DYOA 5CGMA 4IPLA 5DFAA 3NYDA 2WBGA 1FH8A 3WUGA 1GCYA 4LYRA 1VFMA 5DT5A 5A6JA 5BWFA 3FW6A 3NSXA 4N0RA 4GI6A 3RIKA 1PIFA 3W0KA 1JXKA 1UWQA 1VIWA 2EPMX 3VILA 2WHKA 1QHZA 5A6MA 3NSNA 1CZ1A 3NDYA 4BQ4A 3AYRA 3CUIA 1C8YA 2J7DA 2JIWA 1VAHA 3AXXA 2EQDA 2JE8A 5CPQA 5JIWA 5JH8A 4UFKA 3W6MA 2WVTA 3M46A 1H49A 4XZBA 4D6EA 3BLKA 1GQJA 3J7HA 4CUCA 4AXNA 4CU6A 2VQUA 1UKQA 1JD7A 1AQMA 2VMFA 4D6GA 3VVGA 2UY4A 2ZX7A 1MXGA 1GORA 1SFSA 3OB8A 2WK2A 1FH7A 4KGLA 2PWEA 1BGGA 3MUIA 4AEFA 4GPNA 1W9PA 3QGVA 1BYBA 3OBAA 1V0KA 1W9DM 2YLLA 5E0CA 1E70M 3MMDA 3RJXA 1DEDA 4EE9A 4UTFA 5ABGA 4MNJA 3CHDA 1FA2A 1H3GA 3UR7A 2BHUA 3HU7A 3ECQA 3WF2A 1TE1A 3VIPA 1KBBA 2VZOA 3U7BA 3BAWA 5D8WA 4LPCA 4L4OA 2VURA 3ARXA 1C8XA 2BHYA 1BYAA 2G3NA 1XRVA 3GBDA 3MUY1 4M24A 1LL7A 2BXYA 1JDCA 2YLAA 3FAWA 5A95A 2ZIDA 2C0HA 1UKTA 3WFZA 1CYGA 4MB5A 4NI3A 1LLOA 1UQYA 5I6SA 2WKLA 1YHTA 2UY3A 1EOKA 4CVWA 4YPJA 3W4RA 2AOSA 2JEQA 3WEMA 2BV9A 5JBFA 4DUWA 1XSKA 4PMOA 3O6AA 4NF7A 2GFTA 1TMQA 2DT0A 7TAAA 1MWOA 5E6YA 4AZ5A 2G3JA 2CBUA 3DHUA 1HJWA 3PHAA 5JUVA 1TA3A 4ZE4A 1U33A 1PX3A 2CBJA 2VQTA 3FAXA 1HJVA 1JZ7A 1GNXA 3VIIA 3KZSA 1BQCA 3OLDA 2EPOA 3AJ7A 1UD4A 5C71A 1IZKA 5CGTA 5I79A 2XVPA 5FOOA 2W91A 1PBGA 3OLIA 1G9HA 1WZMA 4GI8A 2RGLA 3G6MA 1FFRA 1E6XM 3W6LA 4AZ7A 4HU8A 5GNXA 2J74A 4PYSA 5I23A 2PWHA 2DIJA 4XX6A 4GZEA 2J7EA 4B15A 2XVNA 2QMKA 1J01A 1OGSA 2VCAA 4NSBA 2FHCA 1O6IA 3VD5A 5BXSA 2OWXA 4CCCA 1X1NA 2JF7A 2XFYA 3ARUA 1JF6A 2W66A 2DQXA 4R5EA 2WLZA 1D2KA 2GDVA 1UWUA 4M80A 3AIUA
chains in the Genus database with same CATH superfamily
4ALDA 4GIYA 1MXSA 3VDAA 2E0PA 4U5IA 2NT0A 4MGGA 4Q8MA 1XIBA 5C70A 4BI7A 1E5NA 4JIPA 1SYTA 3R10A 3M44A 3TOPA 3V0TA 3MC5A 4H41A 1CLKA 1L9WA 5BRPA 2PLMA 5EMYA 1BLIA 3PRAA 3GS6A 4LS0A 2OLHA 4DJFA 2VWTA 3KRSA 1FCVA 1P48A 2Z1SA 3LI1A 2A3CA 3W7MA 1IEQA 4MYXA 3VIMA 4J35A 2ISVA 1FDZA 3O7UA 4W8LA 1OCNA 1CGUA 1HTIA 3DXIA 2FHBA 1U1UA 1DJYA 3XISA 4IPIA 3D5HA 1H09A 2WMIA 1IHIA 2FZDA 3M0JA 1MQPA 5HULA 1AH3A 3ZR6A 4HQVA 4ADSA 3P6LA 2FJUB 3G1VA 1O5KA 3HA1A 1BPLB 4FN2A 1Y5XA 1PSCA 5BXPA 4AVOA 4ES4A 1R3YA 2RUDA 4J28A 4O15A 4XWUA 1HGWA 4YVPA 3EDJA 4PTVA 1QWKA 1DXEA 4M0XA 4CNSA 4HOXA 4XKMA 3VNYA 4N9CA 4XVEA 4FO4A 4Z1YA 4E4PA 1JPHA 3V16A 2G50A 1WZLA 4QGCA 2DT2A 3LXCA 1XLIA 1FKIA 3R89A 2WJZA 2Y63A 3K4AA 2YFNA 3UXIA 3KBNA 4L65A 4EXAA 4JHOA 1OG0A 4Q8UA 2VDIA 5FIPA 3H7UA 4GD0A 1RR2A 1PE1A 3Q58A 3TW9A 2V5CA 2B5UB 2M2AA 4CEUC 1R7AA 2ZX9A 1JJKA 4Y6GA 2WSYA 3L68A 4PBGA 4ZL1A 2ZR5A 1TMLA 4BWLA 2AAAA 3QY7A 3CUHA 4MZ1A 4WY0F 3G1AA 2F6UA 3TWBA 4U31A 5T26A 3W1QA 3T42A 4IIEA 4I7WA 3QMSA 3A24A 1W5QA 2QCDB 1GYNA 3PNUA 5CZJA 1PDZA 3TROA 2YYTA 2GK1B 1GOWA 4RL3A 1YX1A 2WSKA 2E67A 3DZ1A 4AYGA 4C90A 2PV1A 1RLCL 3NEVA 3WDJA 2CBIA 2PDCA 3PZUA 3GAYA 5AC5A 4JBRA 1GG0A 2QIWA 1R3QA 3UWYA 3BJFA 1KFWA 4J40A 1RD6A 1UH3A 4IG2B 3ZSTA 5M03A 4MGVA 4W5UA 3PULA 3IARA 4QE4A 3MDWA 1SW7A 3GU2A 2V3DA 2DIKA 4M6PA 3U4AA 4AZIA 1PKYA 2G5WA 3LLXA 5CPTA 2DZBA 2BXZA 3SR7A 1Q6EA 4J3TA 3GTNA 2OZTA 3VX0A 4LUJA 1F6PA 1T6MA 3KP0A 4HNOA 4KEZA 3DFSA 3FJ6A 4L1WA 6REQB 1OYAA 1OZQA 3GHUA 3O5GA 3ZLHA 4ZOCA 1DP0A 3CUXA 4XD3A 2ZUSA 5A2CA 1TPH1 3AIBA 4G1NA 5D04C 3THUA 3WUBA 4Q4RA 4WGHA 3VMOA 1W26A 3BAJA 1ZBVA 1RXOB 3NR0A 1ZJHA 1BD0A 1F61A 2W4XA 1QNOA 1Z7AA 3TWAA 1PL9A 4JTSA 4Y8EA 2ALDA 1JAKA 4PODA 3GG1A 3O63A 3NWRA 2PTXA 1POJA 2CNCA 1V6UA 4NKCA 1L0PA 1QI0A 4ZBCA 3GIYA 4REQA 1XD0A 3FA4A 1QPNA 2FFIA 1FKSA 1EO7A 3KBMA 4C7GA 4M8UA 1F3EA 4LNCA 2G95A 4LUSB 5JQ9A 1PAMA 5BU6A 3PSWA 1KR0A 3AS1A 3F1QA 2O0TA 1YNQA 2ZXAA 1W37A 1JZ5A 1THFD 3IUHA 3BLPX 3TK7A 3SQLA 2OEJA 1CIUA 2CC0A 3EA3A 3I3DA 1DWGM 3UI4A 3II1A 3TJXA 3V75A 3QPEA 2YBUA 2VX5A 3SRDA 1EH9A 4ECLA 3C8NA 3NQCA 3H70A 4CQBA 2OSWA 3OJGA 3OHMB 2R82A 2OR2A 4YWIA 3UGRA 4IHCA 3RX2A 3DH7A 5B7YA 3PNZA 2WQPA 4O2TA 4MHBA 2V69A 5JH2A 3G3DA 3W1AA 4W9OA 1KM2A 4F66A 3VINA 3ZOAA 1MUCA 1TV7A 5FF7A 1T0OA 1BVWA 1VENA 3REQB 1MUWA 3W84A 3DECA 3O6CA 4BR1A 2HK0A 5LIXX 2WYSA 1JRCA 4DUXA 4I9MA 4DM1A 3IAPA 2NX1A 2J7FA 4U85A 3B8WA 5DBTA 1H5VA 1E1EA 4A4AA 5A6AA 4MJ4A 2JKPA 2OLAA 3WH0A 1EIBA 1UKSA 3ARZA 1UOKA 1QNVA 4C6DA 5TD4A 4CNOA 4YCPA 1TELA 4LBSA 2DORA 4PUNA 2AWGA 3TE9A 4Q4MA 2VP8A 2FIQA 2VVSA 5JIPA 2QJHA 3MI3A 3N11A 4JTRA 2NQZA 3RK8A 4IJRA 3C8FA 3ERPA 3Q37A 4RDZA 4DEFA 5A8OA 4ATWA 1KGWA 4X61A 3TSMA 4R0XA 4PCFA 3BXWA 3PJXA 3W7QA 2VM8A 5J5DA 1M7OA 5EBUA 1VRDA 2NQHA 3CAKA 4WLCA 3G3MA 3CWHA 1UJQA 4CU7A 1ZENA 3AS2A 2Z28A 1FWJC 4MZYA 3HQOA 5AN7A 1XLCA 1CPUA 2OMAA 5AHFA 3IKGA 4L6DA 3B0VC 1XXXA 4GI4A 3HMJG 5D30A 5DT7A 3SCVA 3M9YA 3WK0A 2EF9A 3M5YA 1IZJA 4HCLA 4B9YA 3MV11 4JDBA 1HJXA 2XIJA 1AUSL 1DIDA 3UCCA 1AVAA 4JFTA 4A8RA 1W2VA 2CLLA 4HJFA 1GG1A 5A2BA 4DWSA 3WLQA 4WD0A 3A4WA 3C86A 1E1CB 1CXIA 3Q2DA 1YPIA 1F8IA 4GA8A 6TIMA 1I4NA 1DWFM 5LA1A 1KCLA 3CT7A 2IPGA 1XR2A 3O0KA 1WE5A 4H2CA 3WD4A 3PBMA 4WEVX 1RVKA 4P61A 5HXMA 3G1YA 3L21A 4GMEA 3K8LA 3OO2A 3WYZA 3WFLA 2BY3A 3RO8A 1MFVA 1Q6DA 1WV2A 4ROPA 3T07A 4IP5A 1H7XA 5AC4A 3ZIZA 1VYSX 3ITXA 2WSRA 1P5BA 1YBQB 1ZSXA 1CGVA 2VL4A 5CSRA 4OU1A 2YA1A 4GUFA 4ZGYA 1YRRA 3I4KA 2W79A 3NTPA 2XWEA 4DF0A 2E40A 2FDMA 2XGBA 2GJLA 4YYFA 1OCBA 3W9ZA 4HZ7A 1IIGA 2HPMA 4TVCA 2C91A 1CNVA 2RUCA 2AQOA 2WM0A 1CW2A 1JQXA 1H11A 3EGJA 4PMDA 1TR9A 1TPWA 3IKDA 1V3IA 2OWWA 1GOMA 3NG3A 3SQSA 4G9PA 1C91A 2D20A 4CQCA 2JZVA 2GOUA 4M7SA 3W7OA 4I5RA 3PPCA 4X9SA 1W1PA 4JYSA 1OX4B 5EMUA 2ZVIA 1M04A 3VZXA 1XRSA 1W31A 1TWSA 3SCQA 3CH9A 4B92A 4O54A 2ACSA 4UCGA 3YPIA 3WD0A 1P6CA 5I03A 1OYBA 5CLWA 1MDRA 3EIPA 2OWCA 4KWOA 4XK2A 3OQEA 4ODPA 1YTKA 2Y6ZA 6REQA 3MDUA 2Z1VA 3WL1A 2WC7A 4O16A 3HURA 1X7FA 1FH9A 4E2VA 2WCAA 2EG6A 5AY7A 4XAFA 3W7PA 1XQKA 4E8GA 4XAGA 4PUEA 4MJ2A 1MSSA 3PAOA 3QBUA 1US2A 3STGA 2WVSA 3WMCA 4ODRA 1VBUA 3V7PA 3AMDA 4H9XA 2Q3RA 2J13A 3MUCA 2VELA 5BXTA 4HA1A 2WB5A 1CBGA 4IX0A 1L2UA 2BMBA 2NUYA 3U2OA 4RE0A 3S9ZA 1H0GA 3QW3A 3PG8A 3FSUA 1UP2A 3T05A 1R2TA 4U33A 3D0CA 1LL6A 2WHJA 3QQWA 3W7RA 1XPGA 1QTWA 5IXEA 4EPBC 1OSEA 5FEWA 1Q63A 1G67A 1R6WA 2JF6A 3GDTA 3FXYA 3QLLA 8A3HA 5CBJA 3DGBA 4ODLA 3HPFA 3U2CA 3WQ6A 3FN9A 1GHSA 5HATA 2J47A 1UMLA 2Y62A 1ZPTA 3TCEA 1UUQA 2HDJA 4QT3A 1K9EA 3KCEA 4HOWA 4JN8A 1DWHM 4NL1A 3WH9A 4LV4A 2I14A 3QKZA 3GXNA 1YE4A 3LK6A 4JEJA 2D9FA 1GTHA 2H3BA 2P1FA 3P0XA 2CEQA 2P10A 2F21A 1H50A 3RLGA 2Z00A 1W5PA 1XYFA 4BI6A 3S9YA 2HPIA 1Y5VA 4FLRA 3T8QA 1QUMA 3C6CA 3QSTA 3VOJA 3CZGA 1UOZA 1W3KA 1PPIA 2XDFA 1SJAA 3TTSA 4K7YA 2P50A 2WC4A 1FKKA 1VEMA 3B06A 5LSMA 2O9OA 1ZP3A 1XYBA 4Z17A 4ZO7A 1QI2A 4H9TA 4AZCA 1B31A 1J4EA 3BMBA 5TNVA 1J0ZA 3UA3A 3WBWA 3T4CA 1UW9A 2YPIA 3OZOA 4Q22A 3SUTA 3B0YA 3NZGA 4GQRA 1JIBA 3UQBA 4FLQA 2DZAA 3THDA 3NAVA 4M5PA 3HPAA 4JTQA 5I3DA 3WH7A 2EKCA 3WX7A 3SY8A 4IPJA 2UV8G 3LCIA 2ZR4A 2Z0IA 3RCYA 1XBXA 3CZEA 1EQCA 1T8QA 3N3MA 4W9TA 3G1RA 4IL2A 4E2OA 4ZO8A 5DMLA 4YS1A 2NXIA 1FKTA 4BKNA 1OGGA 4PL2A 5CJ5A 3POCA 1TV5A 2G37A 3GXPA 1M7JA 1M53A 2F2HA 4FOUA 4Z2LA 1ISWA 2Y88A 3MMTA 5T9CE 3R12A 1BVNP 3OLEA 4NXSA 1V3LA 3KBSA 2BASA 4DZAA 2Q71A 4WSKA 1W1IE 3QV6A 3UXKA 2IS7A 1ODUA 4OBSA 5F7UA 3B0PA 5LIWX 3S4TA 4O12A 2YIHA 1JYVA 3BQ6A 1HW6A 2QEZA 2QCMA 3TC3A 3ZT7A 1PZ0A 1N8WA 4AVNA 2A21A 2PWVA 1SJCA 1UUMA 3MP5A 1O7AA 3TTEA 4K3ZA 4O4WA 2B7QA 1A5SA 2CZ5A 2QF7A 3W00A 1PIGA 4QSFA 1OF6A 1KCXA 3PWGA 1YNYA 1K8XA 1OFPA 2NSXA 1FVPA 1L1PA 4HZ8A 3NPWA 2PCEA 4ACZB 4E6MA 1TVPA 5BU9A 1EC7A 3CC1A 2PI6A 2XFRA 4IQCA 3WLTA 3BWWA 2ZQSA 5BOFA 5IBXC 2YBVA 1VBRA 2OGYA 2Q6ZA 2GQAA 2XP4A 4HNLA 2YFOA 2XM2A 1EUNA 1M5WA 2FAPA 1W9XA 4JTTA 2AMGA 2OX1A 2PF0A 4KWUA 3LSCA 3F2CA 1CWYA 3B40A 3AIVA 1OVDA 3EDDA 3EAUA 1POKA 5DELA 3ABOA 4JFVA 4HJWA 4EXQA 3L4XA 3RG6A 2YDSA 1I6NA 4H8VA 1M6JA 1QO2A 4B3ZA 3SZ8A 4PUWA 2GJXB 4AC1X 3GW0A 2V68A 1OT1A 1WO2A 2PLKA 5EYWA 3W37A 1CXFA 4ZENA 4CKQA 2QUNA 3KDNA 4AD1A 3L4YA 4A3UA 4KGJA 3S8HA 3GKFA 3K1GA 1UA7A 4UDMA 1TSIA 4M51A 1D8CA 3KE0A 4LOCA 4WDWA 2WCGA 2VZVA 1UB3A 3W1MA 2QJJA 1XSJA 1E0UA 1VFSA 4KBXA 3ANUA 4PEEA 2DUXA 2NUWA 1WDQA 4WVXA 4IFKB 4GOAA 3H23A 5JH1A 4LV9A 5HJXA 1FCUA 1HT6A 3QV8A 4C7DA 2W5FA 3TJIA 2V30A 4Z2IA 4NZCA 4HMEA 5IHRA 3SDOA 3HGSA 1AZ2A 2D0FA 4PTXA 4DH0A 1US0A 4OKDA 3GLCA 4K6AA 3BK0A 4C6LA 3WY1A 1TRIA 4EWND 4BCEA 3CUGA 1FKGA 3VIOA 2WJFA 1MYRA 2Z1BA 1W1A1 2GGJA 3VX1A 1QI5A 3PZOA 4AD0A 3W2KA 1BG9A 1S2CA 5MHBA 4M19A 1PIIA 1FX6A 1R3RA 4WSHA 3WDIA 1MMFA 1MQQA 4KS0A 2ZXQA 3NCOA 4KWSA 4U2YA 2VGFA 3RFAA 4U86A 3DERA 5J8LA 4ZQCA 2NX3A 4JZ5A 4HHPA 3U2EA 3M6DA 2P88A 4JHZA 5CSYA 2ZR6A 1QK0A 2DZSA 5FAJA 2O9PA 2DU2A 4DPPA 4J3WA 4A21A 2CHOA 2UY2A 4DRJA 5HBFA 2WXDM 3KHJA 1E43A 4R9OA 4QDWA 4QNWA 2GVLA 3HMCA 3O06A 3IK8A 2X2YA 3LY0A 3VGGA 2YDQA 2DPEA 1RCXB 1UUOA 1Q6LA 3H53A 5BOEA 2VC6A 1JZ3A 3LXBA 1OM0A 2PDMA 1AODA 3S1GA 3VDCA 1G4PA 2WJDA 1AJ0A 3PFMA 2WW5A 5HWMA 3CWOX 1FKDA 3B8UA 1TTJA 3K46A 1HL9A 4BWLC 4KRZA 2XPBA 3TMQA 5I3GA 2ZE0A 3ZR5A 2QT3A 1OIFA 3OOQA 3SW6A 5CPNA 1XBYA 2O92A 3I6RA 3AMCA 3PZIA 1UD8A 2GDUA 4DRMA 4CN6A 5EFFA 2R1LA 1GVFA 4L9YA 3PJWA 1XL9A 1GQLA 1B4EA 3GW3A 2BLEA 1RK6A 5F4SA 2DGAA 3S2MA 1XQLA 4U2ZA 3VIFA 3P8JA 4F9JA 5KTLA 1Q65A 5AKQA 2D24A 3USZA 1EHAA 4HP5A 4LSBA 4H6RA 3UWUA 1YW5A 3CLMA 4G1KA 3U5UA 3M6YA 4IMCA 1ISYA 3GR4A 3ZJ6A 2VVNA 3NDZA 4MKSA 1V3JA 3TYUA 1J6OA 1H51A 2PDJA 3NGJA 3WCZA 4LCQA 2XINA 3W29A 5K4ZA 2D2HA 3DX5A 2ZUUA 4EWJA 2ASHA 2OEKA 1GUVA 4O19A 1R87A 4QE1A 3VA8A 2RJHA 3W23A 3W26A 3R79A 3SURA 2YBTA 5A6BA 3CMGA 1KB3A 4QRNA 1GJPA 1QW9A 3H4XA 3V5OA 1FWDC 2AKZA 1F05A 1ZTVA 4RZ4A 3W74A 1TPEA 4GXPA 1AH4A 1ZY9A 2Y1HA 3UPBA 3ABRA 4M29A 1J4HA 2OCZA 3O15A 4UOZA 1Q4NX 3W70A 4QP0A 3CAWA 1LLWA 3ZT5A 3S5ZA 2VOTA 3SRFA 3TNOA 4B4HA 2XP7A 4GJJA 1PS9A 1QW7A 3RUBL 1W3HA 1W3IA 3KOYA 1NY1A 3AZTA 4GZJA 1IXOA 4GQBA 3DOPA 4CVUA 4X0VA 3FYOA 4FOJA 3GRIA 2GDQA 3FX4A 1JCJA 3KRBA 8RUCA 3WJYA 5EMMA 2RJGA 1FP8A 5I77A 4JYDA 2AL2A 4LCRA 1ITXA 4V1XA 2A85A 3C0SA 3QPZA 4IQJA 1IR1A 2PGRA 3CGNA 4IXHA 1E5JA 1DWJM 4Q8PA 4C6FA 4DY1A 4PMZA 3B8DA 4WY0B 4YTSA 4AIEA 3HM7A 2CKRA 1VFHA 3L2LA 3D46A 4KRUA 5GNYA 3NOEA 4FX8A 4EX4A 3FNDA 3AHTA 1A5LC 3B7XA 3NPVA 4MWAE 1V6WA 1SMDA 2X0HA 3MPGA 2J24A 2NX9A 3JYMA 1WPCA 5F2IA 3KTXA 4BI5A 4TV6A 3E9AA 3M0ZA 1SSDA 3T44A 2Y85A 3FJNA 4M1RA 4JKMA 4TV5A 1XSIA 4AY7A 3C0LA 4ZQRA 4L6HA 3UR5A 3S2LA 1EJTC 4PC8A 4XAPA 3W28A 1KXQA 4MY8A 3WLNA 4H4IA 1HNYA 1CXHA 2YL8A 4JGDA 3NQFA 5JMUA 5IFTA 4CD5A 4RXGA 3HQ1A 3LENA 5JVLA 2J25A 4XISA 1Q45A 3OBKA 4F0MA 1CLXA 3T0DA 1KM6A 3HG3A 2ODOA 1FAPA 1X39A 1XLDA 3PUOA 2J4GA 2PDBA 3CUJA 5C9RA 1FWSA 1PXGA 4YWSA 3WLRA 1JUBA 4MVAA 4AD5A 1X8CA 4D6CA 4HD5A 1BGAA 4BQ2A 4DWSD 2R9RA 1A3HA 3CH0A 5CKSA 1X97A 4GI9A 1JG9A 1B57A 3A9BA 1K77A 1FHVA 1EDTA 2ZUNA 1AD1A 1TTIA 1LWJA 1QU4A 1RVGA 1KGXA 3W02A 1VD6A 3M0IA 2LKNA 2HNHA 1HVQA 2WOQA 5HINA 4MADA 3UG8A 3R4IA 1V79A 2WZEA 3UVIA 1Q5MA 3RM4A 2ZWYA 4LEFA 1DE5A 3R13A 4ADUA 2R6OA 5PTDA 3W87A 2WNNA 4G56A 2B81A 4WY0A 5DMNA 4UTWC 2WC3A 2W27A 3BZJA 3E0LA 1ISVA 1GKRA 2ZZ7A 3VCCA 5T9BG 1ESWA 5C2CA 2Z29A 3MUXA 3GY1A 2CZFA 1OFQA 4A3RA 3N4FA 1R9ZA 3NO3A 1LOQA 1TPUA 1F4AA 4DO7A 4LCSA 4XQ6A 3ZWSA 2CLKA 4GX8A 4N7QA 5H2ZA 2BY2A 4DO5A 4HZMA 3CS2A 1F3TA 2XVLA 1ME8A 4ZOBA 3PTKA 1ZBKA 1K6AA 1RCQA 2WANA 5FL0A 1OD8A 4K8GA 4IQEA 1NWSA 1G5AA 3NYZA 4P7NA 1ISZA 1S2VA 1PEZA 4FXJA 2QIIA 3ZT6A 3ODKA 1NP0A 2PTDA 4IJCA 1C90A 4R88A 4H6EA 2GPTA 4N4PA 3E2VA 2PD5A 3EB2A 1G7VA 4MSPA 3SUVA 1GOOA 2D1ZA 5AYXA 3TA6A 4EIVA 2VDHA 1ZAJA 2E9MA 1V0NA 1R30A 1TMHA 1O4UA 3ITTA 3N25A 1GVSA 1IT8A 1NOUA 4L4PA 4DIPA 1EF2A 4H9ZA 4DROA 3GM8A 1WCGA 3OVPA 4OBTA 4AAJA 5C2GA 2ETNA 3S1WA 1JGIA 1TQXA 1F73A 3RX3A 5F4XA 2ZXBA 1S2TA 3ITLA 2MNRA 4V27A 1HIZA 4JTEA 4PULA 2ZC1A 2PDYA 4WZHA 3RRAA 2G3MA 2PDXA 3TFXA 2Z4GA 3L4ZA 2QV5A 3CAQA 2GZXA 3IV8A 4JTUA 4I9AA 2RAGA 2VENA 4FLSA 3E3HA 2PEVA 1ZZMA 5CGMA 5K7JA 3S5NA 3NL2A 3ONCA 5DFAA 1Z48A 1FH8A 5CZ0A 4H01A 5DT5A 5A6JA 5HW6A 4TYOA 1LUCB 1XBVA 4N0RA 3O6YX 1JXKA 2R14A 2EPMX 5CC7A 2WHKA 3OTRA 3TC5A 1QHZA 1HQTA 1CZ1A 1BXCA 1Z3NA 1JQVA 3CUIA 1C8YA 2J7DA 1VAHA 3M1ZA 3FA5A 1AH0A 2QUTA 2TYSA 1DQWA 2D2JA 3QM3A 1TIMA 3M46A 5D2YA 2SFPA 1GGOA 1QPQA 1KTNA 2V67A 4CU6A 1HG3A 1UKQA 4FNPA 4TU1A 1JD7A 3T1GA 3QTPA 2UY4A 5I00A 5BOOA 2ZX7A 3P8IA 1VCVA 4JIQA 1SFSA 3OB8A 1BGGA 1TPB1 4FF7A 3S6DA 7ENLA 6ALDA 1EKOA 8TIMA 1TJ0A 1WQ5A 5ABGA 5FF2A 3SM0A 3U9IA 3CHDA 4ZB2A 4NNRA 1OCJA 2PV3A 5CG7A 1RQEA 3ECQA 1B5TA 2I17A 4YNGA 3BAWA 1TX2A 2VURA 1YNPA 5FI8A 2KX9A 1XRVA 4FZIA 5C6MA 3GBDA 4M24A 3SY5A 3FAWA 4QIBA 4IUOA 1A5BA 5A95A 4TNSA 1NFGA 1JR1A 2A7RA 4DHGA 1UKTA 2OU4A 1F8AB 1CYGA 3PB0A 2UY3A 4CVWA 2DUAA 4YPJA 2P0IA 3E49A 1XYCA 3VFCA 1Q7QA 2JEQA 1PUDA 4RW5A 4NJGA 5JU6A 3WLPA 1W17A 5FEXA 1XSKA 3S42A 4PMOA 3VCNA 1C9WA 3BG3A 3UY7A 4F3HA 2GFTA 1H7WA 3NXFA 2ZZ5A 1NDZA 2DUZA 5EL1A 3W22A 3NQVA 2CHRA 1KT1A 4DRHA 3DHUA 4FAPA 5I06A 3AXMA 3PHAA 4O4VA 5JUVA 3W07A 4ZE4A 2W3ZA 2HS6A 2VQTA 1HJVA 4GHRA 5C5YA 4JIRA 4HSNA 3GK0A 1IZKA 2V0TA 2XVPA 2PDGA 4KFOA 1VZWA 1QAPA 5FOOA 1PBGA 1VS1A 1G9HA 2ZE3A 5HUOA 1FWIC 3R0UA 3CXOA 4AZ7A 4HU8A 1YTDA 2PWHA 2Q09A 2P4VA 3OOBA 1J5SA 4GZEA 4LB4A 1XLAA 3GXTA 3OVGA 3TAKA 1QFEA 2XVNA 4YCOA 4CNPA 1W5OA 3FYYA 1QO5A 2PDUA 3JU2A 4JTAA 3VNKA 5L9FA 2HVOA 4Y96A 2VCAA 5HWBA 1LQ2A 3VD5A 1YEYA 5BXSA 3HG2A 4DZHA 1X1NA 2JF7A 4O57A 4CNUA 3W88A 1Q1CA 2WO5A 3TYCA 5FJJA 2DQXA 2WLZA 3TZFA 1D2KA 2WNZA 4C1NB 1UWUA 4MWAA 3AIUA 2NQJA 4GCXA 1P5QA 4IIHA 3T2OA 2QAFA 3EWXA 5HW7A 3M0XA 1RP9A 1VB9A 2PP3A 3QR3A 4Q8QA 4CLMA 1FWEC 5E5CA 3CBWA 3AXHA 3DI1A 1Y0EA 1FQ0A 4LC6A 4DVOA 5GPRA 2YX0A 3EOOA 3KXQA 4QSHA 3H12A 2Y24A 4EF9A 3W2LA 4YHEA 3CU2A 3SUUA 4MAVA 2PU0A 3W7LA 3RDKA 5E70A 2NWRA 4DJDD 1IIHA 2QVHA 2A0NA 3PPFA 3G1DA 3AZRA 2DZXA 4WF7A 1SO6A 4M82A 3E0IA 4BQ3A 1G7UA 1XYZA 1E6QM 4W7VA 2ZICA 3W25A 3W7NA 5LIUX 5CEWA 3IJIA 5I3FA 4E0CA 2V81A 2IKHA 5L6UA 4XTIA 2BGNE 5DCBA 1CGYA 4LYPA 3IK4A 4HNTA 4NYYA 3FOKA 3MVTA 3CZKA 2VT0A 2NXGA 4HMNA 3RX4A 1XYLA 3WIJA 2JKAA 3ZLGA 1NDWA 1ZNNA 5TIMA 2H3DA 4D6FA 3QY6A 1SJBA 4IH3A 5FF0A 1M65A 5AVNA 4EP8C 2A79A 4QAWA 4MSSA 5I3KA 3BGAA 2YDAA 1KLYA 4QXIA 3F4NA 4H2HA 3O5JA 3W83A 2HEJA 3QVQA 4O1CA 2EO7A 1MNSA 5AHNA 4LC8A 4NAEA 3S6TA 1EQPA 3CHFA 3BE7A 3N34A 4IF2A 4DZ5A 3LERA 3RITA 4Q7IA 3BV7A 5M17A 4MWAB 4X63A 1F9CA 5FACA 2E5BA 2V5BA 1J0KA 2PBOA 4ONVA 1XLFA 1VHNA 4QDPA 2F4EA 3WZ0E 4HPGA 1EBGA 1NOWA 4PBEA 1AQHA 2VWSA 5AHMA 3SUWA 1NDVA 1X1OA 3ARSA 3H7RA 4LU0A 2QULA 2DZUA 1XLJA 4P7OA 3CEUA 2X05A 2PV2A 3DU0A 4JNMA 4OIFA 4Q4KA 5A8MA 3CTLA 1UC5A 4W88A 1AMKA 3VOHA 1R9HA 4UTWA 1GPFA 1PTDA 1ZUAX 2GUUA 3B8IA 2HK1A 4Z1CA 1TUFA 2OYKA 2HTMA 1PINA 2VD8A 3GVGA 1G0CA 1K3UA 4IJBA 4MM1A 1DJGA 1QNSA 1IEXA 1TCOC 1RPXA 1W9VA 5C9WA 1LLZA 4DLFA 2QGYA 4MPQA 4CU8A 4NNAA 2TRSA 1XCFA 1S3TC 2PRMA 4MG4A 4J3UA 1JVWA 1H7PA 4GG9A 4DRNA 3OBEA 4E3VA 3OA3A 1HN1A 2F6KA 4LAWA 3AAMA 3M4HA 1IT7A 3WO8A 2HS8A 2I5QA 4GY0A 3UZWA 2PODA 2WWDA 3KAHA 2ZX5A 3DFYA 3GNDA 4J5NA 2EG7A 1CECA 2CZEA 3C0QA 1PDYA 3A22A 2RH9A 3EX3A 3CMFA 4Q7BA 1UHVA 1JZ2A 1N8IA 2WV8A 5GPGA 1RPKA 3B3DA 4HK7A 4TTUA 2Y8VA 3DGRA 1B3VA 1GW9A 1GVIA 3VOFA 5E9XA 1WBJA 4PBFA 3A23A 1E73M 1V02E 1TRDA 1C3FA 3TU9A 1EPXA 4OHQA 1OQFA 1EP3A 2E9BA 3UQAA 3DBNA 3E0FA 2F2KA 1XIFA 3IRDA 1TYGA 1GOIA 3W85A 2MLYA 4P8UA 5EY5A 4DF1A 2Z7KA 1J93A 2DVUA 3QR1A 2FDSA 5EMLA 1JUKA 4UTTA 3EXSA 1VJZA 2OO6A 5T8GA 4G2DA 1VFLA 4JAWA 4DI8A 3L12A 3VZZA 3L23A 4D2JA 3GXDA 1GOQA 3BQ5A 2C7FA 4AD4A 2Y8UA 3T8LA 4L3NA 4OGZA 4RW3A 1QW8A 1FWGC 4JFKA 3ICJA 1FFQA 1RH9A 1R0MA 3NRKA 4YHGA 4PMYA 4YTQA 4RLIA 3AYVA 1ALDA 9XIMA 3ZR4A 5H1WA 3L4VA 4DYJA 5LNVA 1WXYA 3GIQA 2QZRA 4PRRA 3M0KA 2ZA1A 1OZMA 4Q4SA 2DZPA 3W73A 3F5JA 1ZAIA 1K4GA 4PMRA 1A49A 3WF3A 3W7GA 2B7PA 5CZTA 3S5SA 3CHCA 1O68A 2IW0A 1C29A 3GYEA 1JZ4A 3R8RA 4HHLA 2F8QA 3AIWA 4D1IA 3OODA 5HW8A 3O5EA 1JCYA 3W7EA 3PBUA 5D37A 1XP3A 2EEXA 3CZJA 4MLRA 4Q33A 3E6EA 1EL3A 1F74A 3KACA 3OVQA 1UWTA 1WDPA 4JDYA 4PN2A 1IV8A 5D33A 3NZQA 4JTHA 4N19A 5BCAA 2Y0FA 4H7ZA 3R11A 1AD4A 1H62A 3MSGA 1E6SM 5E9AA 4DYKA 3H22A 3B9EA 4B5VA 3PZVA 4XIMA 1RZMA 2YCEA 3ABZA 3KFTA 1O5QA 3CQIA 3GO2A 3IV3A 2QCHA 1EPVA 1RA0A 2VRJA 3UR2A 5FEZA 1SMAA 1VP5A 3LCFA 3VOGA 2E77A 4HTBA 4OE7A 4KWVA 3N4AA 2VCDA 2INZA 3VKJA 2Y61A 2EHHA 1TV8A 4L56A 4QNEA 4C1KA 1KFKA 3FJLA 2BOFX 2A1YA 1AZ1A 1YBQA 4IICA 3HF3A 1XFBA 5BNKA 2NXHA 1FDJA 1S1PA 5CGQA 3IWPA 5LHFA 2WAGA 4GH3A 3F5KA 3UG3A 1TUXA 4JYFA 4QT2A 3NQ2A 3QW4B 5AZ0A 1ADSA 3T2QA 2OT0A 1JPIA 1B3XA 1XUUA 1N55A 3A9IA 1GOXA 3UT0A 4KQZA 2VGIA 1A5NC 2DT3A 1TV3A 3T0TA 4MB3A 2J75A 4JTCA 2MUCA 4NNBA 4LRSA 4Y7EA 2RGMA 3SGUA 4DJFC 3B9AA 1KKRA 3QQ1A 5IHSA 4CQDA 1T40A 3BDKA 3R8HA 4L9ZA 4HA0A 3TP4A 1REQB 3MSYA 4IM4A 1W8SA 3EMCA 3ARYA 4QISA 4W84A 3CZ8A 4YVXA 4HPHA 2YB4A 3OVRA 4XBSA 3INPA 4QLJA 1V6TA 4U4MA 1KV5A 1XC4A 3U2ZA 4JXCA 4L1XA 2C18A 2FJKA 5CCZA 1CB2A 1E6ZA 1BG4A 1NF7A 4LBRA 4IT4A 5C54A 2KFWA 4W9PA 1FD9A 1PX4A 1UPPA 1U5HA 2PTWA 4UZUA 2YW4A 4DLMA 4AXKA 2G3IA 2XSAA 4GACA 1HGYA 1IXNA 4ML9A 2Q02A 1OEPA 4QJ4B 3UBPC 3GVWA 5D9PA 2X7WA 4QG6A 1KRMA 4MWAC 2QJGA 2W67A 3NQ6A 1FUYA 1I45A 4C6CA 3EOLA 2ACRA 2Q8XA 3KBVA 3NNTA 2PDNA 2R1KA 1W9UA 4Z2HA 2RSEA 2D3NA 4KMQA 2PZNA 4S1FA 3VNDA 1PWMA 5G4HC 3PUDA 4DXVA 4TO8A 3GAKA 1DHKA 1FWRA 3CJPA 4R3UA 3WL0A 3N12A 1XI3A 1XC6A 1UKPA 5A2AA 4GYPC 1GEHA 2IKGA 5E6ZA 4KT2A 4UQ9A 4ZEPA 3T08A 3I6CA 3A4AA 3TKFA 1I0BA 2I1OA 1DHPA 1DWIM 3EKGA 4KCVA 4YN5A 2ZA2A 3M5XA 2BVWA 2EAWA 4I7UA 2ZVRA 3HO8A 4XKYA 3LZ3A 3I68A 3RR4A 3BCJA 1R86A 3EOSA 2CCRA 4B9ZA 2DH2A 3WJZA 1ICPA 5A1AA 2PWFA 2TMDA 2N87A 4PE8A 4J4NA 1HXVA 3LBMA 1BXNA 1UR8A 4LAYA 4Z1AA 4CGTA 1FHUA 4ZOAA 2Y5JA 3GBEA 2V5KA 5H8PA 2FVMA 1H2JA 2E6FA 2XN0A 1V7YA 3R0KA 4UBPC 3CPGA 2ZRUA 3VGDA 3E96A 3TEVA 2UZ5A 5IBXA 4CD7A 4F8XA 3T40A 1EZWA 2PSNA 1R2RA 3AXIA 4YIWA 4JQ2A 4DNHA 1WZKA 2EPLX 2XIIA 3WQGA 5E93A 1NWUA 4AHQA 4H9MA 1LG2A 3NPXA 3GE7A 4PUKA 1J2BA 4KERA 4GZIA 1W5MA 2VCBA 3H6OA 1QNPA 3UNDA 2VGGA 4PR4A 1P7TA 3NXLA 3UJRA 5J04A 4DF2A 3KTSA 2XWDA 3AJXA 2INFA 3KCJA 4BEUA 1Q8JA 3BGJA 1U1JA 1MW1A 3WK1A 1H5YA 4W86A 1VHCA 2VC9A 1DJZA 4LUTB 1XGDA 3AS3A 5HT1A 1AW2A 3QTGA 3GDRA 3C52A 1N82A 1Q6RA 3SCWA 1J6PA 1W3NA 4IL0A 4S3GA 4UTHA 4PTDA 4O50A 3VFLA 1FKHA 2GL5A 3H2CA 2GSHA 3O2LA 1LJYA 1JDAA 1KRBC 4ZPVR 2Y7FA 3NDOA 1BWLA 3ELFA 3SIMA 4IT6A 5AZ1A 3TUUA 1IWPA 3L0KA 4DUVA 2DG3A 2PB1A 3SSJA 1NSJA 4KCUA 4LF1A 3BOFA 3U4FA 5CC6A 2DSWA 1K7FA 1L6GA 3HOJA 4JFLA 4Q4PA 5CAKA 3WF1A 1GEQA 2D2OA 4KEUA 2PGEA 1E1CA 2E3ZA 3BAKA 4EACA 4U3CA 3LBCA 3TA9A 3PWIA 3M0VA 3L66A 3RILA 1H7RA 5AECA 2PDPA 1A7XA 3PZ9A 4O1DA 3W7IA 3DKJA 1SFJA 3NPUA 1DQXA 2OELA 6XIAA 3EA2A 1W2PA 1XDJA 1D7JA 1H7OA 4HIBA 4LVDA 3PRDA 1XJBA 2DDXA 4JFUA 3N14A 1BTMA 3DFTA 1XH0A 1O94A 2EGZA 2POZA 1TZ9A 1KV8A 3N2OA 1FY6A 3AMGA 4YU1A 1DVJA 1E40A 3KZ7A 4AWUA 4PL1A 1ZBCA 1YPXA 3TH6A 1NARA 3W1NA 3PY2A 4BF9A 3M5ZA 3HGRA 4H6KA 3RCNA 5AC7A 2WJEA 1D8WA 1SO3A 4GVFA 1YKWA 2L2SA 2AQVA 2RDUA 1KFLA 5HPOA 4ZQNA 4O11A 3GSMA 4JTLA 5AYZA 4US5A 4LX4A 4QG8A 4TUFA 3ARRA 5LGXA 4UXDA 1AFSA 5BMWA 4HYRA 4JL2A 2EJ1A 3DUGA 4OT7A 1XG3A 1V8EA 5D2XA 2XVKA 3S47A 1M7PA 5DRCA 1QCWA 3MMWA 3RXZA 4R9XA 5DIVA 1QVBA 2J27A 3KAFA 3AROA 1Q7ZA 3T7VA 1QK2A 3N9RA 4AWSA 1V6VA 3WQOA 3KAOA 1BWVA 4C6BA 3WQWA 5FJIA 1B3YA 3GNRA 2P0OA 3WNMA 1ISXA 4DT4A 3OLGA 2EBNA 3H4GA 3P84A 3SQMA 2XG9A 2GUBA 3P93A 7CGTA 3BPWA 1TVLA 2PDKA 3I10A 1CXLA 4LANA 2IPFA 4JFWA 4BF7A 2YCLA 3CQKA 2VN1A 2QDEA 4GFSA 3ES8A 1Q3NA 1KTBA 4NG3A 3PANA 4DAIA 1HP5A 2PS2A 3IVUA 4KH2A 1O95A 1KKOA 3NO1A 8XIAA 5KZ6A 4V28A 3CGMA 4HZ6A 4J2MA 4HK5A 2J7CA 2X42A 1AA1B 4MFDA 1HJUA 2ZUWA 1M9HA 3NIYA 2IKIA 2VUNA 4WK9A 3F4CA 5REQA 4LAMA 4GBDA 1NH6A 2Y7DA 2YXXA 3GVVA 3UCQA 3E74A 4GJIA 2PAJA 4DM2A 2DJXA 2XH7A 2G4JA 5I3HA 3O5QA 1XIIA 3C5QA 3VOIA 3WG6A 4AVFA 4CCEA 3VC5A 4JY8A 5A6BD 2BY1A 3S2NA 4GBUA 3N73A 4ZSTA 3AFBA 1NELA 1RUSA 3IIXA 1BSIA 4LB3A 1ZLPA 4HK6A 4XTDA 3TYAA 5TBOA 5HQEA 1OCQA 1KFEA 2E68A 5CJNA 2CWXA 4XVDA 1ADOA 2WKGA 2EXOA 4B16A 4HN4A 4DAFA 1RSCA 2RUSA 4JIIX 2J8FA 1U5JA 3N04A 3ALGA 3LPOA 5ABHA 4QAIA 1EYMA 3LPGA 2QPSA 4C6KA 1E1FA 4UOQA 2ZOXA 3QOKA 5MKGB 1XIEA 3O5MA 1ZFJA 4TW6A 2YA2A 3ORWA 1F2JA 3JRKA 4MYAA 2A3AA 3WSUA 1UYQA 3AZSA 4KIEA 4GO8A 2QJMA 2Z2UA 4N02A 1KW1A 3IJ6A 4D6HA 4XD5A 3WQ5A 2OJPA 1BTCA 1EIXA 1KRCC 1HKMA 5DO2A 2VX7A 5D4YA 5DXYA 1G94A 4ERGA 3TYZA 1ZCNA 1IE7C 4HNVA 2FGZA 2WPGA 3OA5A 3ZVHA 4KEVA 2D23A 4B5NA 6ENLA 3L0NA 3VD3A 3SCSA 4CNTA 2OVLA 2FMNA 1OINA 5G4EA 5EB8A 1V08A 5C55A 1JFXA 3ZVIA 2WNQA 3I4EA 4JTJA 4UOJA 3VAWA 3FAPA 3UESA 3FHQA 2Y70A 1FWNA 4Q4OA 2ZZ4A 2PURA 1XHGA 3VXGA 3V18A 2Z2AA 1FKFA 3NQAA 2DH3A 2XSBA 4B2DD 4DYEA 1LOLA 5EGRA 2V5DA 3ABXA 2YA0A 1O5RA 4QEHA 3UVAA 5JXQA 1I2PA 2C3ZA 4XBJA 1EDQA 2J8GA 4I6KA 1TIWA 1G01A 2RQSA 1BAGA 3OZMA 3TIMA 3PBWA 5E0KA 5DLCA 3BUVA 1N7KA 1Y8BA 2D0GA 3CUFA 4O1AA 3OEXA 4UTKA 3P14A 3H54A 2CETA 4QDMA 3W1TA 1E9ZB 3CEPA 1JNEA 1BYCA 3ZQ9A 2H8XA 2VR5A 1I0DA 3CIXA 1KFJA 2X0YA 3W53A 1W0MA 3CB8A 1L6WA 5REQB 3T4WA 1DJHA 4E38A 5DEZA 3DHFA 3QY8A 4JX6A 1YLVA 2VNCA 2R8WA 3BZGA 4G2PA 1KCZA 4MKVA 4FLOA 1EGMA 4TX9A 4YMZA 5A8NA 2PWUA 3WDRA 1OB0A 3QQ0A 1BVZA 4WKAA 3UWVA 3VIKA 1UG6A 3IGUA 4KR0B 1Q13A 1YPFA 3PAJA 5DY3A 3EMZA 2QAPA 1L8NA 2KE0A 3V35A 3OIXA 3W3OA 4E4FA 1G4TA 2GGEA 3FDGA 1QMLA 4E3TA 1FTXA 3K13A 4LUSA 4HPXA 3W27A 4AIBA 5KETA 3SIZA 1OY0A 2FZNA 1QOPA 3LU2A 2LJ4A 3H2OA 4DJEC 2QCEA 4DXXA 1OYCA 3KEHA 4K8EA 3MHFA 1XDLA 1PV8A 3AIRA 1EJXC 3OP2A 4OECA 2C16A 2G96A 1JDFA 1X98A 4M6UA 3E2SA 4XO7A 3KRZA 4FIQA 3GZ3A 4N9DA 4FX6M 1SR9A 3O5KA 5A6SA 3NL6A 3W81A 1E9LA 2D69A 4GZ7A 2P3EA 1LM1A 1GYLA 2XPAA 4S3KA 4O8RA 1RY0A 1VFOA 4NQ1A 2FPTA 4JYEA 4PUDA 3IJLA 4OUIA 3HGOA 4DB7A 1XH1A 4RCXA 3H2AA 1W3LA 3R2GA 3E12A 2FZ8A 2G0WA 2IKJA 3P5ZA 3W1XA 3KW3A 3PPGA 4N2YA 1SVDA 3AISA 3L5LA 2CLFA 4I9TA 2YL5A 3GC2A 1LT8A 3GTHA 1XM3A 4LYKA 3GVQA 3TJLA 1RALA 2NZLA 4LFYA 3WELA 4TIMA 3RN6A 3TYDA 1S5WA 3AXKA 1XINA 3E0WA 3LV6A 3SI9A 2YCLB 2C1IA 4I3GA 4MB1A 3RM8A 3URBA 3FYPA 4BY3A 4MNMA 1V03A 2C0AA 4Y9NA 5BRQA 4Z2KA 4RDYA 4QBXA 3SGGA 4UFLA 3LPFA 5I02A 2DFAA 3MYOA 3N15A 4UCFA 4FXFA 1U83A 4MB4A 4GGHA 4XKYB 4TQTA 2ISWA 4XUGA 3VAVA 3ITGA 4JX4A 2WSPA 3MSRA 3W7KA 2ESCA 4DBUA 2JEPA 3BLEA 2DSZA 3VOCA 4JOMA 4DWSC 2PP0A 1XCXA 1NWTA 1V3HA 2WHLA 4MZ8A 3UZ5A 3PTMA 1WUFA 5CJMA 3BW3A 2ZX6A 2CERA 4O53A 1OFEA 1OHLA 3UZZA 3GC4A 1AL7A 3IHZA 2OZ0A 1QBBA 4NAFA 1HJSA 3V4BA 3H2MA 3A64A 3B05A 4MY1A 4FI4A 4E2DA 4AG0A 4GUIA 3HJZA 4M3PA 5B80A 1FRBA 4UWMA 2PD9A 1DIKA 1WYIA 2BSLA 1M41A 3UJ2A 3GNPA 4B4FA 4MF4A 4PRTA 5I98A 2RDTA 5ABFB 2ABBA 5HNUA 6XIMA 3IACA 5TAOA 1SO5A 1V0LA 5M1TA 1H0IA 3WQFA 1LBFA 3MMUA 2DVTA 2OYMA 4A6GA 3BAIA 5C9XA 1HKKA 3KDOA 3SJ3A 2FZMA 3K1DA 1S2AA 1S5NA 3UGVA 1MZHA 4WQ6A 3LPPA 4B5TA 4QJ3B 5GJPA 1XFCA 3AS0A 4AZGA 4ZOEA 4AB4A 1NFBA 5HJYA 2OSXA 3FHAA 1E4NA 3IGHX 1DJQA 2O56A 3DBPA 2PLCA 3D3FA 1ZJIA 4RK8A 5J6EA 1FHLA 2R1MA 4WOZA 4IWWA 4W7UA 4UMBA 5AYYA 3N2CA 1KM1A 4XZ9A 3VUPA 4IIDA 1ITQA 5FJTA 1EX1A 4RNIA 4ICCX 4GYKA 5DN1A 1M1BA 1NMWA 2Y2WA 1VBHA 2HNEA 2WNWA 4GYJA 4QITA 5EPDA 5C8BB 4IQ2A 4FP1A 2V2HA 1LBMA 3VIHA 2VRKA 5G1YA 1HKVA 4O0ZA 1K6WA 3N6JA 1A0DA 5G2WA 3K30A 3RM9A 5A8QA 1YQ2A 2GGHA 3TXVA 4GIAA 4N6EA 1SM9A 3DG3A 1E44A 1KM4A 1O66A 4IZGA 2WBGA 4J3ZA 1GCYA 4LYRA 4WX2A 1VFMA 1OFDA 3EWZA 1A4MA 3FIGA 3FW6A 3NSXA 4N9BA 2XP8A 3W0KA 3EWYA 3G77A 3VILA 4D8LA 1HL2A 1PVNA 4C02B 4BQ4A 4Y9MA 1JDEA 1O60A 4PFMA 2GLKA 3B04A 5CPQA 5JIWA 4IPPA 5C9UA 1WBHA 4CUCA 3S9IA 1B9BA 3LTPA 2VQUA 4OFCA 3E0VA 2VMFA 4JFJA 1QPLA 1K4HA 5A6TC 2GWNA 3IUIA 1MEWA 3L5AA 3P82A 4GPNA 5EA9A 3OBAA 5HK4A 1PKMA 1RJQA 5E0CA 3MMDA 2OPJA 5SWUA 1K8ZA 4A05A 2ZZ2A 1UBSA 3A3WA 1ME9A 3VIPA 1KBBA 3EOUA 4GUJA 4ZO9A 3AWOA 3E38A 4JQ4A 2OT1A 3U7BA 2AQWA 5G2IA 5D8WA 4LPCA 3UZYA 1KRAC 4L4OA 4Q4QA 3ARXA 2EKGA 4BF8A 1BYAA 3BOLA 1LL7A 2YLAA 3KOZA 5CAHA 2OG9A 2ZIDA 4GH1A 3LMZA 5HJLA 1AQFA 5F2MA 4GNKB 2I5IA 4MB5A 4LBUA 4NI3A 1UQYA 3LSBA 5I6SA 2WKLA 3PSVA 5M2FX 1DJIA 5C7HA 1A5AA 3QC3A 3W4RA 3C0JA 2AOSA 3TDBA 3WEMA 1QPFA 3ABQA 1R9XA 3N2XA 4DUWA 3E2RA 3MCMA 2ISDA 1U1HA 4NF7A 5EKYA 3CV7A 5CZSA 3RAOA 1FWTA 5E6YA 4AZ5A 2Z6JA 3GNXA 4F0HA 4Z1DA 1PX3A 2CBJA 4I7VA 3STFA 3W76A 1GNXA 1TTPA 4EAYA 1BQCA 3OLDA 2XIQA 4WCJA 5C71A 2XH0A 2AMXA 4QROA 1NMVA 3KTCA 1PO9A 1WZMA 4GI8A 2ONEA 3CYVA 2RGLA 1G4SA 2JKEA 3RR1A 2YXGA 2GYIA 1IXQA 2ZTKA 4JTIA 3BL3A 4MFEA 4XD6A 2XIMA 2XN1A 3SJNA 3N4EA 5GNXA 2O7SA 2PPGA 5I23A 2DIJA 1EB3A 1QR7A 2OOFA 3WQEA 2JK2A 3SECA 1VC4A 2QMKA 1XUZA 4L61A 1DKWA 4NSBA 2WKJA 1O6IA 1XIJA 1VYPX 3PR2A 3IVTA 3ARUA 3E5BA 4KCTA 3VCRA 3L65A 1F3WA 4K38A 1IZCA 4R5EA 3U48A 5I3IA 5HQLA 4M80A 1BRLB 4GY7A 4IPXA 4HA4A 3GFYA 3XINA 4Q8VA 2Z1XA 4ATDA 2DW6A 3R5EA 5HNTA 3RPDA 5HKGA 2YGYA 3BJSA 1UJPA 1EJ7L 3DHPA 4GYFA 1Q6QA 2IF4A 1XYAA 1KFBA 4ZA0A 1YYAA 4IQDA 3KM8A 4K7VA 4A29A 5CLTA 4ODOA 1UWAA 1U5VA 3MWAA 2PDWA 4LVBA 3CHEA 1A3XA 1SPQA 1T41A 2G4FA 4IGNA 4V2XA 2OSYA 1NIUA 3RLVA 3H55A 3NEHA 4B5XA 2EPHA 2HCVA 3UYCA 4G7EA 2X1IA 4Z08A 4JNZA 4OVXA 3TYEA 3CO8A 4AISA 2QHAA 4UTMA 1FWFC 4L5ZA 5D9OA 4LAVA 1LRTA 3BMXA 4CQ8A 1EC8A 4WRHA 4JX5A 4LY4A 4P5UA 3T2PA 5XINA 2XH2A 1W1B1 4WXZA 4NVTA 1LROA 4A22A 2JGQA 2BHZA 1KGUA 3S2CA 4B91A 1JYWA 3QR0A 1QZ2A 1J8VA 1L6SA 3U3HA 5HPCA 4UTLA 1SZEA 2FKPA 3O5FA 4E4UA 1I2NA 4FX7A 3VMNA 1B6CA 3P2VA 2R1NA 1W54A 4PCTA 5D9MA 1W56A 1N2VA 3GH5A 2A3HA 1KC7A 1ICQA 4X60A 1F4HA 1TWWA 5K3VA 1E55A 2DV0A 4J2PA 4LXFA 4QCEA 3G1SA 2ZTJA 5CG0A 2F23A 3URNA 4W89A 2ITKA 4QHRA 2V3GA 5HNNA 1R2SA 2R24A 1R47A 1J0JA 4IT1A 1E0WA 4HSHA 2HE5A 3AMLA 5MF5A 3PZQA 1TCMA 3BSGA 5LIYX 3BLIA 5I2UA 3LLDA 4GKTA 4Z2JA 2OEMA 4Z42C 3LB0A 4H8HA 2DSKA 4QQ3A 4ZXLA 4FAMA 3RCMA 1Q6UA 2Y89A 2YCKX 2B31A 1J5TA 2P53A 4HMCA 3SGZA 4DRIA 3EB3A 1HJQA 2E25A 2PU1A 5LXEA 2V5LA 2D3LA 1EJVC 4GXWA 2BGQA 1XPYA 5CPLA 2EPKX 4ZTXA 4O52A 5HAOA 1RHCA 1TX0A 2PTZA 3LYEA 4GQ0A 2X7VA 3LCGA 3S2JA 2GJRA 3W75A 4DBDA 3WH5A 2XPKA 5ENLA 1HKJA 3GNOA 3LHVA 3FCPA 1F5ZA 3DG7A 3NFUA 1MEHA 2I57A 1IGSA 5JBDA 3D6NA 4LF2A 3ARWA 2CHNA 4ZSUA 1XIMA 2J9XA 1AMYA 3ZJ8A 3CTTA 1ZCCA 1JCMP 3O3RA 1XRTA 1I60A 4RNJA 5FAGA 3NO5A 2UZ9A 4GCAA 4XSLA 3I6TA 4GGQA 5D38A 4KEMA 5BZAA 5LA2A 4QCFA 3KABA 2BODX 2BXVA 3GX9A 3REQA 3RPTA 1QRQA 2CIPA 3TDFA 3GYCA 1HX0A 3NVDA 4E8DA 5BWAA 3GG8A 2E4TA 4QG9A 2V63A 3LCWA 2X8RA 3ID7A 3C2VA 1NDYA 4FNUA 4W4QA 7ODCA 4DJFD 1F6KA 4H04A 2CESA 1EWEA 3VNZA 2V9DA 4AZCB 3AUOA 5AC8A 2VYOA 1B0IA 1E0VA 4C65A 5FEPA 3T9PA 1J4RA 1UD3A 5MKGA 1Z42A 4NX0A 4L72B 4C5ZA 2BZNA 1F6YA 1RJPA 1DIEA 2QS8A 3M41A 2DVXA 3OG2A 5H6HA 3AI0A 1GJWA 3NL3A 3UI6A 3F4WA 3THCA 3JUGA 4C6NA 1UZ4A 2ZRZA 4JIHA 3FEMA 4JQ3A 3Q4DA 3LHZA 2E5DA 4NZ3A 4OOZA 3ATZA 3WNPA 2Z1KA 1P6WA 5CH9A 4BS0A 5A6LA 2J77A 2BDQA 4UFIA 3G5EA 5D9NA 1EEXA 4XZMX 1ECEA 3U57A 4QE5A 3B8TA 2Q01A 2WZMA 4J3SA 4PMQA 1UC4A 2NW0A 4L9XA 5AOUA 3UU0A 1DIOA 3S1UA 1NVMA 1X6LA 3QKEA 3HQNA 3M7WA 3STCA 3IVSA 2J7HA 4QS6A 4EKJA 3CO4A 2QUVA 1NF0A 1JAEA 3FFSA 3C3NA 4IFOA 4W93A 5HQMA 3RO6A 3A5FA 1FWWA 3R58A 2ZZ1A 3W6YA 3NQ8A 2G41A 1QNRA 3HB9A 1S38A 1HP4A 4U10A 3TTYA 1B90A 4KETA 1WKYA 4CNNA 1R8LA 1TPVA 2C15A 2GQ3A 3NQEA 3R25A 2IXUA 3NTYA 2FTWA 4CD4A 4TX6A 2ZQTA 4TX0A 4POCA 4HMDA 3ALFA 4YXGA 1YW1A 2DEPA 1T99A 4ML4A 4GISA 4RKAA 2HE8A 3DFPA 1I1WA 1BKSA 3WDPP 1H61A 4HU3A 5HWJA 1E15A 3LLFA 4ZQOA 4KESA 2VKZG 4NX5A 4RE2A 4XUYA 2OYLA 4AEEA 2GQ8A 1NJJA 3MY9A 4F2BA 3NM3A 2CPUA 4PGLA 2PBGA 5IOBA 1WOAA 2XTKA 3KLLA 1E4MM 2V3FA 1KA9F 4IUGA 3UEQA 2J88A 5AFDA 2GJPA 3VE9A 3APYA 3IAQA 1ROUA 1EWDA 1P4CA 3RPMA 1J79A 4AIUA 2P8CA 1XRFA 1SZNA 4AX7A 3NZRA 4Q8OA 4IGHA 2XP3A 3QMTA 3GC5A 2IPWA 5E09A 4S3EA 1V3MA 3TVAA 4HCHA 5FJOA 4Q32A 1SZFA 3CQ0A 3LGGA 2M08A 4KIRA 4CCZA 1QHPA 2QDDA 1E72M 2QPXA 4A8LA 4LAXA 1OK4A 3ZSSA 3AHYA 3UERA 4YL2A 1WDSA 4R85A 5D8ZA 4Q8WA 4J9JA 2CLPA 1IEWA 3N6HA 1GYMA 4Y90A 4C7FA 3ANYA 2O55A 1XW8A 3H9RB 1S2UA 4GWEA 1S5TA 4TTGA 1BWKA 1GOKA 2VHLA 1L2QA 1ELSA 4KQNA 3ZFHA 1ZCOA 4P2VA 2QW5A 4FSAA 4WDXA 3EPNA 3CYJA 5BROA 4XZNX 3K5XA 1KQZA 1TREA 3VGBA 1K7XA 2FFCA 1K02A 3S46A 1E51A 1M3UA 1O1HA 1CI1A 3UWWA 1ZJAA 3EX6A 3LHUA 3M0HA 2FB3A 2YCJA 3GR7A 4TMBA 1JPDX 2NV1A 2I16A 5BMXA 1TVNA 1CXKA 2ZUVA 3T78A 2J62A 1H7NA 1IX5A 1VLIA 4DUOA 4TVUA 2MF9A 2XSXA 5CZKA 4OBRA 3IGXA 3BCFA 5B7ZA 1TJRA 3P67A 3P60A 3NJ3A 1BHGA 3BH4A 1JUEA 3ZWTA 5CBIA 1E6RA 2G97A 3WMLA 5LNWA 2QXWA 1ZQ5A 3AC0A 1JZ6A 3GD6A 3QV9A 1TKKA 1A4LA 2VEPA 3PBYA 1KFCA 2PDLA 3BSMA 4O18A 1DL3A 1KXTA 2XHYA 1F7BA 2OFNA 5IFPA 5FKYA 1JCXA 4K1GA 1S1RA 4MAZA 4BQ5A 4D8ZA 4AFYA 2W63A 4UTJA 2XP6A 1ZS2A 4KFPA 1DWAM 3BAXA 2CLIA 1UWRA 4Q3MA 3AHZA 4DNMA 3SAZA 3A3HA 4AF0A 2DZWA 3GHRA 4HOZA 2WPBA 4H19A 3O07A 1S5VA 1SZRA 4PA8A 2TPSA 1JZ8A 3EB4A 3F7JA 4KF1A 4AX6A 1VKFA 3A4JA 5TQLA 3G1XA 1WOBA 2AAMA 2Y4SA 4NT0A 3PJUA 3KADA 3O1NA 2POTA 3DCPA 4ACYA 5LKYA 2YL9A 2CW6A 1BL4A 2ZUTA 3HN3A 1HKIA 4INFA 4K37A 2DZVA 2BX7A 4H7VA 5FSEC 4A3HA 1EA9C 4O28A 2Y5EA 1OABA 2B7NA 4GXMA 1OWQA 3G18A 1UA3A 2NLIA 4WJ8A 1ODZA 1UWIA 4D8AA 1FOBA 3WENA 1M01A 4RDVA 2OODA 2OB3A 2XZ9A 2HVMA 1GW1A 1F40A 3GB6A 4C6MA 1WUEA 1ITCA 2Z27A 2WVVA 2XGZA 3UG5A 3WLJA 3PRBA 2OOGA 3QMRA 2GWGA 4KFNA 5LHEA 4O8AA 4S3AA 3EX2A 3LA4A 4JKKA 5LYRA 3G22A 1JGMA 1LWHA 4JTGA 5G5IA 4JIEA 3URQA 4LWWA 4UQCA 2ZXDA 3NQ7A 2CYGA 2BOGX 1GONA 1TPC1 1UD2A 4LAUA 4JL1A 3BCDA 2PPPA 2E9LA 2A3BA 4LVFA 3O5DA 1FWHC 1XISA 4IIGA 4F79A 3PC0A 4GINA 1LUCA 3HPXA 1VBGA 1Q6GA 3RGCA 4AIOA 3WH8A 3LD5A 4I5UA 3V1PA 5IDZA 1D7KA 3LCHA 4NJKA 4ADTA 4NILA 1Z6KA 4FEZA 4W9QA 1QI3A 3AICA 2WMHA 2ABAA