4MAVA

Crystal structure of signaling protein spb-40 complexed with 5-hydroxymethyl oxalanetriol at 2.80 a resolution
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
361
structure length
361
Chain Sequence
YKLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYSFANISNNEIDTWEWNDVTLYDTLNTLKNRNPNLKTLLSVGGWNYGSQRFSKIASKTQSRRTFIKSVPPFLRTHGFDGLDLAWLWPGWRDKRHLTTLVKEMKAEFVREAQAGTEQLLLSAAVTAGKIAIDRGYDIAQISRHLDFISLLTYDFHGAWRQTVGHHSPLFRGNEDASSRFSNADYAVSYMLRLGAPANKLVMGIPTFGRSYTLASSKTDVGAPISGPGIPGRFTKWKGILAYYEICDFLHGATTHRFRDQQVPYATKGNQWVAYDDQESVKNKARYLKNRQLAGAMVWALDLDDFRGTFCGQNLTFPLTSAIKDVLARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase-3-like protein 1
publication title Crystal structure of signaling protein SPB-40 complexed with 5-hydroxymethyl oxalanetriol at 2.80 A resolution
rcsb
molecule tags Signaling protein
total genus 121
structure length 361
sequence length 361
ec nomenclature
pdb deposition date 2013-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mavA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mavA01
2XYLA 3POCA 4OBRA 3VIKA 3WD2A 4EE9A 1X6LA 5C8BB 1OB0A 3L4XA 5CLWA 5ABFA 1GJWA 3PZIA 4WIWA 3LMYA 1CNVA 1MW1A 3L4YA 1BLIA 2YJQA 1J0KA 4YPJA 2WVSA 5CLTA 3AYSA 2CHNA 3CHDA 4BQ2A 5LA2A 4AEEA 1UKTA 2XFYA 2ZUWA 4CCEA 2EEXA 3EDDA 1V0LA 1VFFA 3MU7A 1TCMA 2FHFA 1NWRA 2VL4A 2JE8A 2J4GA 1LQ0A 3CZGA 3N18A 3AS3A 2YL9A 5JBEA 5GNZA 4ZEPA 2BHYA 1EDGA 5AY7A 2HVMA 1XSKA 8A3HA 1XH0A 3ZOAA 4F9DA 5A8PA 3ARRA 4M24A 1UKOA 3VKKA 1DHKA 4AWEA 3RM9A 1W3LA 1B3XA 1H0IA 1PX8A 1FHLA 1JYVA 3B9AA 2GJRA 1K9TA 4D6HA 3N1AA 1PZ2A 1W9XA 1DWHM 1J0IA 2NT0A 4IM4A 1Q4NX 3BC9A 3BCDA 2WVUA 2VUYA 5A1AA 2Z1SA 4OOUA 4L4OA 2E9BA 3HJEA 1CTNA 5A8OA 1E1FA 1CXLA 3F4VA 2J7GA 4OOZA 5GQBA 1JDAA 1XV8A 2WWDA 3ZSSA 4W85A 1C8YA 3K46A 4HOZA 1KGXA 2BFGA 4QAWA 3UEQA 2J25A 1E4IA 1JZ4A 4OZOA 1OBAA 3KL3A 4D1JA 3N15A 4CU7A 4H2CA 3W38A 1C8QA 4D6EA 5A2CA 3WNPA 3SCWA 3CIVA 1XCWA 1PPIA 5FL1A 1GOKA 1KGUA 2O9TA 1BYCA 3CUIA 5DF0A 5CJ5A 3WL0A 4C7DA 1V0NA 1XH1A 3ZJ8A 1JZ8A 2XFRA 4CD6A 3AS1A 1V3JA 4CGTA 1ODZA 4X9YA 1GVIA 3VDBA 1IV8A 1UKSA 3T0DA 4D6FA 1LWJA 3GBEA 1LL4A 3AXHA 1QI0A 4OJYA 1UHVA 3BSHA 1JAKA 3T2OA 1K9DA 3AICA 1I75A 2Z1KA 3W24A 2ESCA 4AZCA 2VNCA 3A4XA 1QI4A 4J3TA 4KH2A 5A69A 3TA9A 1HL9A 4DUXA 2E8ZA 4YN5A 1GJUA 3M46A 2DT0A 2WYSA 1K9FA 1BYDA 2D0FA 1W1PA 4W88A 1QBAA 1FH8A 4UNIA 5A6AA 4H7VA 1UKQA 3IK2A 3EDKA 1D2KA 1DEDA 1ESWA 1DWJM 3ZT7A 1BSIA 4AZBA 3CUHA 3MANA 3L2LA 1E4LA 3BXWA 5EFFA 1E6SM 2Y24A 5CQ1A 1NQ6A 1XD0A 1WNOA 1EQPA 1UR9A 1GQKA 1HJSA 1QI3A 3AHVA 3VIHA 3B8SA 4J28A 4H8VA 1V0KA 2IUZA 4DUVA 3PTMA 4CD4A 4CN1A 4AD4A 4V2XA 4QCFA 1E55A 2CEQA 3SCTA 3AS2A 1E6NA 2J75A 3A3HA 1V3MA 2AMGA 3SUWA 1ZS2A 1WB0A 3ARSA 1DWFM 1B9ZA 3O6AA 4F79A 4PUDA 1QNQA 5I24A 3AI0A 5IHRA 1GHSA 4P7RA 4CU6A 3ZSTA 3WNMA 4MB4A 2XGBA 5A8QA 3VTRA 1OM0A 2J7FA 4FF5A 1HKIA 5AC4A 2UY2A 4J3VA 2WMIA 4IISA 1HP4A 3SCNA 1MXDA 1HNYA 1CIUA 4PMUA 5E0CA 1V6YA 1UH2A 1ZJAA 3FN9A 2ZWYA 1HKMA 4JCLA 1QW8A 1Q6DA 3M7SA 4PCSA 1US3A 1H41A 3CZKA 1KWGA 4NRRA 1ISVA 2GJXA 1UA7A 1QI5A 3MUY1 4ZE5A 4PMZA 1W9VA 3AIUA 3AZTA 3WH6A 3EDJA 1GQIA 2DH3A 4V28A 1BAGA 4BQ4A 2CPUA 2GFTA 5D9MA 2WHKA 1J10A 3AZRA 5LA1A 6CGTA 2VX4A 2FDMA 2WAGA 2G3MA 3VNYA 3PHAA 4P7QA 2EPKX 3CH9A 2D1ZA 1VEPA 3K8LA 3OZPA 1TR1A 2XG9A 3AMGA 4JKMA 3OLIA 1HJXA 2E8YA 4QLKA 2CIPA 3BAYA 1CGUA 1VEMA 2YA2A 3AISA 5CPQA 3IANA 3T2QA 1R7AA 1TUXA 4IUGA 2O92A 4ML4A 3UETA 1W1VA 3PZMA 2YKKA 1UH3A 4ZE4A 2WWCA 1HN1A 1JZ7A 1LG2A 2OSYA 4CUCA 2OSWA 3WQ5A 3OLDA 2VCCA 1JZ2A 2JF7A 4IPNB 4B9YA 5AYIA 5M03A 4HZ8A 1WO2A 3FAWA 3G6MA 2F8QA 2JALA 4UQEA 2PBGA 2GJPA 1OGSA 1C7SA 2GUYA 2YL6A 4GI6A 4D6JA 2J7HA 3VX0A 4XX6A 3TTOA 3TOPA 3K8KA 2V5DA 5HNNA 1GCYA 4U3AA 3AROA 1L8NA 1Y7VA 2WLYA 7A3HA 3PZUA 1NOUA 1UKPA 2UY3A 3WQWA 2Y2WA 1B31A 3KEHA 3ZR6A 4ZXLA 3QGVA 2A3AA 3QOMA 3AXIA 4S3KA 1W9DM 2WHMA 4NI3A 3WNNA 1E71M 3SUSA 5F7UA 1MYRA 5BXRA 1NOWA 4UOQA 1HJQA 2RGMA 3CMJA 3GZAA 3BAJA 1OD0A 1TA3B 3CMGA 2X2YA 4UFHA 5FD0A 1JIBA 3KL0A 1G1YA 4W5ZA 4B3LA 2XIBA 3KE0A 3MSGA 2DPEA 2WLZA 4AMCA 1BYAA 1ECEA 4PMVA 2QF8A 1E0VA 1M04A 1HIZA 3BMVA 4LYRA 1US2A 1UD3A 1Z32X 1W9BM 1JDCA 4KWUA 1BG4A 4A3YA 4AYSA 3WMSA 2VR5A 1GOOA 1ODUA 3EYPA 4QCEA 3VD7A 4EANA 4TXEA 4HA3A 3KWXA 1M53A 2JEQA 5C70A 4TTGA 3W4RA 3ARTA 1QHOA 3UERA 2V3GA 3VMNA 1PX4A 2WANA 3GXFA 4NF7A 4AZ7A 3RM8A 4PCTA 5BYWA 2ZX6A 3LPGA 4BF7A 1SYTA 2CBJA 1B30A 2V38A 1WKYA 2VX5A 2EPMX 1GQLA 4URIA 4BZYA 2BVYA 4XZBA 4GPNA 3CLWA 1BGAA 7CGTA 1UR8A 1JNEA 1LLOA 2VI0A 3PZNA 2YDQA 1Q6CA 1JZ6A 3DC0A 2VT0A 5M5DA 4XV0A 5D9NA 4CD5A 3WFZA 2VRKA 1LL6A 4WSKA 1CXIA 3BCFA 5JBDA 1JD7A 1R86A 3N11A 1PJ9A 4HPGA 1WZMA 3TONA 5KZ6A 4PTMA 1NWTA 5A2BA 2GDUA 2AAAA 1MW3A 1UWUA 2E40A 5KEZA 3A6OA 4FLQA 1CGWA 1UWRA 2XVLA 2PWGA 5AC5A 2WMGA 3BH4A 1FP8A 3WD3A 1ZBCA 3GDBA 4BA0A 4CCCA 4M29A 1QW9A 3PZTA 1MQQA 4MADA 4P8VA 1XYFA 1BGGA 1JG9A 2VZSA 2VC9A 2WHJA 4D6IA 3GNOA 4PMQA 2ZX7A 4Y7EA 2DSZA 1AQMA 1HT6A 3CBWA 3BAWA 4HTYA 2EBNA 3FNDA 4HZ7A 2BY2A 2V3DA 1WZAA 3TTYA 3NJ3A 2VZVA 4NZCA 2X09A 3WNLA 2YLAA 3OG2A 3SCQA 1W2VA 1OD8A 4W7VA 4UZSA 4MNJA 2D3LA 1W2PA 4CD7A 1SMDA 2A3BA 2W67A 3FHAA 3BAKA 4GKLA 3N04A 3LPOA 4W86A 1WDRA 1WZLA 3NSMA 1CEOA 5E09A 3SUUA 2BVDA 1W1TA 1FH7A 3THCA 1VEOA 4W89A 3M6DA 1H11A 4MNMA 1X6NA 1GOMA 5DFAA 1EA9C 2PWEA 4J7RA 2JIWA 1E3ZA 4WKFA 1G5AA 3VGDA 1BVZA 2DSUA 1YHTA 3BGAA 1XSJA 1QNRA 4MNKA 2BHUA 1H4PA 3AMCA 3WL1A 1XYZA 4LQ1A 5FOOA 2ZUMA 3FAXA 4K68A 5LYRA 3VGEA 3WDPP 1GORA 2VVNA 1UG6A 2XVNA 4UFIA 4F66A 3VIIA 1VENA 1CGYA 3A4WA 1I1XA 1VAHA 3VM5A 3WDIA 3AHZA 2WZIA 2EPLX 4FLRA 4AD3A 3L4VA 1FP9A 2DSVA 5HBFA 2BY3A 1B3VA 1RD6A 2J8FA 3N13A 5BRQA 4MJ4A 3NUKA 3WUGA 1J0JA 5FIPA 2QMJA 4MTVA 1KBKA 3AMKA 3ZJKA 3WMCA 4UQCA 2CKRA 3EMZA 5BWFA 2PWDA 2ZUVA 4JHZA 4LYQA 3PZGA 1WAWA 2ZXDA 4TUFA 3VMOA 3POHA 3WDQA 1CXHA 1KQZA 3AMDA 3WFLA 3VD5A 1E1EA 2GK1B 3GH5A 3AHYA 1AQHA 1V3IA 2WXDM 2UY5A 1OIFA 1H09A 2FHCA 1H1NA 2CETA 3W53A 3W29A 5BXSA 2XM2A 4B9ZA 1J01A 4UOJA 5M3WA 5CSUA 1EOMA 2XUCA 2F2HA 5IFTA 3OZOA 4BQ3A 2OWCA 5HPCA 2VZUA 2J7BA 4PSPA 2G41A 3W28A 3ARXA 5I0DA 3WIJA 3HN3A 5JIWA 4UQ9A 2V3EA 3AFBA 1E4MM 4AZGA 4BQ5A 1PIGA 3WDHA 1LWHA 2HISA 3SUTA 3WQ8A 4AC1X 5I5RA 4ZXOA 1XRVA 1WE5A 2X0HA 2VRQA 5ABFB 1CDGA 2DH2A 1IT0A 5I2UA 2RGLA 1UWTA 3ARQA 4R5EA 1D7FA 3ZIZA 3WF4A 2YIHA 2VRJA 4Q22A 1B2YA 1E72M 1VJSA 3PZQA 3ALFA 1KWKA 9CGTA 2D3NA 3PBGA 4P7NA 2IXUA 3WD1A 3CUFA 1K9EA 4OBSA 6A3HA 4Z2JA 4PMRA 4W93A 3AOFA 5DO8A 2ZUNA 3UG3A 2MANA 2WPGA 5I78A 3ARPA 2WC3A 3DHPA 5A8NA 4E8DA 4UQDA 4Z2IA 4DWSA 3AJ7A 2PI6A 4PSRA 1BVNP 3CUGA 3MMUA 1NARA 2VX6A 5JUVA 2DQXA 1C8XA 1TFVA 4AW7A 3VGHA 4ATDA 2OSXA 4JCMA 3FY1A 2EXOA 3U57A 5A6BA 1HVQA 1BYBA 1KR0A 1UYQA 3W82A 3VMPA 4BS0A 1GQJA 3MKKA 4GI9A 4WJXA 1QNSA 2CYGA 1UQYA 2QV4A 2EPNA 3S2CA 3WUBA 5BXTA 3OBAA 2BXYA 4C7GA 5A6MA 2ZWZA 3BAIA 4JFSA 4AZIA 1CWYA 4RE4A 2BXZA 3ARWA 1XGZA 3ZO9A 3WH5A 5DT7A 1KXVA 5E70A 5I23A 4AD1A 4M81A 1KQYA 1XD1A 2CBVA 3OIHA 1K6AA 3ZJ7A 4XUYA 4AISA 1UR4A 1UWQA 3WBEA 4PBGA 2C7FA 2YDRA 1QI2A 1GNXA 1B1YA 3AIQA 3GXIA 4LYPA 2AOSA 3UG5A 2ZICA 1DWIM 4HZ6A 4CN4A 4W8BA 2PC8A 3QHOA 1GZJA 2EPOA 2E9LA 4W87A 3BSGA 2OWWA 5A6KA 4AZ5A 2D0GA 2VQTA 4P8WA 1J18A 3MUZ1 3VU2A 3NDZA 2W92A 3UESA 1B3WA 1R85A 4PRWA 1HKJA 2DSKA 5EMYA 1ISZA 4AD2A 4JFVA 1G01A 2DEPA 3NYDA 2O9PA 4IPLA 5HDRA 4B16A 4MB1A 1V3HA 1QNOA 2VJXA 3IAPA 5D9OA 3QOKA 5GPRA 3RDKA 5E6YA 4CVWA 2GSJA 4U2YA 3RM4A 2WKGA 5CGTA 1E9LA 4PMDA 3WEOA 1UR2A 1WCGA 1M7XA 2F61A 4W5UA 2YDSA 4W84A 4UFLA 5D8WA 1AVAA 3WMBA 3PZ9A 1V08A 4R27A 3VIMA 4AZCB 1E40A 3WQ6A 3SUVA 3HMCA 3MV01 2OYKA 1WP6A 1GOIA 1V03A 3IJ8A 3VUPA 1HP5A 1MFUA 4AD0A 2VQUA 1OT1A 4EK7A 1B3ZA 3N12A 4FK9A 1TZ7A 3CUJA 1E70M 2DGAA 2W61A 1JFXA 1V6VA 3W6MA 5CPSA 4TTUA 2OYLA 4GQRA 3WQ4A 4X0VA 2D23A 1V02A 4Z2LA 1M01A 4LGXA 2WVVA 1JXKA 2PB1A 2J7EA 2XVKA 2J62A 2V3FA 3WH9A 7TAAA 4E4PA 3K8MA 5FL0A 3TP4A 4PUEA 2X0YA 1A3HA 3GNRA 4DM1A 1GONA 3KL5A 4FMVA 1W9UA 4UCFA 3ZT6A 5I6SA 3EMCA 4U3CA 3L4TA 2FH6A 4L4PA 3T08A 3TTQA 1TE1A 4CKQA 1DP0A 2WMHA 1JF5A 2GVYA 3GYCA 4UR9A 3ZM8A 3A47A 1CLVA 1WDPA 5IDIA 2FGLA 4GQQA 4PTXA 3DYPA 1VFMA 2ZX5A 2WC7A 2XWEA 1NP0A 3AHTA 4B15A 2WMIB 1UD5A 5JIPA 3T0BA 3WUEA 4CU8A 5A95A 2A3CA 4JHOA 1HJUA 2WMJA 4P7LA 1LJYA 1V3KA 4BCEA 1I1WA 3UR8A 5GNYA 3WD4A 2W66A 4MB5A 2QLYA 4U31A 3DHUA 5ABEA 1ISXA 1BQCA 3IJ7A 2GJXB 1V3LA 1PAMA 1KCKA 3RJXA 1XHGA 2X05A 1FFQA 1E0WA 2E4TA 1MW2A 4UZUA 2QPUA 3ZT5A 1VBRA 3VDCA 3VIGA 2W62A 3VOCA 2G8ZA 2CESA 3QHNA 1KXQA 4HMEA 3ALGA 4Z2KA 4H8HA 4PN2A 1NH6A 4JFUA 1CXFA 3BLKA 3EBVA 3WH8A 1D3CA 4AZHA 1KGWA 2PWHA 3VIFA 4W7UA 3O2LA 3B9DA 3ZR5A 5CPTA 3AS0A 3OB8A 2PF0A 1C91A 4YHEA 4TVCA 4JFTA 2D2OA 2X8RA 2E9MA 4B3KA 1TVPA 2WZEA 2W5FA 4PMOA 2WVVB 5A2AA 3O9NA 4MDOA 2NT1A 2JIEA 1AMYA 1EHAA 5BROA 2OYMA 4DUWA 1VFOA 4HPHA 1ZJBA 1JDDA 3KZSA 4JKLA 3CHEA 4GINA 4GZIA 1ISWA 3ZJ6A 2J7DA 1EH9A 4NSBA 3W0KA 4DWSC 1NWSA 3AIEA 1EOKA 1CPUA 2NW0A 4HOWA 2CXGA 4PEEA 5HPOA 1R87A 2CBIA 2Y8VA 4D72A 4HP5A 3RPMA 4EAMA 1WPCA 2ZUSA 2QHAA 1KFWA 3AZSA 4LPCA 2ZOXA 5E6ZA 1ZBKA 4D1IA 1JZ5A 3WD0A 1W3HA 4MNLA 1J0ZA 1DWAM 4DWSD 1QVBA 1Q6FA 4WKAA 3ARUA 2EQDA 3GM8A 3MUAA 2OLHA 4M1RA 1H2JA 2YBUA 2O9RA 4P7OA 2D24A 3HU7A 1V6XA 3WSUA 1RPKA 3AQUA 3PZVA 3ZMRA 3EDEA 5A6BD 1FOBA 2WZHA 3M07A 2XJ7A 3NIYA 4KRTA 4QDMA 3W27A 1TG7A 3ARZA 1JZ3A 3GBDA 5A6SA 5C71A 4AY1A 1BPLB 2WNWA 4JZ5A 4H8UA 4W7WA 4QLJA 1MFVA 1C92A 1H0GA 3AIBA 4H04A 3MMDA 3AHXA 3VD3A 4MPKA 1FA2A 1NM9A 4HMDA 3VILA 3T2PA 3AMLA 4GZEA 4M80A 3OLEA 4M82A 1EQCA 3VM7A 1CGVA 4YHGA 3VGBA 1ZB5A 2FGZA 4QP0A 2ZUUA 5CZKA 1HL8A 4TVUA 3SEPA 2ZXQA 1HJVA 2QMKA 2G3NA 1UQZA 1ZU8A 1VB9A 2D22A 4HMCA 5E0FA 1C3FA 1BTCA 4PMYA 3ARYA 3CHFA 3PTKA 2VZTA 1AQ0A 2YL8A 1UD2A 3K4AA 2BY0A 2W91A 4GIAA 3F5KA 5EBAA 2J47A 1X1NA 1JXJA 3VINA 1HKKA 2JFEX 1OCQA 2VR4A 5BCAA 5CG0A 2WKLA 4AXNA 3U5UA 3I3BA 4CD8A 2OWXA 3APGA 3CHCA 4JIEA 3UCQA 3CGTA 3WDJA 3I3DA 1CECA 4U2ZA 1JNDA 3WKZA 1OT2A 3WN6A 2XWDA 2XGIA 4ZENA 4H41A 2X1IA 1V02E 1GHRA 1F4AA 3GH4A 1OGBA 4UFMA 3GNPA 4XB3A 2XSBA 1UWSA 4AEFA 3L4UA 2J7CA 4Z2HA 2QPSA 4GXPA 2V5CA 1BF2A 4JKKA 2C0HA 4KRUA 4J3UA 4AD5A 4UOZA 3VDHA 1H5VA 5FKYA 1KR1A 1E6PA 1G94A 2WCAA 4P8UA 1M03A 1JI1A 1HXJA 1UD4A 3A4AA 4OKDA 4GO8A 3JUGA 4D6DA 3L4ZA 4D6GA 1QPKA 1RH9A 1KB3A 1UR0A 2Y8KA 4HA1A 3VX1A 3T0AA 6TAAA 1CYGA 3II1A 4JFWA 1E4NA 2WB5A 3ECQA 2EJ1A 4M56A 4TX6A 4WSJA 1KCLA 2G4FA 1EDTA 1MVYA 2BV9A 2E0PA 1EXPA 2J77A 1RP9A 2BHZA 2BVTA 5CXPA 3VIJA 4F9JA 1GUVA 1GOQA 3IAQA 5JBFA 2UWFA 1UOKA 4PMNA 2VTFA 4PMXA 4Z2GA 1MWOA 1FFRA 2XPKA 1PEZA 1E6QM 1GOWA 2DIEA 1VJZA 3DECA 1CXKA 4J27A 3T09A 3CZLA 8CGTA 2WM0A 5M17A 3MO4A 1OWQA 1CGXA 4TVDA 1O6IA 1BFNA 3GXMA 1CENA 4WLCA 2VO5A 2WCGA 4U5IA 3U5YA 1W32A 1KBBA 1Q6EA 1UR1A 2WSKA 5LA0A 3G6LA 3U7BA 1QBBA 3WF3A 3N17A 3D5HA 2ZXAA 3K1DA 1H49A 2G3IA 1NWUA 4GO9A 2Y5EA 3W26A 1V6WA 4UTFA 4UQAA 3AXXA 4UFJA 1RP8A 3UR7A 3MUIA 4M8UA 3GTNA 4HOXA 3EMQA 3SCRA 1W9PA 1EO7A 5BXPA 2VVSA 4N0RA 4ATWA 4RE2A 1H3GA 4MDPA 5I79A 1B90A 3WF0A 3CO4A 1FHDA 2VCBA 2DDXA 1E6XM 2DT2A 2J74A 4HA4A 1WZKA 1B0IA 3CZEA 3MV11 1G9HA 1A47A 1U2YA 2CITA 4CVUA 1JL8A 5I77A 3VDAA 1OIMA 3WNOA 3VNZA 3W6LA 1EIBA 4V27A 1CLXA 2UY4A 3VIOA 1QHPA 2BS9A 4CN6A 3L2MA 5EB8A 3FW6A 3LPPA 1LL7A 2WSPA 3BMWA 4QFUA 3MS8A 2PBOA 1CZ1A 1E73M 3MMWA 4J3WA 4MB3A 3RCNA 3OA5A 1VBUA 2XHYA 2YA0A 2A3HA 3ARVA 4P8XA 1E3XA 5IFPA 4D6CA 4WK9A 1TA3A 5ABGA 4OUEA 4A3HA 2FH8A 1E15A 2WCSA 1QHZA 2G3JA 5D4YA 3AYRA 5I3DA 4A4AA 1IZKA 1O7AA 2XVGA 3LPFA 5A94A 3PZOA 1V6UA 1WDQA 3N9KA 4C7FA 4AZ6A 4ZFMA 2VCAA 1E5JA 1J0HA 5CSYA 4U5KA 3SURA 2VZOA 1VIWA 1WDSA 4J3XA 2J78A 2NSXA 5HXMA 1JD9A 1XSIA 5ECUA 1TMQA 3SCPA 1HX0A 1E56A 3CZ8A 2Y4SA 3CPUA 4HU0A 4JL2A 2D20A 2ZE0A 5A8MA 2CERA 4PYSA 1L0PA 4S3JA 4FLSA 3CTTA 3WF1A 1N82A 4DWSB 3L4WA 5A6JA 2ZUTA 1S46A 1PX3A 4KGJA 2WVTA 1JAEA 3AIVA 3MSDA 3CZJA 1VF8A 3WNKA 2XVPA 5DEZA 5BRPA 4LX4A 2WHLA 3D3AA 5A3HA 4AIOA 3K4DA 2A3EA 3WENA 3AIWA 1HJWA 2B31A 5HOSA 2FHBA 1BG9A 4RL3A 3QR3A 3RO8A 1QOXA 1UA3A 3I3EA 5TD4A 3NCOA 5IXEA 2D0HA 4WF7A 1JYXA 3W25A 1Q6GA 1F4HA 3SCUA 5GNXA 4NRSA 5D8ZA 1C7TA 2W4XA 4J3SA 4HU8A 1J12A 4EKJA 1CBGA 4KMQA 3W37A 3VGGA 1XCXA 4W8AA 1MXGA 2XFFA 1JYNA 3WEZA 1EO5A 1U30A 1OINA 3WH7A 2WMFA 2CBUA 5AYBA 3WDRA 4X0NA 1BHGA 1C93A 4JL1A 3QHMA 3FXYA 4WKHA 3AIRA 2WK2A 1EDQA 1U33A 2E3ZA 1J11A 2DSWA 1UD6A 4RE3A 5E9AA 1NP2A 2BNJA 2JEPA 4AIUA 5JH8A 1IZJA 3VVGA 4FLOA 3RILA 2WBGA 1ZBVA 4N42A 3ZQ9A 1VFUA 4XZWA 1SFSA 4ATLA 3BAXA 1KXHA 2WW5A 2ZXBA 1ZL1A 3DYMA 3VGFA 2ZX9A 4MJ2A 2VMFA 4E8CA 2DT1A 2EO7A 1G0CA 4ACZA 4MAVA 3WQVA 3VPLA 4PTWA 3VIPA 4TOQA 1MQPA 1GPFA 1ITXA 3WBAA 5A6LA 1XH2A 1JFHA 1UWIA 1E6ZA 1GVYA 5D9PA 3VD4A 3WY1A 3THDA 3OGSA 1P6WA 3VO0A 4QLLA 3UG4A 1CGTA 3W81A 3SCSA 1JI2A 2XM1A 4DM2A 1SR0A 3F5LA 2WC4A 3RJYA 2YBTA 4CCDA 3F5JA 1E43A 1W91A 2J8GA 1DTUA 2C8NA 1HVXA 2VURA 4GI8A 3WUFA 1ZBWA 1R8LA 5DT5A 1OGGA 1EHNA 1R7OA 1ISYA 2YA1A 1B3YA 4W8LA 4AIEA 3GH7A 3FHQA 1E5NA 3RIKA 2YLLA 1VRXA 3SCOA 5IHSA 3DYOA 3RMEA 1GW1A 1QNPA 2JF6A 2WMKA 4U33A 2VX7A 3VD9A 4UFKA 2GDVA 3PN8A 1SMAA 1TVNA 2WBKA 1JGIA 1UZ1A 1J9YA 1W3JA 1FH9A 4KGLA 2DT3A 1E0XA 3E1F1 1W1YA 3EDFA 4PTVA 2VOTA 3NDYA 1MQRA 2CHOA 1CXEA 5ABHA 3WF2A 4GZJA 2PWFA 4LXFA 3SCVA 3B9EA 5EFDA 1PBGA 4MAZA 2CKSA 1ITCA 1DWGM 1W3KA 1XC6A 4E2OA 5CGMA 1MW0A 3PTQA 2XIIA 4TX8A 1YQ2A 5DMYA 3OLGA 2XSAA 1E6RA 1LF1A 3WEMA 3WELA 2XTKA 3GXDA 1JF6A 3NSNA 3OGRA 1NOFA 2ZX8A 4OIFA 2CNCA 1J0YA 1UUQA 2GK1A 1HF6A 2CCRA 2IXVA 1UZ4A 2Q8XA 1UD8A 4UQBA 2BY1A 1V0MA 3IJ9A 2J79A 1PIFA 3BLPX 4D71A 1C90A 4JAWA 4F8XA 3TTSA 3OGVA 2DIJA 3S6TA 4Q7NA 2YL5A 1OSEA 1JYWA 2O9OA 1LG1A 3U7VA 4ACZB 3SIMA 2W63A 3NSXA 2ZIDA 1PZ3A 2YOCA 5FCZA 1UH4A 1EGZA 3J7HA 1KXTA 4ACYA 2TAAA
chains in the Genus database with same CATH superfamily
4N2YA 4DZIA 3LCIA 4S3AA 3TFCA 5C8BB 3QGKC 1R6WA 3WQFA 4O0ZA 2CLMA 4NXSA 3UR5A 3JXVA 1CNVA 3KCLA 3LMYA 3L4YA 4A6GA 1WXJA 5CLTA 4Z1BA 4F4RA 1IEWA 3G77A 4JFMA 2A1YA 2OOFA 5B80A 1FD9A 1UKTA 2ZUWA 4QNWA 1KKRA 5AOUA 3EDDA 1V0LA 4JIPA 1TCMA 1PXGA 5DITA 1TJ2A 1BRLA 3LHYA 4LVDA 2RDTA 4KT2A 2J4GA 4KWSA 4MLRA 3W7HA 2YL9A 3T44A 3O5DA 2HVMA 1XSKA 3FGCB 4R3UA 2PRHA 4S3DA 1XH0A 3ZOAA 5A8PA 2A4AA 2G37A 3FSTA 4NQ1A 4M24A 1DHKA 3PA7A 3F4DA 1H0IA 1PX8A 3KRZA 1JYVA 4D6HA 1PZ2A 1W9XA 3UWWA 3TZFA 1A4MA 3LTSA 3B7XA 1F61A 4C6MA 3BCDA 4LCQA 3DFOA 5CPLA 1ZHAA 5A1AA 2PURA 1LOLA 2ZZ5A 3KZ7A 1XW8A 3VKJA 2VFDA 2DZSA 1TRDA 4WJEA 1CXLA 3F4VA 6XIAA 2WWDA 1ZRQA 4MWAB 2WZTA 1Z89A 4JTJA 2DY3A 4W85A 1C8YA 3K46A 4XD6A 3UEQA 2R9RA 1E4IA 4DZ5A 2D2GA 2VWSA 4I8DA 3W38A 2DW7A 4C60A 4YWIA 3SFKA 3B8VA 1PPIA 3SRKA 1GOKA 2GOUA 3CUIA 1FWTA 3NPXA 2LJ4A 5DF0A 1EB3A 4E2BA 4C7DA 1V0NA 5D2TA 1ZJHA 4DRMA 3BARA 1SJAA 3W7RA 2QW5A 1GVIA 3T7VA 4A2SA 4YVXA 4G50A 1UKSA 3TQ0A 2PDFA 1GEQA 5HJYA 4X60A 1UHVA 3HBLA 4ODPA 3W24A 3KW3A 2ESCA 4QSFA 1XJBA 4US5A 1QI4A 4G56A 4KH2A 5A69A 3CXOA 3TA9A 1LT7A 4GY0A 3EXSA 2ZA1A 3KBSA 4L61A 2DT0A 2CWNA 1TYGA 1BYDA 3A9BA 4H9TA 1W1PA 1FH8A 3IK2A 1EBGA 3EDKA 1ESWA 2O0TA 4GGHA 4AF0B 4MYAA 3MANA 1I2PA 1YE4A 3OJGA 5EFFA 1K3UA 2OCZA 4IJCA 3P8IA 1NAL1 3VCRA 1QI3A 3VIHA 2NLIA 1XLIA 3C6CA 3B8SA 3S2MA 4D8AA 2IUZA 4WEVX 1RBLA 3PTMA 4DBEA 4V2XA 1YTEA 1Q5MA 3N19B 1TREA 1E6NA 3KDOA 4AU0A 3U2EA 3RITA 3ARSA 3O6AA 1QNQA 1XG4A 3S9IA 2I9EA 3T07A 1O66A 2Z6JA 5TF0A 3GVQA 3STFA 5AC4A 2UY2A 4HPJA 4IISA 4Y9OA 2I14A 3OZYA 1HP4A 1KNWA 3GNDA 4X2PA 5CBJA 2ZR5A 1TPH1 4NX0A 1CIUA 1GWJA 1W8GA 5FI8A 1IEQA 2C91A 2OQHA 1EX5A 1ZJAA 3KAOA 4ZVJA 2B7NA 2ZQ0A 4FHAA 3WG6A 3T0TA 3O5PA 1F8IA 3EKZA 2G3FA 1EP3A 1Q6DA 1XUUA 3O7UA 1I0DA 2VEGA 1ISVA 1UA7A 2JKEA 1R2RA 1YIXA 1NMVA 3TNOA 3W1AA 2RH9A 3AIUA 4KRZA 1DV7A 4IQEA 3ZFHA 1BAGA 4XSLA 1EJRC 2GFTA 1OFOA 4DJEA 4MY9A 1A80A 3F4WA 1I60A 3AZRA 5LA1A 3SO7A 2FDMA 3DFNA 1RPXA 2QJJA 3VA8A 2WAGA 4DZHA 2V8ZA 1YLVA 4O17A 1GG0A 5C2GA 3CH9A 1U83A 4NAFA 1MI3A 3PFRA 3B4YA 3PUEA 1Q6HA 1QCWA 4QLKA 2CIPA 3AISA 3IANA 1TUXA 4YMZA 1X98A 4JTLA 3PZMA 2YKKA 5A8GA 2QCMA 3ELFA 3MB9A 3B0PA 4CUCA 2DP3A 4B9YA 3H24A 3W1LA 3GIQA 4HZ8A 4UQEA 2PBGA 3M0HA 2GJPA 1OGSA 2GUYA 2NLYA 2QT3A 2J7HA 3GC5A 1QFEA 1J6OA 4MY8A 1FTXA 1Y7VA 4MG4A 7A3HA 2OMAA 1NOUA 2UY3A 3G0UA 5FF7A 1XIGA 2XP3A 2Y2WA 5GJMA 3VCCA 2VFFA 4NASA 1X38A 4XAGA 3B04A 2A3AA 8TIMA 3PG9A 3WNNA 2V69A 1E71M 1UUOA 4R7WA 5F7UA 1WOBA 1J2BA 3EEGA 4FIRA 2GYIA 4MSSA 2X7VA 3TMQA 1TA3B 4IUOA 4C6BA 1KRMA 5FD0A 3GNXA 4W5ZA 3FEQA 2INEA 4B3LA 3GIYA 3MSGA 3GG0A 1SW7A 4KERA 1ECEA 4PMVA 2QF8A 1E0VA 1M04A 1HIZA 2E6DA 1Z32X 3DG3A 4KWUA 2CLOA 3W1XA 4LTSA 5C2CA 1ODUA 3EYPA 4O14A 4HNTA 3LG3A 1DIEA 4PTNA 1W5PA 4TXEA 4HA3A 2A2IA 1FVPA 3H53A 1T7LA 5LIWX 1QHOA 1YDYA 3VMNA 3IKGA 1EL3A 2WANA 4GCAA 1ONEA 1NDYA 2ZX6A 3LPGA 2H90A 2GGHA 4I8YA 3THQA 4S3BA 4Q8VA 1M41A 4J2MA 2PODA 3WO8A 4BZYA 1SR9A 3UU0A 4XK2A 4IICA 4DT4A 3QW4B 1LLOA 2VI0A 4JTAA 1JZ6A 3P6LA 2VT0A 5M5DA 4C6OA 2VRKA 3NZRA 4LF2A 1CXIA 3I4EA 4C6IA 1JD7A 4S38A 3N11A 1JEZA 1PJ9A 4HPGA 3TONA 5J6EA 3FYOA 4LV9A 4G2DA 2GDUA 4WUIA 3LSBA 4RKAA 5LSMA 1UP3A 1XQKA 3T05A 2C1HA 4FLQA 4TIMA 4DJFC 3BMBA 1VQTA 3P0WA 3O63A 4IFOA 2BVWA 1XM3A 1JCTA 3BH4A 2Y61A 4MUPA 4OQVA 1R38A 1KTBA 1QU4A 3G0XA 1OZMA 3PZTA 3P5YA 4XIAA 2XH0A 1BGGA 1J6PA 3CYJA 4PMQA 1AW1A 2ZX7A 4Y7EA 2DSZA 4GIVA 1AQMA 5E5CA 1HT6A 3CBWA 3C2VA 3TH6A 4ZO6A 1ONRA 1CW2A 2EBNA 3FNDA 2XN1A 4HZ7A 3SAZA 4Q4OA 3W7MA 3BWWA 4WY0A 2X09A 2WNQA 4LVFA 4W7VA 4CD7A 2MNTA 2A3BA 3SUUA 3NYZA 3L5MA 3HG3A 3EOLA 1RR2A 3M6DA 4RDWA 2B0MA 4MNMA 3CPGA 2MLXA 2Y78A 2PWEA 4J7RA 1UROA 1MEIA 2YYTA 2QGYA 4IFKB 4KFNA 3CQJA 4GFSA 1XYZA 4LQ1A 3GUWA 2ZUMA 1UG6A 2PTDA 2AQWA 3W72A 1VENA 1CGYA 2F9RA 2OFJA 1H1ZA 3A4WA 3ENLA 1I1XA 1VAHA 4JNZA 5EKYA 1JVWA 4JEJA 3C2RA 4QRNA 4H6RA 3LRLA 1OK4A 5CC7A 2BY3A 1B3VA 4O15A 3N13A 4HBEA 1ADDA 3NUKA 4GUHA 4PBFA 3QF0A 5HTGA 2QCEA 4UQCA 4GHRA 2C79A 3ITTA 3O1NA 3PZGA 3POHA 1C9HA 5RUBA 1DJZA 2ZA3A 2XH7A 4JFJA 3AMDA 3OQ8A 2ICSA 4LBSA 5AVHA 1NVMA 4GE8A 3G24A 3H2AA 4W9QA 4UWMA 3TSMA 3CV2A 1AQHA 2O55A 2UY5A 1GKRA 1OIFA 4PL1A 4LOCA 2A7RA 2FHCA 3W53A 1QTWA 2XM2A 2Z6IA 3DOPA 4AX6A 3M0VA 4UOJA 4GUJA 3TJ4A 3O16A 1F73A 2F2HA 3PNUA 5I3KA 3FFSA 3WQCA 1NDVA 4G6CA 2J7BA 1VBGA 4F0SA 2D2JA 3KZPA 1EPVA 2QAPA 3ARXA 2QUVA 3QYQA 5JIWA 4UQ9A 2V81A 4L1WA 2GGJA 1E4MM 3C0QA 1VHCA 5JMUA 1LWHA 5DCDA 5J5RA 3IIPA 4AC1X 5I5RA 1XRVA 3ZVHA 1CDGA 1F8MA 4RDZA 1IT0A 3BTNA 5HWCA 4RK8A 3ZIZA 1XFCA 3P5ZA 4IJRA 3PZQA 2ZZ7A 1GYMA 9CGTA 3FA5A 1JCNA 4JQ3A 2IXUA 1K9EA 4JYEA 4Z2JA 2MANA 1K8YA 3LUTA 2AGKA 1FAPA 2EKGA 5A8NA 3PK7A 1L6SA 4Z2IA 1L6YA 4DWSA 1BVNP 3MMUA 3WJXA 2VX6A 1IWAA 2KI3A 2ZZ6A 4DRIA 4K3ZA 1XYBA 2FZNA 1TQXA 4CQCA 3S9ZA 5EY5A 4MPQA 1TKKA 2UV8G 1NY1A 4C65A 1OYCA 3HQNA 2CZFA 3O5RA 4IPPA 2ADAA 4FN2A 3VMPA 4IIDA 3MKKA 4WJXA 2EPNA 4H6QA 5BXTA 5G4HC 3IACA 4C7GA 4AZIA 2ZC1A 4CQDA 4JDYA 4M6UA 3RPDA 2EULA 4C6JA 5DT7A 1OFDA 3VFLA 2MPHA 4XWUA 1XD1A 2J9XA 2F7FA 1TTJA 3P93A 4PBGA 2YDRA 4C6EA 4ZZ9A 2QJMA 4GJ1A 1QR7A 3AIQA 4LYPA 4RJEA 4L6OA 1IXQA 4W8BA 2PC8A 1GZJA 4W87A 3S2JA 1VBHA 4PFMA 2OWWA 5AN7A 3BG3A 3H2OA 4AZ5A 2D0GA 1T41A 1FJDA 4IT6A 3CAKA 3IGUA 1ZALA 2M2AA 3G1DA 3UESA 4DJDA 3IKDA 2IF4A 4L56A 1VYPX 3KOZA 1EJUC 1R85A 1NU5A 1FRBA 4F0MA 5EMYA 2ISFA 4L4MA 3S2LA 1FKWA 1LWIA 2R24A 2PLMA 1F07A 2RAGA 3UJFA 4HK7A 1V3HA 3MDYB 1YADA 3V3WA 3RDKA 3STEA 3QOKA 5G1TA 4BEQA 4Q7BA 3OO2A 3C4UA 2WKGA 5FJIA 1E9LA 2FAPA 2A79A 3LENA 1HKWA 3NGJA 3LHZA 1QK0A 2F61A 4YVPA 1F5ZA 5D8WA 4UR7A 2OTDA 4NX5A 1TCOC 3WMBA 1DBTA 3ZLHA 3VIMA 4AZCB 2HS8A 4IQJA 3HMCA 2WSQA 1S2TA 1XS2A 1V03A 1HP5A 4G1NA 2ZZ2A 4Q4KA 3W1QA 4JFIA 4KCWA 3NAVA 4JBRA 1H50A 3HV9A 1G4PA 3WQ4A 4X0VA 2M08A 4Z2LA 1M01A 2WQPA 3NZ1A 1OF8A 1BF6A 1VFLA 3PB2A 3NVTA 1UJPA 1HQTA 2PTZA 1JPKA 1LUCB 5HW8A 4POCA 3DH7A 2V3FA 5D2WA 7TAAA 4E4PA 4LRSA 5KTLA 2ON3A 3MKVA 2X0YA 1A3HA 4UIOA 4JHMA 1V77A 3NG3A 3VKBA 4OV4A 4DM1A 1O68A 2MUCA 1RALA 4LUSB 2HXUA 1O95A 3KL5A 3ZT6A 3SSJA 2P0IA 3O5QA 1LT8A 1TE1A 3PPFA 4GNVA 4L64A 3KCJA 2WMHA 3KBVA 2GVYA 2AGTA 4TNSA 1ME9A 1FWDC 3KFTA 5IDIA 3MSYA 4PTXA 1RD5A 1D7IA 2D9FA 2WC7A 3M5XA 4JQ1A 3R8HA 2CW6A 1UD5A 1X6UA 2KO7A 3A4JA 4AHQA 4IIGA 1LRQA 4GVGA 2WMJA 3B9OA 3MP5A 1F6KA 3IJIA 1I1WA 3PB0A 1NFPA 3A3XA 3PJTA 2OXNA 1N1AA 3WD4A 2V30A 4O1DA 3FIGA 3QTGA 1UUMA 4U31A 2QVNA 1X96A 2HSAA 1TCDA 2YFNA 4HSOA 2GLKA 3V18A 4UTWC 4B5XA 1ISXA 2GJXB 1V7YA 3RJXA 1XHGA 2X05A 1FFQA 4NIRA 1MW2A 4UZUA 5BMXA 1TVLA 3U2ZA 1DQWA 1LOQA 5FA5A 4QE4A 1W1IE 3K1GA 1P6CA 3QHNA 1KXQA 4JTEA 3ALGA 3TVAA 4DZ2A 3BJFA 1SUXA 3EBVA 4DELA 4IF2A 1P0DA 3PJXA 2PWHA 2RUCA 4LU0A 2UZ9A 3M6YA 3B9DA 3ZR5A 1L6WA 1C91A 4TVCA 4O18A 3TKFA 5HUPA 3VNLA 3W83A 2XIJA 3BOFA 2QGHA 4MFDA 2WVVB 4CNTA 1TB3A 3CV1A 4IP7A 4RDYA 2JIEA 1AMYA 1UB3A 3TYUA 3W7NA 1EHAA 5BROA 2OYMA 1VFOA 1JDDA 4JKLA 1EH9A 4DAFA 2XGZA 3S5OA 2VR2A 2YDAA 3FGCA 4Q4QA 3AIEA 1WKFA 4KCTA 1H5YA 4JFLA 1R87A 4ERGA 3RPMA 4EAMA 1P6BA 2ZUSA 2QHAA 2QQ6A 3TW6A 1EEXA 1X1ZA 4D1IA 1HKVA 2EQDA 3GM8A 5ECVA 2Y7EA 3MUAA 2E6FA 1H2JA 4FIQA 3Q67A 3CIXA 2D24A 3ZXWA 4XKYB 1D3HA 1K4GA 3WSUA 4DAIA 3AQUA 3EY6A 1RY8A 3PZVA 2DW6A 2EGZA 3ZMRA 4U84A 4M51A 1VYRA 5A6BD 3M16A 5HNRA 3M07A 4IPJA 2XJ7A 1OCBA 1RCQA 3W1PA 3UJSA 4JN7A 4MWAA 1BPLB 1W17A 1FKBA 2IQTA 3W1UA 1RJPA 3HGJA 1I2RA 3BZJA 5LNWA 5HQMA 3VILA 3T2PA 4HB7A 1EQCA 3MI2A 2RUQA 4YHGA 2FGZA 2ZUUA 3O07A 1KRBC 1HL8A 3R0UA 5TIMA 4BK9A 4TVUA 2HBVA 3R94A 4FXRA 1VB9A 1GEHA 3PUGA 4E0CA 3VOHA 1BTCA 2OZTA 3W7DA 4O1AA 3QC3A 1S3HA 2QCGA 1EIXA 1OEPA 3N9SA 5HWBA 1AQ0A 1YNQA 2QCDB 4NL1A 2AAMA 2EPHA 4MUZA 4GIAA 1PCKA 4HNCA 3F5KA 5LIKX 1JXJA 3EOUA 5CG0A 5DMNA 4DF2A 3LGDA 4OV9A 2YX0A 2NUXA 4ZQMA 2YW4A 3RR4A 2OWXA 4WDXA 3APGA 3KVJA 3I6CA 4JIEA 3RCMA 3CGTA 3LHWA 3DFPA 3QZAA 3GB6A 3WN6A 4CQBA 4ZENA 2P76A 1W1B1 1FXQA 4M6PA 4LT9A 1UWSA 2DZTA 4DN1A 3L4UA 3IHZA 4GXPA 1P0NA 5E1QA 2ZR6A 3S3GA 3FJ4A 3EX3A 2HPIA 3TAKA 4J3UA 4IXXA 3AWOA 3KXQA 5BNKA 1FX6A 5D04C 1G94A 2GSHA 1WUFA 4WRHA 4QM1A 2R91A 4P8UA 1M03A 1JI1A 1TE6A 1TZZA 2B7OA 3IV3A 3S9YA 1FWCC 4D6GA 4DPPA 1KB3A 3G1AA 3W86A 2Y8KA 5D02A 3DERA 1KFBA 4JFWA 1EJSC 2PEVA 1H60A 2QS8A 1EXBA 3EX6A 2P5NA 4XD4A 3PWAA 2BZNA 1MVYA 2PDWA 3LCXA 4QEHA 4ZA0A 3VAWA 1IHIA 2CLFA 1FWWA 1SO3A 2J77A 3XIMA 3XINA 5KINA 2BHZA 2BVTA 3VIJA 1X8FA 4QS5A 4F9JA 3T4WA 1IGSA 3DGBA 5CJNA 4EPBC 2UWFA 4PMNA 1J79A 4I5UA 2YZRA 4HK5A 1PEZA 5AZ0A 1LDCA 3NQMA 1CXKA 5G4EA 8CGTA 4C90A 4Q3MA 2WM0A 4LVGA 2V5LA 3QQ0A 3H2NA 3GXMA 4H6EA 2VO5A 3U5YA 1W32A 2DJLA 1XLDA 1EP1A 5FEPA 3XISA 5JH2A 4LFYA 3NNTA 5LA0A 3BZGA 1HTIA 4A21A 3U7BA 3TA6A 1QBBA 4GY7A 1LORA 3WF3A 3LS9A 3N17A 1L2QA 5AECA 4DYEA 5CEWA 2G3IA 4IL2A 4E6MA 2XP7A 1Q1CA 3OEXA 4OHQA 2VEPA 3GTNA 3B05A 1W9PA 5BXPA 4N0RA 4ATWA 3FKKA 4R34A 3DFHA 2HV5A 1K8ZA 4K6AA 2OLSA 3WLQA 1UR3M 1WQ5A 2QEZA 2VCBA 2PGWA 1EYWA 4GD0A 5TQLA 3CNYA 3CZEA 3L67A 1G9HA 1JPMA 1JL8A 3RFWA 5DY2A 1TIMA 5REQA 3VDAA 5H91A 4NZ3A 3DKLA 4V27A 2GUBA 1O5XA 4CN6A 2ZRYA 2LLEA 1KW1A 3LPPA 4FP1A 4O54A 3H21A 3O5IA 1CI1A 3MS8A 4QFUA 1JUEA 3ES7A 1E73M 1XISA 4AC7C 4MB3A 4O8RA 1AH3A 4QR6A 2ANUA 3JZUA 2EHHA 1SSDA 3RK8A 4P8XA 3EWCA 4YS1A 3EXRA 1TA3A 4KCUA 2ATMA 2YCKX 1P1XA 3GFXA 3DESA 3AYRA 3NURA 1AL8A 1JVNA 2PAJA 3GU2A 3TJLA 1PWLA 2OT1A 3N9KA 1Q65A 2WJZA 4C7FA 2VCAA 1WDDA 2EKCA 4FNRA 5F2MA 4AVFA 4XD5A 1P5QA 1A5BA 1VIWA 2J78A 1F7BA 1XSIA 2ALDA 2D20A 2ZE0A 2PDJA 3WLRA 3CTTA 3L4WA 5A6JA 2ZUTA 1PX3A 4KGJA 3AIVA 3MSDA 5DEZA 3APYA 3N2TA 5ENLA 2X1UA 2A3EA 3AIWA 1HJWA 3LI1A 1A5AA 5IXEA 2D0HA 1Q4WA 1XLGA 1Q6GA 5GNXA 1Q63A 3NOYA 4RE0A 1KD0A 3KOXA 3AC0A 4KMQA 2Z28A 1KBIA 2EG6A 3RHGA 4W8AA 3B03A 4N9BA 5L9FA 3CGNA 4LY4A 2XFFA 2IPJA 3ZYZA 1EO5A 3GKAA 3WH7A 5I3FA 2CBUA 5AYBA 4FZIA 3N2XA 3IRDA 3MT1A 3QHMA 4AHOA 3MY9A 1O60A 3AIRA 3HGRA 4Z1CA 1UD6A 4GCXA 2Z2UA 1I2NA 2BNJA 3W7GA 2DVXA 3DZ1A 5JH8A 1M65A 3RILA 2WBGA 1IZCA 3ZQ9A 3D0CA 2P10A 4XZWA 2Z7KA 3NZGA 4ATLA 1RVKA 3HOJA 2WW5A 4U10A 1YXYA 1K1DA 4XZMX 2HE8A 2FGBA 4E8CA 1XFBA 2EO7A 2NXHA 4DO5A 3PUDA 3KLLA 1Z69A 3WQVA 3OVPA 4TOQA 1JDEA 1AZ1A 4LNCA 1GPFA 1ITXA 2GL5A 3P82A 1S38A 5FJTA 1GT8A 3N34A 1P6WA 5M2FX 3W81A 1CGTA 1DJWA 4DRJA 5FJRA 5CGQA 3W1RA 3F5LA 3QR1A 1YDVA 3H7VA 4YL2A 3W6YA 5TAOA 2J8GA 3VOFA 2VURA 2Q01A 8XIAA 5DT5A 2XISA 1CB2A 1R7OA 1B3YA 3DENA 2RURA 5F1UA 1QMLA 3SCOA 3N73A 5MF5A 3MJYA 2JF6A 4U33A 1JCXA 4UFKA 3PN8A 4LUIA 2WBKA 1UZ1A 1J9YA 4HYWA 1OC6A 4YCOA 4O2TA 1W1YA 3DG7A 3PBYA 2CHOA 2INZA 3NRKA 4GRSA 2PWFA 1YXDA 3UYIA 4MAZA 1XC6A 4TX8A 2OKTA 2PWUA 1DE5A 3UXIA 2QUTA 4GACA 1DXIA 3DDMA 4XUGA 3QKEA 2PDXA 5D2XA 3HGSA 1SSGA 2ZX8A 4XAZA 1T5AA 2CNCA 3F2CA 2MLZA 1ZY9A 2XN2A 1UZ4A 2Q8XA 3S42A 1R0MA 1V0MA 3MBFA 2QUMA 1VFSA 1PIFA 4OTKA 2AL1A 1FKTA 1IEIA 2ACRA 3TTSA 2YXGA 3VNJA 3OGVA 1KFEA 4Q7NA 5CPNA 1FKFA 2YL5A 1S5MA 4DQWA 1JRBA 3BUVA 3DX5A 3CJPA 2W63A 3NSXA 2ZIDA 1PZ3A 2NWSA 5FCZA 1EGZA 3RLUA 2V63A 4GISA 1T40A 3POCA 4OBRA 1J93A 1YW1A 3S2NA 1TWSA 5FESA 3L4XA 3K30A 4WIWA 5I3IA 2XIQA 5HJLA 1MW1A 2YFOA 2ZZ1A 3UW6A 3VNIA 3AYSA 3MO7A 4N4QA 1XKYA 4Q8TA 1H1YA 5JVLA 3S47A 2XFYA 4WXZA 4B5TA 1NWRA 1Q85A 1I45A 2ZRXA 1W37A 4MGVA 4NJJA 3CU2A 3AS3A 3ITLA 4ZEPA 2BHYA 3SN0A 4WX2A 3WJYA 3C56A 3HZ3A 3TDBA 1UKOA 4K7YA 4GXMA 4AQLA 3QRHA 1F3EA 1FWFC 1W3LA 3JU2A 1B3XA 4FAPA 4ITZA 1FHLA 3B9AA 3NQEA 4FOKA 1AL7A 1K9TA 3EB4A 1DJNA 1FKDA 4Y96A 2ZCGA 4CQ9A 2HCVA 3RRAA 3BICA 3WYZA 4K8EA 4GBUA 5A8OA 2AKMA 2OB3A 1Q6IA 1E1FA 5C6MA 4JEQA 2I1OA 1FDJA 1GG1A 4DNMA 1JDAA 1P4CA 3ZSSA 1HO1A 3CGMA 2OT0A 4O19A 1YNYA 3KOWA 3ZS4A 3O6YX 1PTGA 1IT8A 1KGXA 5F4WA 1Z9AA 4L4LA 2J25A 4K38A 4F48A 4QZVB 3KL3A 3STGA 1MNSA 3M0MA 3FEMA 3NQBA 4LAUA 1C8QA 4MKSA 4D6EA 1MZRA 2XZ7A 5A2CA 1XCWA 3QKZA 1KGUA 3HTWA 3N3TA 1BYCA 2GPTA 5CZ0A 3QZEA 3Q58A 2Z1VA 5CJ5A 4LB3A 3WL0A 3FA3A 3KTCA 3EWUA 3N2OA 4A8IA 2XFRA 3TCSA 2RQSA 4M7TA 4X9YA 1OABA 4QXIA 3USBA 3VDBA 2KX9A 1LWJA 5CJMA 3GBEA 3AXHA 1QI0A 4OJYA 3DGRA 3BSHA 1JAKA 3T2OA 3HPXA 3GHUA 4PBEA 4AZCA 4LUYA 1F6YA 1ZUAX 2TMDA 4JD4A 1HL9A 4IZGA 1I6NA 1X8CA 4YN5A 4CEUC 3HPFA 2WYSA 1K9FA 2D0FA 3KTXA 4CEXC 5J5DA 3MHUA 1QBAA 4ZOAA 4UNIA 5A6AA 4CNNA 1DEDA 3O06A 1LQAA 2RJGA 4HNLA 1LUCA 1E6SM 1NQ6A 1R9ZA 1XI3A 1AFSA 2TSYA 1M6JA 2J24A 4J28A 4H8VA 5LIYX 2PV2A 4LUSA 1HW6A 1F40A 3BG5A 4CD4A 4CN1A 2EG7A 3EX1A 3IVSA 2XP5A 4B4FA 1F8AB 2OQYA 3SCTA 3AS2A 4K1GA 1TV3A 2OFNA 2ZTJA 1J96A 2J75A 3BK0A 3A3HA 4YWSA 5CC5A 4S1FA 3VZYA 3AAMA 4E38A 4HD5A 3UWUA 4PUDA 4LBUA 4DI9A 3MHFA 4NYYA 4R7JA 3ZSTA 3WNMA 4MB4A 2XGBA 1ZP3A 2A7NA 4HYRA 1QPQA 4MGGA 1HKIA 4J3VA 5BU6A 1PYFA 4QG8A 3TIMA 1ICSA 3S1UA 2DG9A 1HNYA 3QVQA 2XPBA 4L65A 3OOBA 4MIMA 1V6TA 1TO3A 1ADOA 2QAFA 1RQEA 4AWTA 3LBMA 3LXAA 1RBAA 1FKGA 3LHVA 4JCLA 3V35A 5FJJA 3CZKA 3L5LA 2GJXA 1A7XA 1U1HA 4XTIA 2PZ0A 3MUY1 1T8XA 4B4HA 1WXZA 3WH6A 4EX4A 4BQ4A 1BKSA 4O13A 4N9DA 5D9MA 2WHKA 1PHWA 6CGTA 2VX4A 3E38A 4M7SA 5HAOA 1W0MA 3PFMA 1A5MC 4IPXA 1VIZA 4P7QA 3NL2A 1CCWB 4UC5A 3O5KA 1VEPA 3DAQA 1DJXA 3AMGA 3M1ZA 1HJXA 2E8YA 4H19A 1IR1A 4HA0A 3T2QA 1R7AA 3RRXA 4IUGA 3V5FA 3HM7A 4ML4A 1Q2SA 3UETA 1FWHC 4ZB5A 3EZ4A 5DIUA 4ZE4A 4FB7A 3S1VA 3SIZA 3ES8A 1JZ2A 1Q2RA 5I03A 1JUBA 2OZ8A 5AYIA 1DJGA 1Q7MA 4F40A 2A7PA 5KSWA 2YL6A 4ZQCA 2ZZ4A 3EXTA 3GFYA 3AUJA 3VX0A 1NTHA 4XX6A 2NX9A 3B3DA 3TTOA 1TPDA 1XIDA 3ITCA 3PRBA 2GVLA 3S5SA 3NEVA 3C2FA 1L8PA 1L8NA 3WMLA 2WLYA 2QF7A 3PZUA 3GYEA 3K4WA 2BGQA 3ZR6A 4FSAA 3H23A 2EF9A 3QGVA 2Y8UA 1WA3A 2Y5JA 2WHMA 3BOLA 3TDFA 3LM7A 4HK6A 2QV5A 1MYRA 2C15A 4FS9A 1HJQA 2RGMA 4XKYA 3CL8A 3CMGA 2X2YA 2X1RA 3KL0A 1G1YA 3OW1A 2I17A 5I00A 3H9RB 1RQBA 2DPEA 1SO6A 4A8LA 1EZ2A 2FFCA 4AMCA 5AFDA 3WBYA 1TPC1 1LBFA 2HK1A 3HIJA 3BMVA 4JTGA 1R2SA 2GVGA 1JDCA 1BG4A 4A3YA 4AYSA 1GOOA 3MMTA 1XX1A 4L9ZA 5GJNA 4QT2A 3TV8A 1SQ7A 4PCPA 3NZQA 4LV4A 3IVUA 1XCFA 5CH9A 5C70A 3W4RA 2PBCA 3UERA 1PX4A 3RAOA 3RM8A 2C1IA 4PCTA 4N19A 4BF7A 3BURA 3OVRA 1SYTA 3LX9A 1XWYA 2V38A 3RCYA 2OJPA 2EPMX 4NAFB 4LAVA 4N02A 3O6CA 4GPNA 3T55A 1DL3A 3TUUA 3P74A 2QCDA 3CLWA 2DQWA 1Q8JA 3KAGA 1UR8A 3LBOA 1PS9A 4I9MA 5C0QA 1U22A 4I6VA 3UF8A 4ZL1A 3LCHA 1XLAA 2X1SA 3BCFA 3KX6A 3BGJA 3SN4A 1R86A 1I4NA 4ODOA 1WZMA 5KZ6A 1QJWA 1NWTA 1ADSA 4IMGA 1JGMA 1UWUA 2E40A 1VCGA 3DEQA 4ODRA 4ZR8A 3G1SA 2XVLA 1R9XA 2QCNA 2WMGA 3A9IA 4PRRA 3TC5A 1FP8A 3DI0A 3WD3A 3SRFA 2JZVA 1P43A 3GDBA 4BA0A 4EAYA 1KRCC 1UMYA 4HNOA 3TLQA 4CCCA 4ERIA 3CQIA 5U4NA 1QW9A 4F0RA 1MQQA 1XYFA 1JG9A 2O56A 2VC9A 1QPOA 2PLCA 3LK6A 3OVGA 1SVDA 3MSRA 1F74A 5FAGA 3IGSA 1DOSA 1POJA 3N6HA 1Z44A 2BY2A 5BOFA 1Q13A 2VZVA 1PSCA 3WNLA 3SCQA 1W2PA 1SMDA 4ICMA 3FHAA 4GKLA 4W86A 3LPOA 1CEOA 3NM3A 5E09A 2BVDA 4IG2B 1OG0A 3TYCA 3B06A 1P5BA 3THCA 4C6LA 3BDKA 1EJ7L 2BOFX 1H11A 3LZ5A 4Q8PA 5DBUA 5FSDC 2ZQVA 3Q2DA 4NZ5A 3UQIA 1GOMA 3GSMA 2R94A 4IWWA 4FXSA 1B3OA 1H62A 3C3NA 5KZEA 2JIWA 1XQLA 1E3ZA 1KFJA 4WKFA 4FX8A 1EUAA 3VGDA 6REQB 3UNDA 1RVGA 4QS6A 3OA3A 1H4PA 2WSRA 4XZHA 2YB4A 4BJHA 3MUXA 3VGEA 3MP4A 4B5NA 2VVNA 1GVRA 2PDCA 2XVNA 4RLIA 3VIIA 5GPGA 3R11A 1O1ZA 3VM5A 3CV6A 4J40A 3L4VA 2QUNA 2OG9A 2DSVA 2PSNA 1RD6A 3LBCA 3R0KA 2C13A 4KIRA 1AQFA 5CZSA 4MYXA 1J0JA 2QMJA 4MTVA 3ZJKA 1FXPA 2HBXA 4IMAA 3UT0A 2CKRA 2GVEA 3BGGA 3CEPA 3SW6A 5L6UA 5HULA 4B91A 1WAWA 1CXHA 3GPKA 1VFHA 1E1EA 4HHMA 1MDLA 3AHYA 4ZQRA 4XVDA 1ZJIA 2LPVA 4IXHA 2I9UA 3KVMA 4JIQA 5CSSA 4Q4MA 4Y9MA 5DIVA 2F21A 4FX7A 1R3YA 2VFHA 4PUUA 1TV8A 1ZAIA 5AYZA 2XUCA 1KM1A 3MWAA 2VXNA 1LM1A 1KM0A 2OWCA 2VZUA 3TYEA 4MSPA 2G41A 3OYZA 3W28A 5FEZA 3HN3A 4IGMA 3WLHA 2ONEA 3AFBA 3U3HA 1AH0A 1PIGA 3WLMA 3T40A 3WQ8A 4I90A 1RAKA 4ZXOA 5ABFB 2DH2A 3A23A 3S1XA 3Q65A 1BSLA 4FOJA 5I2UA 2RGLA 2Y89A 3IIXA 3W2MA 3ARQA 4R5EA 1QPLA 2X30A 2YIHA 2VRJA 4Q22A 1HGYA 2V82A 1MZHA 3MCNA 4L80A 1KWKA 4W4QA 2VKZG 2REQB 1ROUA 5U7SA 3PBGA 4P7NA 3CUFA 4OBSA 6A3HA 3OTRA 1W6TA 3MBDA 3AOFA 5DO8A 2ZUNA 5AYXA 3UG3A 7XIMA 3ZVIA 3W70A 5I78A 3ARPA 4E8DA 2XN0A 4G7EB 3LXBA 3ABSA 4EXBA 3VE7A 3KS6A 4PSRA 3S1WA 3CK5A 5JUVA 1EP2A 1RK5A 1K8CA 1CLKA 4AW7A 1S2WA 5G1YA 3FY1A 1ECQA 4GNJA 1RCOB 3LRMA 1UYQA 4X22A 4DH0A 4BS0A 3WJZA 3VZXA 4PCFA 3ANUA 4GI9A 3GS6A 1QNSA 2CYGA 3WUBA 3OBAA 2BXYA 3WQGA 3W1NA 3W76A 3UP8A 4WOQA 3BAIA 4JFSA 4RE4A 1C9DA 4LUTA 2AQVA 2FJUB 3KBNA 1EFZA 5I23A 2CBVA 1A5LC 2Z24A 2DZBA 4NY2A 4WY0F 4AISA 3E2RA 3OU8A 1SPQA 7REQB 3Q4DA 3FJ6A 8XIMA 5IOBA 2IPFA 2XPAA 2AOSA 3UG5A 5JQ9A 1PV8A 4CN4A 1OC5A 2DUZA 2E9LA 5AC8A 1VFTA 2DZXA 3DC8A 2C3ZA 3QFWA 2QZRA 4JGDA 4P8WA 3A22A 1J18A 4LAWA 3NDZA 2W92A 1XBXA 2GUUA 3UJRA 1B3WA 2Z1BA 3QLDA 4PRWA 1P0BA 2DSKA 1UCWA 2Z29A 3HG5A 5C9WA 2ZTKA 3ZVHB 4AD2A 4JFVA 1G01A 2DEPA 4XBJA 3MYPA 2O9PA 5HDRA 4MB1A 4GH1A 1SFTA 3EOSA 4KFOA 2VJXA 3IAPA 1LTDA 4U2YA 3WEOA 1UR2A 1WCGA 3EB2A 3RLVA 4W84A 4OE7A 2JGYA 1XYMA 4S23A 3WQ6A 3Q45A 1WP6A 3WK1A 2QPXA 2H9AB 5F1VA 3N2MA 2FKPA 3H8AA 2F2KA 1OT1A 3NM1A 1B3ZA 3LTPA 2B81A 2DGAA 2W61A 1V6VA 1XC4A 3V0UA 4TTUA 2OYLA 2D23A 2ZDSA 1V02A 5K9DA 4RNJA 2H3BA 1JXKA 3H2CA 1Z6KA 2PB1A 4X2RA 2BB0A 3AALA 2XVKA 2J62A 3SQLA 3R8RA 1TMHA 3TP4A 5LXXA 5LNRA 3GXTA 2PDNA 1FWSA 4YCPA 1DJIA 4FMVA 4ADSA 1S2CA 4ENLA 5I6SA 3L4TA 3YPIA 3QLLA 1MRQA 4GH3A 4J4KA 1JF5A 3UYCA 1S5WA 4UR9A 3P0XA 3QV9A 1W31A 2R1MA 1EC7A 4Y8FA 2VFEA 3FA4A 3PWIA 3S6OA 1FWNA 1OFPA 4B15A 4NJHA 4IT1A 8RUCA 5BW6A 5JIPA 3IUDA 1PHQA 3A3WA 3B0XA 4QQ3A 4CU8A 3M41A 4Q8MA 2Z27A 3MI3A 3UVAA 3W7OA 1HJUA 3CQHA 3EWBX 5K9CA 5F2GA 3KBJA 5GNYA 1FDZA 4LW7A 4MB5A 3NO3A 5CSRA 4CQAA 3DHUA 2ZRZA 1UOZA 1B57A 5DELA 5IBXC 4EP8C 3IJ7A 3NQ6A 1V3LA 1KCKA 4GNKB 1X1OA 1V51A 3LERA 3VDCA 4I5XA 3NL3A 4UCGA 5LZLA 2G8ZA 2CESA 5AHFA 1YE6A 4C6CA 3GUGA 3LCWA 4Z2KA 7TIMA 2PCEA 4O12A 4YYFA 4PN2A 1NH6A 4NZ4A 3BLKA 3ANVA 4BHYA 1EGMA 4AZHA 4J9JA 4W7UA 3BV7A 1K03A 2XP6A 3O2LA 4H7ZA 3AS0A 2FDSA 2PUZA 1EF3A 4RPQA 2D2OA 1ROTA 4DPQA 1E9IA 3NQAA 4MZYA 4NZFA 1FUYA 4LAYA 3QM3A 5HQLA 4JTSA 3TR2A 3CO8A 4GINA 4JOMA 1O5QA 3B40A 1ISWA 3C2OA 5D75A 1GYLA 4O57A 1M3UA 1NWSA 2ZZ3A 3EPNA 2RDUA 3HQOA 4LB4A 2C19A 1RUSA 5C7HA 3EKLA 4Y6GA 2BXVA 4IQCA 1ZBKA 1JZ5A 3WD0A 3TN6A 1XXXA 4JYSA 4MNLA 1J0ZA 5I3JA 2CZ5A 4WKAA 4HYVA 2OLHA 4M1RA 4AB4A 3VC5A 2NV2A 1VGAA 1A5CA 3AO0A 3VI2A 1K4HA 2DG4A 4NKCA 3SY8A 2V5JA 4QX4A 4BI7A 1QW7A 4QDMA 3W27A 4PR4A 4O1FA 1KCXA 3FKRA 3FSUA 3GBDA 3V5OA 4F2TA 4MLJA 4DRKA 3CWHA 3TQVA 4L6HA 2WNWA 4Q8WA 5CKSA 3SBFA 3VYLA 4F2BA 3M5YA 3HO8A 2QJHA 4CNUA 1X97A 1C92A 2FTWA 3AIBA 4H04A 4MPKA 1RK6A 3PAJA 4GZEA 4M82A 2V6AA 2W79A 3E2VA 3VGBA 1ZB5A 3W7PA 5CZKA 1H7NA 2CWXA 3UI6A 4L72B 2P88A 4EXAA 4YLWA 4MFEA 2VGFA 1FKHA 3VDGA 3LRKA 5HMSA 5AVNA 3BPWA 2D22A 1EGVA 1S5VA 2PPOA 2A6LA 3CHFA 3R58A 5HKGA 4G5DA 3EKGA 1BXNA 3K4AA 4KBXA 2W91A 3ABQA 3GVRA 2UBPC 2ZQSA 3O05A 2BGNE 2WKLA 1DXFA 2R1KA 2Z26A 4LYKA 1U5JA 3I7QA 3I3BA 3NVDA 2XP4A 3PANA 3UCQA 2YXOA 4U2ZA 5FJUA 1OT2A 2NQ5A 3NPWA 5SWUA 2Z2BA 4LS2A 1XIFA 1OGBA 2XZ9A 3EWWA 3TXVA 1E44A 1UMLA 2HK0A 2IW0A 4KW2A 5I09A 5E0KA 2J7CA 4Z2HA 2QPSA 4QG6A 3CC1A 4JKKA 2C0HA 3H26A 3TEVA 4KRUA 2PDUA 2PDLA 1TPUA 1E1CB 5LKYA 4GUIA 2CC0A 1OCJA 1EWEA 3SECA 5CZJA 3M5VA 4U4MA 2IPGA 3H6OA 3NQGA 4GO8A 1XIJA 3L4ZA 1VHNA 4DIAA 3V36A 3IJLA 1M9HA 3VX1A 2OLAA 4ZQPA 2QUUA 1CYGA 3II1A 3REQA 2F6UA 4M56A 4TX6A 2I16A 2ACUA 1FHVA 2RSEA 7ODCA 4NHVA 7PTDA 3TMLA 1GOQA 3U2OA 3F1QA 3THUA 4ADUA 1KLYA 2VTFA 4WOZA 4Y9NA 3NI6A 4K2SA 4PMXA 4Z2GA 4Y9AA 1MWOA 1FFRA 4UTTC 4UTUA 1E6QM 1VJZA 3DECA 3CZLA 4Q33A 1UC5A 3WJWA 1O6IA 1BFNA 3PPGA 1UWAA 3W01A 4U85A 4WLCA 4FA3A 1G69A 3SGGA 3DFSA 4ZO7A 1UR1A 2R6OA 3G6LA 3MP3A 5I02A 4R88A 2CLHA 2W27A 3W07A 2PV3A 2Y7DA 1J4HA 2ZXAA 3K1DA 4UTJA 4PE8A 2Y5EA 2E5BA 3GVVA 3CL7A 4UFJA 3UR7A 3TQKA 4M8UA 1S39A 2FB3A 4AVOA 3PBVA 1T8QA 1Z41A 3B0UX 2CU0A 3UXDA 1R3VA 1W54A 2EG8A 3NPVA 2TRSA 3GFZA 3ATYA 3WF0A 3RR1A 1FHDA 2BOEX 4J1OA 1E6XM 4QDWA 2J74A 1B0IA 1FKRA 2CITA 1MSSA 4WQ6A 4HSNA 3LTYA 4Q7IA 1UIOA 3WNOA 5D30A 3RG6A 1CLXA 2UY4A 1QHPA 4KEUA 3L2MA 1OX4B 4L7ZA 2BASA 3QBUA 4DIPA 3KBMA 4NVTA 3PAOA 2WSPA 1ME8A 1S2AA 2PBOA 1UC4A 4LANA 2E5DA 3L68A 2A0NA 3CAWA 1S5TA 3OA5A 1VBUA 2XHYA 3IEBA 2Q71A 2VM8A 1W3TA 3TJXA 2E25A 1WOAA 4XZIA 4A3HA 1E15A 1QHZA 2G3JA 4KKXA 3P84A 4X63A 5A94A 3PNZA 4PFHA 4MWAE 3PZOA 5C5YA 4I3GA 1OZQA 2E5CA 1WV2A 2P0OA 4XVEA 4ZFMA 3AU6A 1OX5A 2VZOA 1UPMB 2DUXA 3PSWA 1WDSA 2NSXA 4AEOA 3P14A 4NJGA 4IMCA 4AWUA 1NDZA 1HX0A 3BL3A 4L6DA 4S3FA 3QV8A 4GYPC 5A8MA 2CERA 1QPFA 4S3JA 1N82A 2FPVA 2YCEA 1S46A 3QY7A 3EPMA 1JAEA 3KTSA 3CZJA 1VF8A 4MM1A 2E6YA 4HBOA 3WNKA 2D2HA 4IGNA 1I0BA 2WHLA 3S0CA 5A3HA 1FCUA 1PO9A 3WENA 2PDIA 1E0TA 4PL2A 4RL3A 4W9TA 1QOXA 2OO0A 1UA3A 3PJUA 3WX7A 2OOGA 3GY1A 4NRSA 4EVZA 1XINA 2W4XA 1J12A 3GG1A 3W7LA 4A2RA 3W37A 4BFAA 3USZA 5HW6A 1MXGA 1TZ9A 4Q6XA 3TX9A 3W7KA 2WNNA 4XBKA 3E5BA 4GYKA 3FYYA 1OINA 1XLCA 1Y8BA 3PRDA 3LXCA 2PZNA 2XU2A 5REQB 3WDRA 2TYSA 1BHGA 4IIBA 4WKHA 4P2VA 4RE3A 4S39A 1H7OA 1ONWA 2R1PA 3E5PA 2I5QA 2WM1A 2VGBA 1ZBVA 1VFUA 4FNPA 1SFSA 1QK2A 1LRNA 3DBNA 3BAXA 2HZGA 1WUEA 2ZXBA 1ZL1A 3B0VC 2ZX9A 5MKGB 5K7JA 5G1MA 2CZEA 2DT1A 3QGAC 1G0CA 1YTKA 4ACZA 1YPFA 4J4NA 3VPLA 3VIPA 4RX0A 3GG7A 1OQFA 3MZNA 1AMKA 4DZ3A 3CWOX 4N9EA 3WBAA 1OFRA 2ACSA 5A6LA 1XH2A 2NVAA 1JFHA 2RUSA 4IG2A 1UWIA 1ZGDA 4GMEA 1GVYA 3BLFA 3THDA 4MKVA 3V4BA 3OGSA 3VO0A 1GRJA 3TWAA 1YEYA 3UG4A 3SCSA 4HGXA 1JI2A 3W7QA 2XM1A 1NEYA 4C6FA 1SR0A 2WC4A 3RJYA 1DPMA 1E43A 3WLPA 1EJXC 3UWZA 1DTUA 1XG3A 4A22A 1D8WA 2MF9A 5HUOA 2W3ZA 6REQA 2NV9A 1EHNA 2YA1A 3GH7A 4S3GA 3UVIA 1EJWC 3NTYA 3RIKA 1VRXA 1IIHA 3DYOA 3TE9A 1QT1A 1GW1A 2WMKA 3VD9A 2WJDA 4Z17A 4R33A 5CBIA 1SMAA 3U6WA 5HK4A 1S3TC 1FH9A 5DCEA 2DT3A 4GXWA 2O7SA 4O11A 3R10A 3CL6A 3EDFA 4J5NA 2VOTA 1MQRA 3FYPA 2Y62A 4GZJA 3VCNA 4XKMA 5EFDA 1PBGA 3GTHA 5B7YA 1TX2A 3AUOA 1JDFA 1ITCA 5CGMA 2A21A 1YQ2A 4JXCA 3GVGA 1RV8A 5I98A 2FVMA 2XSAA 4QEEA 1E6RA 3FS2A 3WELA 3CUZA 2XTKA 4GA8A 1JF6A 1CT5A 1J4IA 4LH8A 2C14A 3ME3A 4OIFA 1J0YA 4LF1A 3UXAA 1FWAC 3N6JA 2CCRA 2IXVA 2YGYA 1O5RA 3IJ9A 2DVUA 2QIIA 2J79A 3S5YA 4UDMA 4DHGA 1XPYA 2RFGA 3LCGA 1P0EA 1W26A 3IWPA 3S6TA 2VELA 1OSEA 4UB9A 2O9OA 1A5KC 4NILA 1LG1A 2HNEA 3MJMA 1AD1A 3SIMA 1O5KA 1GVEA 1G7UA 1UH4A 4R53A 5CC6A 4ACYA 3A12A 3M43A 3WD2A 1KM2A 1G6CA 2YR1A 4EE9A 3I6EA 3FV9A 5CLWA 1TJ1A 2HRWA 1AA1B 5ABFA 2HEJA 2PU1A 4MMWA 3W1TA 4XISA 2YJQA 4RNHA 3BLDA 3KADA 2E7FA 2FYMA 2CHNA 4R9OA 3F2BA 2VC7A 5DBTA 2REQA 4BQ2A 3GTYX 2XP9A 4AEEA 1D9EA 4CCEA 3DBPA 1OFBA 2C71A 3B8WA 2Y0FA 2FHFA 1US0A 1K7FA 4FR6A 4G7EA 1S5NA 2VL4A 3BANA 1LQ0A 3RX3A 3EWDA 5JBEA 4EF9A 2VCDA 1EDGA 1QPNA 1C29A 2FTYA 2Z1XA 1PIIA 2BP1A 1T11A 2HROA 3VKKA 2I57A 4ZOEA 3RM9A 1H51A 5XIMA 3A21A 3MVIA 2GJRA 2PD9A 3W9ZA 1ICQA 3E96A 2AWGA 2YCLB 1S1PA 2IKHA 1J0IA 4A8RA 3C86A 1Q4NX 2WO5A 2WVUA 4KWWA 3R25A 4OOUA 4DO7A 2E9BA 3HJEA 3KVKA 4B5VA 4IGHA 3MTWA 1MNZA 3TYZA 1CTNA 3D6NA 4WGXA 4JFKA 4EF8A 1XLFA 2J7GA 4ODQA 7REQA 5GQBA 3QPEA 3DFYA 1YRRA 2H8ZA 1VCFA 1RBOB 3W23A 4HN8A 3KP1A 4C6PA 4HOZA 4ZSTA 2PGEA 3LLXA 1DIOA 5DX7A 1JZ4A 3G1FA 1OBAA 3TC6A 2HE5A 4CU7A 4H2CA 3TCZA 2W9MA 1MUCA 4WCJA 3WNPA 3SCWA 1DHPA 3CIVA 1N8IA 3PR2A 2O9TA 3U8GA 2IQ0A 1GTEA 3ZJ8A 1JZ8A 2JK2A 1XICA 3DHFA 3IJQA 3KUMA 1XLKA 3T0DA 4D6FA 4N9CA 4NI8A 1OFQA 4LJ3A 1PKMA 1LL4A 4QG9A 4BI5A 1SW0A 1JPDX 3AICA 1Z3NA 2Z1KA 3PF3A 4I6KA 3A4XA 1Q6LA 3H55A 4RR4A 3INPA 1ELSA 2H9AA 1PYMA 5C2XA 4DUXA 5AC7A 1GJUA 3N4AA 3M46A 1OHLA 5EL1A 1V8EA 4GOAA 2ISSA 4JNMA 3EEZA 3LHTA 4H7VA 1UKQA 5JXQA 1DWJM 4BY3A 4JYDA 4AZBA 3R8GA 3L2LA 1E4LA 3BXWA 2Y24A 5CQ1A 2ALRA 1B4KA 1XD0A 1WNOA 1R3WA 1GQKA 1UR9A 3AHVA 1SJCA 2PTXA 1LYXA 1V0KA 3PG8A 1A0DA 4B5SA 1DQXA 2CEQA 5I3GA 4CNOA 5TNVA 5JU6A 1VPXA 1FCQA 4HPNA 2FZDA 2ZRWA 1V3MA 2AMGA 3SUWA 1G67A 1ZS2A 1DWFM 4OUIA 1GZ1A 1VH7A 1VKFA 4H8NA 4LVAA 5I24A 5IHRA 1GHSA 2CHRA 4P7RA 2E09A 1BTMA 5C9UA 2OR2A 5KMYA 3IVTA 5A8QA 3VTRA 3LB0A 1OM0A 3H4GA 3SGZA 4ORIA 3T9PA 2Y63A 1BL4A 1FBAA 3SCNA 1VRDA 3L0GA 1Q6UA 1FCBA 4PMUA 1TIWA 1FWBC 5E0CA 4XD3A 4WDTA 3FN9A 4TW8A 4FR1A 1KRAC 3G22A 4KPLA 2ZWYA 4DVOA 4RW5A 4UTKA 3M7SA 2PDQA 1KFLA 1KWGA 3B8UA 1XDJA 1AJ0A 1UJQA 4NRRA 4DBDA 1QI5A 2GJNA 4M19A 3S5NA 4ZE5A 5LNVA 3AZTA 2E1DA 3EDJA 2CZDA 1GQIA 2DH3A 3H7RA 4V28A 2OKOA 2NQ9A 3MDUA 4A35A 2PDHA 1J10A 1NSGA 4GYJA 4JY8A 2G3MA 3E74A 3MI6A 4BF9A 3GXPA 1JCJA 4DO4A 1WBJA 2D1ZA 1TR1A 2XG9A 4HSHA 1JNSA 3O5EA 3HGOA 2E68A 3C2EA 2YYUA 4A3RA 1D7KA 3OLIA 5HR7A 4PH6A 3BAYA 1DE6A 1CGUA 5DANA 2YA2A 1XYLA 4WD0A 5CPQA 2BWGA 1IWPA 5CPOA 2R82A 2O92A 4JTIA 4Q8OA 2WWCA 1HN1A 1JZ7A 1LG2A 2OSYA 2VDGA 3GE7A 3WQ5A 4QIBA 3TXZA 3OLDA 4IPNB 4TW6A 3T42A 1F76A 4ONVA 5M03A 3G6MA 2PU0A 1HZYA 4J4OA 2ATSA 2B7PA 3O5FA 5K3VA 1C7SA 4D6JA 1FKLA 4C5ZA 4AAJA 5FACA 1JCLA 2V5DA 3ZLFA 5HNNA 5H1WA 1QZ2A 3GC4A 2Z7GA 3DG6A 1NQKA 3WQWA 2MNRA 1DORA 3UPWA 3KEHA 4F0LA 2FMOA 3NA8A 3I4KA 4IHCA 1W9DM 4NI3A 3OQEA 5BXRA 4UOQA 1PVNA 3MCMA 4MKNA 2XSXA 3CMJA 3GZAA 1TPEA 3BAJA 1OD0A 2ZR4A 4UFHA 4JTHA 1JIBA 1TPB1 5EA9A 4A3UA 2NX1A 3PWGA 5HUAA 3PM6A 3TW9A 2INFA 1BYAA 3TSDA 2YB1A 4FOUA 1O4UA 4HNNA 1W9BM 3B9NA 4GK8A 3WMSA 3E6EA 4PC8A 2XIOA 5XIAA 5KETA 4QCEA 3TYAA 3VD7A 1TV2A 3IPWA 4EANA 1QWKA 3KWXA 4ZO9A 2JEQA 3ARTA 3O8AA 3GXFA 4NF7A 3SJ3A 3S8HA 1KKOA 5BYWA 3E0FA 4L5ZA 5B7ZA 2CBJA 1TJRA 3R1ZA 4JIIX 4JS3A 1WKYA 1BXBA 2VX5A 3UWYA 2BVYA 3EX4A 3TCEA 2R14A 4IMEA 1TV4A 4O0QA 2AL2A 1BGAA 7CGTA 3PZNA 1J4EA 3ANYA 2YDQA 1Q6CA 3HURA 2OELA 3IS4A 3PRAA 2BSLA 3DC0A 3CB3A 5D9NA 5BOOA 4Z0SA 1W1A1 3AWNA 1LL6A 3OBKA 1IGWA 3PP7A 1FWEC 2PWVA 4DF1A 3OZMA 4PUWA 1WKEA 3LZ3A 4E2VA 2DFAA 5C9XA 3CASA 5KEZA 3A6OA 2NXIA 4ADTA 2MLYA 1CGWA 2HVOA 1JCMP 4S2CA 1VR6A 4HU3A 1F05A 1EJVC 1ZBCA 2C6QA 3FXGA 2VWTA 2G95A 4MADA 3L23A 4US5D 4P8VA 3ZLGA 1E1CA 1W8SA 4BF8A 2NUYA 2WHJA 3KVLA 2HDJA 3GNOA 3V7PA 3MC5A 3P80A 3BAWA 5DMMA 1DTNA 3M0XA 4WDUA 5LIXX 3UCDA 5HR6A 3P81A 2V3DA 1WZAA 3TTYA 3B4UA 1VLWA 3NJ3A 1W5OA 2YLAA 3DFTA 3OG2A 5HNTA 3NFUA 1W2VA 2QDGA 4F3HA 1OCNA 1OD8A 2HJPA 4UZSA 2QJGA 3N04A 4GIRA 1WDRA 1WZLA 1FWIC 1JULA 5E93A 3D47A 2Z2AA 4W89A 1KT0A 4PULA 2FZBA 2XH2A 1LCOA 1AK5A 2B4GA 1X6NA 4HKPA 4GQBA 3UG8A 1XYAA 1XLHA 3GKFA 3SDOA 4R0XA 1XGDA 1YYAA 1G5AA 4JN8A 1GTHA 1YHTA 3BGAA 3RGTA 4MNKA 4HPXA 2BHUA 3BW2A 3I6TA 3AMCA 2XFWA 1FKXA 2Q3RA 3FAXA 1ICPA 5LYRA 3WDPP 5DLCA 1GORA 1R30A 4UFIA 3SR7A 3EA2A 4JPGA 5F2IA 3TQPA 1UP0A 3P61A 2WZMA 4DRPA 4JX4A 2YXXA 5C55A 3G8EA 3EWZA 3WDIA 4Y90A 2WZIA 4DXVA 2EPLX 3QH2A 2PD5A 2Z25A 4XZNX 3SADA 1FP9A 1PTAA 5HBFA 1F3TA 3ITGA 1IQ8A 4MJ4A 3DFQA 3WUGA 5FIPA 4DEFA 2Q8LA 3O3RA 3C0LA 1F6PA 3RX2A 2ZUVA 1ZENA 4LYQA 1YDOA 4DJED 2ZXDA 3CEUA 3TFXA 3VMOA 3WDQA 1KQZA 4R7OA 1PZ1A 3VD5A 5AZ1A 1H7XA 2GK1B 3KABA 3IIVA 3GH5A 3HQ1A 3JYJA 4QHRA 1EUNA 3QZ6A 5BXSA 2AKZA 1I2OA 3C8FA 4BR1A 5IBXA 1OX4A 4PUMA 3TNBA 5CSUA 5AC6A 5IFTA 3OZOA 3RPTA 4BQ3A 4B5UA 5HPCA 3UZZA 3S46A 1KFCA 4LRTA 3W7JA 3RLHA 3T81A 4U28A 3WIJA 5HATA 3GDKA 3G3DA 4BQ5A 3WDHA 4HCHA 2HISA 3SUTA 4Z08A 4XAPA 3GDRA 1WE5A 2X0HA 2VRQA 1XLLA 3RYSA 1UWTA 5HW7A 3HPSA 1D7FA 5BOEA 3WF4A 2H3DA 4EIVA 1E72M 2PMQA 1VJSA 2WPBA 2XIMA 4IX0A 2D3NA 3WD1A 1DIKA 5EMLA 4JDBA 3IUHA 4W93A 1L6FA 3STCA 2WPGA 1UW9A 4RXFA 4DRSA 3DHPA 4UQDA 3GC2A 1ZP4A 3AJ7A 3L2IA 2PI6A 3CUGA 2DQXA 1TFVA 3VGHA 3QSTA 4JCMA 2EXOA 4ZQOA 4PODA 4OWGA 1K7XA 6XIMA 1IEVA 5A6BA 1HVQA 5FJOA 3BSMA 4AMAA 3PBUA 3W82A 4C5YA 3NQ2A 4IX2A 1RXOB 3KWSA 1SU5A 5M1TA 1KM5A 1XRSA 3L0NA 3P8JA 2J9YA 2CLIA 1EC9A 1UQYA 2QV4A 4M5PA 5HA7A 3S2CA 1TPFA 2RJHA 1XGEA 5K4ZA 3AJXA 2BXZA 3ARWA 4Z1AA 1XGZA 5F2LA 3ZO9A 3WH5A 1KXVA 5E70A 3UWEA 1HXVA 4AD1A 2P1FA 3IJDA 2YPIA 3AYVA 3N3MA 3M7WA 4ILSA 5CAHA 1K6AA 3DHDA 3ZJ7A 1XBZA 3GW3A 3ITYA 4ICNA 4IP4A 1UWQA 4JN6A 3WBEA 3OBEA 1QI2A 3LV5A 2GGGA 1XIBA 3C0SA 2O7QA 2ZICA 1DWIM 1QWGA 4HZ6A 3OVQA 3QHOA 4OECA 2GWGA 4RXGA 2KR7A 3PTDA 1WXYA 2AMXA 3F4NA 1OC7A 3MUZ1 4XG1A 3M0KA 5MKGA