4DWSA

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
543
structure length
526
Chain Sequence
GAVPTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEKIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADETIDMGPLYNPGEIYLSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
total genus 186
structure length 526
sequence length 543
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsA02
1GHSA 5JBEA 2Y4SA 3SCUA 1TVPA 1OGGA 1KCKA 1NWRA 3EYPA 2G41A 4WKFA 1A47A 3M6DA 2FHBA 1WKYA 2PB1A 3A4AA 4PMQA 3AIQA 4DUXA 4W7VA 1TVNA 3B9AA 1J0KA 4WJXA 4D1IA 1W1VA 1WDQA 1E6SM 3CH9A 3NIYA 3WH7A 1CTNA 2D20A 1XH0A 1OBAA 2VRQA 4LYQA 3GM8A 4P7QA 1VFUA 5AYBA 1UKQA 1LL4A 3VGBA 1B3VA 2WMIA 5A95A 1ZBVA 4CN6A 4YN5A 2XFFA 3T09A 2O9RA 4PCTA 3SCWA 5LYRA 5CJ5A 3VGDA 2VTFA 3WD4A 1J0ZA 3WMBA 2X0HA 4GZJA 3AICA 1BGAA 3THDA 5JUVA 3T2OA 5D8WA 2YL8A 5F7UA 1E1EA 1QPKA 3K4AA 3VGEA 5GPRA 3KL5A 1OT1A 1V02A 3ARSA 1JD9A 3CUIA 1LWJA 1W3HA 3A3HA 3L4YA 2ZXQA 1ZBKA 3BSHA 3AMKA 3THCA 4U2YA 3DECA 1E5NA 3UERA 1GVIA 2XSAA 1PX3A 3N13A 1O7AA 3U5YA 4L4PA 3GTNA 3WFZA 3T2PA 1XYZA 1CLVA 2J4GA 2ZICA 2YKKA 1UKSA 4EKJA 1V0NA 2XVLA 3VD3A 4W5UA 1JZ8A 2XWDA 2WHKA 2ZX7A 3EMQA 1C8YA 4NRRA 4Q22A 4ACYA 5BROA 1W2PA 5BWFA 1WP6A 5D9MA 4DWSD 1E73M 4PUEA 2XUCA 3K46A 4W89A 1QNRA 5DT5A 1PIGA 2PI6A 4U3CA 4TUFA 3SCNA 2BNJA 1KGUA 2J79A 5FCZA 3WF1A 3PZIA 5DF0A 1UQYA 5E6YA 2DSWA 1XYFA 4IUGA 1WPCA 1HIZA 4MNLA 3L2MA 5BYWA 1MXGA 2J25A 1JFXA 2PF0A 4X9YA 3APGA 4UQEA 4B16A 2WVUA 1NQ6A 1WO2A 3GNOA 1LLOA 4AWEA 4IPNB 3AHYA 3W27A 2BXYA 2V3FA 5D9NA 4HOZA 1VAHA 3BXWA 3UESA 3WQ6A 5BXTA 3BLPX 1UD2A 2XSBA 1QI3A 2CHNA 1K9TA 4W87A 4Z2IA 1B3ZA 2YDRA 2VO5A 5E6ZA 5HXMA 1J11A 1WNOA 1M03A 2YLAA 2IXUA 5BXPA 1VIWA 1J01A 4M24A 2ZOXA 5CXPA 3DYPA 1HT6A 2GDUA 4HOXA 1VBUA 4GZIA 4JFVA 3AHZA 4W5ZA 4E8DA 3WUBA 2QV4A 1LG1A 1HNYA 1Q6EA 3CUJA 3MV11 1XHGA 1MW2A 1U33A 4BQ2A 4PMDA 2WCSA 2ZXBA 4JIEA 3PZMA 3PN8A 3ARPA 1TFVA 1U2YA 4AZ5A 1VBRA 4LXFA 2E40A 2VL4A 1FHDA 5JH8A 1WZLA 3TTSA 3PZOA 4F9DA 4WK9A 2CYGA 2YBUA 4J3WA 4UQAA 2NT0A 1C91A 2ZX5A 3WQ4A 3VNYA 1W2VA 2WVVA 1CLXA 1E6ZA 1C3FA 3IAPA 5A6LA 3W53A 1HVXA 1JL8A 1ITXA 1BYAA 2VX6A 2DH3A 3U5UA 4PTXA 3SUVA 3NUKA 5ABGA 4P7OA 2YDQA 1B3XA 5HPOA 1UH3A 1UWIA 2BY0A 4C7FA 1DWJM 3MUAA 3VDHA 5FIPA 1FP9A 1VJSA 1E4NA 2WYSA 3NDZA 4JZ5A 3B9DA 3CBWA 1H4PA 5ECUA 3VKKA 5D4YA 3KL3A 3I3EA 1GOMA 3AZRA 4BCEA 5IHSA 3ZJ7A 2TAAA 2QMKA 4TVUA 3B9EA 1EQPA 2UY5A 2Z1KA 1ISVA 1BPLB 2VZUA 1AVAA 1TCMA 5C71A 3ZT5A 4AZ6A 2WWCA 6TAAA 5A6SA 3WL0A 1XSKA 4IM4A 2ZX6A 1CXHA 1B0IA 3ARQA 2G3IA 5CLWA 2WSPA 3RM4A 1B3YA 3OLDA 3DHPA 4HMCA 1EDTA 2CHOA 3VINA 1E0WA 3AYRA 1V6YA 1NARA 2CBUA 4M82A 3WD1A 3ZIZA 4OBSA 4B9ZA 3EDEA 3UG5A 3PZTA 2Y5EA 3ZR6A 3EDDA 5E0FA 4BZYA 4DM2A 3UETA 2GJRA 4XZBA 2JIEA 4BQ4A 2O9PA 1V6VA 2ESCA 1B90A 3N17A 2DT3A 4UFHA 4EAMA 1KR0A 2GVYA 1GQJA 1CPUA 1BF2A 1V3KA 2C7FA 3QR3A 1UA3A 1I1WA 1JDDA 4EE9A 1IZKA 1SMAA 2DPEA 1U30A 1BG4A 4HA3A 3VMOA 4AIEA 7CGTA 1Z32X 1D7FA 1C7TA 4OJYA 4ATLA 4GINA 2NT1A 5LA2A 1BQCA 1WDPA 4ACZB 2FGLA 3GH4A 3CZGA 5D9OA 3VMNA 3S6TA 1JAKA 5HOSA 4MDOA 1HN1A 4JCLA 3K1DA 4MB4A 3G6MA 1QI4A 5TD4A 4CCDA 3U57A 1V6XA 4QFUA 1E56A 1RPKA 1OD0A 3W26A 3BH4A 3OGRA 5E70A 3F5JA 4H8UA 3RPMA 4W8LA 3ZR5A 1C90A 1H2JA 4AIOA 3N12A 2BY2A 3OZPA 1BSIA 4UFIA 2XWEA 1ZB5A 3WDPP 2WB5A 4JAWA 2AMGA 2D0GA 3IK2A 3CZEA 1W3KA 1VB9A 4J3SA 2CKSA 2CEQA 3RJYA 3VIOA 1UOKA 1V02E 4PMVA 4A4AA 1UG6A 3AOFA 4IPLA 4QCFA 1VEOA 3ZJ8A 4NRSA 1W91A 2WW5A 1VFOA 5LA1A 3N1AA 1HJUA 1ZJAA 2G4FA 3AMLA 3AS1A 3OIHA 1BYBA 1GOWA 2PBGA 3CUGA 4GQQA 4MJ4A 1JZ5A 1UYQA 1JFHA 1CWYA 3N18A 3AROA 2EPKX 1BYDA 2W66A 3WH6A 2D2OA 1G0CA 1UWTA 3PZVA 4H2CA 4CN1A 1QBAA 2E8YA 5IXEA 4B9YA 1QI2A 5A8NA 1UWUA 5EFFA 3T2QA 4ZXOA 2VOTA 1H49A 1H09A 4CN4A 3W6MA 2OYLA 2CIPA 2WM0A 5I3DA 1PX4A 1XV8A 3B8SA 3ARUA 4D72A 4HOWA 3RDKA 1TR1A 3W28A 3TP4A 2PWGA 2BVTA 3CHEA 4PMUA 3FHAA 4P7LA 1WB0A 1M04A 5A6MA 3WEZA 2DQXA 1JZ6A 3MKKA 1J0HA 3GH5A 3FAWA 3EMZA 4TOQA 1DWHM 3OGVA 5BXSA 1VEMA 4UOQA 2VJXA 3IJ9A 3ZT6A 2DSZA 1MFVA 2RGLA 4W93A 1BFNA 1MW0A 3N15A 2CCRA 5D9PA 1E15A 1X6NA 2FHCA 2WWDA 3LPPA 4PMZA 4B15A 4KWUA 4R5EA 1HJXA 2V3EA 1V3LA 3VDAA 2FGZA 2WAGA 4JFWA 2XFRA 3VOCA 4MDPA 4AZCB 1HKMA 4PTMA 1BGGA 3L2LA 4CD7A 3W25A 3WN6A 4W84A 1B9ZA 4FLOA 1E3ZA 4S3JA 3OBAA 3SCPA 1H0GA 3WBAA 3AHXA 4KGLA 2VR5A 4Z2KA 4CD8A 4J7RA 1GQLA 3ARZA 1JG9A 3CUFA 1VF8A 4PEEA 2JIWA 2J74A 4QLJA 1DWGM 2W92A 3UG4A 2GJXB 2EPNA 3VTRA 4ZE4A 4WSJA 5A6KA 1LG2A 1TUXA 3RM8A 1ITCA 1W3LA 2F2HA 3WDJA 3SUWA 2X0YA 1TA3A 3WEMA 2AAAA 4N0RA 3CZJA 4KMQA 3N9KA 2EPOA 2XVNA 3AFBA 4UOZA 1IT0A 2W91A 4AXNA 2WMJA 4UFLA 1LQ0A 1GJWA 1E4IA 1W3JA 1W9BM 1KCLA 4ZFMA 1UH2A 3TONA 1ESWA 3BC9A 4CVUA 1CXLA 3W6LA 1W9XA 1UZ4A 4JKMA 1V3MA 1US3A 5AC4A 1JDCA 5DMYA 1HKKA 4F79A 3WQWA 4OZOA 1E43A 1R86A 2WZEA 4LX4A 2PWEA 4YHGA 3K8MA 1AQHA 1ISXA 1AQ0A 1US2A 1LL6A 1JIBA 4JFTA 1J18A 1W1PA 1K6AA 4W8BA 3WNNA 3SIMA 7TAAA 1HX0A 1XD1A 2VVNA 2WMFA 3WNLA 2C0HA 4W7UA 1VFFA 3OGSA 1V3JA 3ZSTA 4P7RA 1E72M 4HTYA 1MVYA 2FH8A 3AI0A 4E4PA 1MWOA 3CHDA 1DWIM 5EB8A 3CUHA 2EQDA 3WF4A 4PUDA 2HISA 3BMWA 5JBFA 3O2LA 4GPNA 4U33A 1Q6FA 2J78A 1CXIA 3ARRA 1CGWA 1W9PA 2WC3A 1G9HA 2BHYA 3WNPA 2VX4A 3VM5A 4E8CA 2QF8A 1YQ2A 1NH6A 1HL9A 1CGUA 1WDSA 4M81A 3VM7A 2VRKA 4LYPA 4KH2A 3IANA 3T0DA 2XVPA 1QNSA 1EHAA 2AOSA 4PBGA 2GFTA 1WDRA 1Q6CA 2W63A 5CQ1A 1D2KA 4H7VA 3WDHA 1CGVA 2OWWA 3GXDA 4J27A 4PTWA 2CERA 4H8HA 3E1F1 4OOUA 3VD7A 5CZKA 2J77A 3WELA 1G1YA 2J75A 5JIWA 3WDRA 2WLZA 4AW7A 4A3HA 4LYRA 5IFTA 1ZJBA 1DWAM 1FA2A 5GNZA 1PEZA 3BAXA 1MQQA 1H1NA 2JF6A 3VGGA 3AYSA 4GI8A 2G3MA 4M8UA 4PMNA 4ACZA 3I3DA 3A4WA 1W9DM 2J7GA 3NSMA 3IJ7A 2J8FA 2W61A 1JD7A 3HJEA 4HMEA 3AS3A 4MTVA 2J7DA 2F61A 2VZVA 3W4RA 1Q6GA 1BVNP 2V5CA 2JF7A 1SR0A 1JZ2A 5I78A 1CGTA 2XTKA 1G01A 2EPMX 1JXJA 3GXMA 1CXFA 3WKZA 3EDJA 2VR4A 2WZIA 1GPFA 2BHUA 2WANA 1C7SA 1B1YA 1HL8A 1H5VA 5CGMA 3PZGA 3M07A 4WKHA 3J7HA 2E9MA 4MNMA 3WH5A 3AIRA 1EGZA 3S2CA 4BQ5A 1LJYA 1PBGA 1HJWA 1IZJA 2WCGA 4MNJA 2ZWZA 4JL2A 4QAWA 2D24A 1KGWA 3A4XA 1X6LA 3KWXA 2DSUA 1KR1A 3BAJA 1KGXA 1WAWA 1E71M 1ISWA 3QGVA 1MW1A 3OLIA 1UKPA 3FNDA 2XVKA 2W5FA 1HXJA 4ML4A 1JI1A 1JYXA 5DFAA 2OWCA 2OLHA 4AZ7A 2GJPA 1CZ1A 1MYRA 1EOKA 4HZ7A 1CXKA 4EANA 2FHFA 3VX0A 1H0IA 1CECA 4WLCA 1UR2A 4D6DA 1EOMA 1TZ7A 1GQIA 4KRTA 2O9TA 1QW9A 2WKGA 1N82A 2WSKA 1GJUA 4Z2JA 1OT2A 8A3HA 2V3DA 5E09A 2D3NA 3JUGA 1HP5A 1VEPA 3UG3A 3WY1A 3CLWA 3ZT7A 2WPGA 3QHNA 3AMCA 2VRJA 1HF6A 2ZUSA 3OLEA 4GI9A 3IJ8A 3L4TA 5HDRA 1UKOA 1GORA 4W86A 3RCNA 1TG7A 2E3ZA 1KXTA 4PCSA 4AEFA 3NCOA 3VX1A 2BVYA 1Y7VA 1VFMA 3SUUA 1R85A 3AXHA 4CCCA 4MJ2A 1CYGA 3NDYA 5I0DA 2E9BA 2XGIA 5M03A 1E6QM 1UR8A 2J7HA 3W29A 2WMHA 4NI3A 2QLYA 1E3XA 1VJZA 3VNZA 1PPIA 1UWQA 2WMKA 4D6CA 2BY1A 1QI0A 3II1A 3AXXA 4D1JA 3TTYA 3LMYA 2J47A 1KBKA 2XVGA 3WFLA 2JFEX 5CLTA 4AZCA 3QHMA 3WDQA 2VZOA 1E9LA 5JBDA 3WENA 1BAGA 1UD3A 3LPOA 3T0AA 2GDVA 1SYTA 3SUTA 3VIGA 1JDAA 3CO4A 1J0YA 2VMFA 4DWSC 4W85A 3AIEA 4CU8A 4D6EA 3UR7A 3WNMA 5I77A 2A3EA 4MAVA 4HPHA 2YDSA 3VUPA 5I5RA 4N42A 3ARVA 1GHRA 1NOWA 2VNCA 2A3BA 2ZXDA 4MNKA 2DGAA 2W62A 2VQTA 2OSYA 1L8NA 1WZAA 3GDBA 1JYWA 4U2ZA 4QP0A 3WF3A 3ARYA 3AMDA 2JE8A 2D1ZA 3AHTA 3M7SA 3VDBA 4GZEA 4V27A 3OA5A 4BA0A 1C8QA 4CD6A 1RH9A 4B3LA 1UD8A 1QHOA 2X1IA 5HBFA 1OCQA 1OIMA 4CVWA 4H41A 4PMXA 3SCRA 1E6PA 1ISYA 2EBNA 1UA7A 1UD5A 2Y24A 1BVZA 3VILA 2G8ZA 2WZHA 2ZX9A 3PTMA 2VC9A 1UHVA 3TTOA 4QDMA 1OSEA 5HNNA 3VIJA 3WNKA 1S46A 1DP0A 2EPLX 3TOPA 2XIIA 1ODZA 2X8RA 2XFYA 4FLQA 5CPSA 2VX7A 5M17A 3FY1A 2W4XA 3NSNA 2J7EA 3WUGA 1GOIA 1GQKA 2J7FA 1QNQA 4QLLA 4MADA 5C70A 5BCAA 2G3JA 2GSJA 3CMJA 1YHTA 6A3HA 4TTUA 1BLIA 5GNYA 4Q7NA 4UCFA 2DIJA 4J3UA 4ATDA 2WHMA 5FOOA 2JALA 4K68A 2WC7A 1JZ7A 1KQYA 1W9VA 2YOCA 4FLRA 1KWKA 1FP8A 4R27A 2EEXA 4F66A 3W38A 4NZCA 4XZWA 3WMSA 1GW1A 4TVCA 4HA4A 1JF6A 4GI6A 3WD3A 1GOQA 2VT0A 1GCYA 5A6AA 4Y7EA 2PWHA 4AC1X 3BLKA 3WEOA 3POCA 1OWQA 3QOMA 1PIFA 4H8VA 3RILA 3WF2A 4UQ9A 3BMVA 3AZTA 4GXPA 4W8AA 1DHKA 3WL1A 3SCSA 1HJSA 4JKKA 3PZNA 3VD9A 1SMDA 1DEDA 1UD6A 3WMCA 2V5DA 4FK9A 2WHLA 4MB3A 3NYDA 1E5JA 3AQUA 1MQPA 3MSDA 4JFUA 2J62A 4WSKA 3VPLA 1FFRA 1JAEA 3KZSA 1GNXA 1BHGA 3O9NA 5M5DA 3RM9A 1KQZA 4HA1A 1V0MA 1OGSA 3N04A 3BAKA 3LPFA 3GBDA 1V08A 5IDIA 4PMOA 5FL1A 2OSWA 4CU7A 4D6FA 2E0PA 1A3HA 3VIIA 5A3HA 4RE4A 4URIA 1EQCA 2OWXA 2DT1A 2WK2A 4HMDA 2CBJA 4AZGA 1W1TA 1FHLA 2EXOA 4DWSB 3EMCA 1HKIA 2WVSA 3D5HA 1JYNA 1JNEA 5DT7A 4LPCA 1RD6A 4F8XA 2VI0A 4AZBA 4JCMA 1XCXA 8CGTA 3A47A 2OSXA 1R87A 3CPUA 4J3XA 3UR8A 3CTTA 2XG9A 5KZ6A 1GOOA 1K9FA 3L4UA 1LF1A 5IFPA 4HZ8A 1X1NA 3GXFA 3NSXA 3AIBA 1W32A 2J7BA 1KB3A 2DEPA 1ODUA 3W82A 1J12A 1WE5A 3FAXA 1E70M 5I23A 3WIJA 2XIBA 3ECQA 5A2CA 4J28A 2Z1SA 3WH8A 1CGXA 5ABEA 4W88A 3F5KA 2IUZA 4LGXA 5A6BA 2YBTA 3WD2A 2WNWA 1HJVA 2HVMA 3VD4A 1LL7A 5DO8A 3AMGA 1HJQA 3GNPA 2CETA 4FF5A 4J3VA 3MU7A 2VCBA 5DEZA 1KXHA 3F5LA 3QHOA 4PMYA 3FW6A 5CSUA 1B2YA 1UR4A 1QW8A 4UOJA 3BCFA 3RIKA 3ALFA 1E4LA 2YL9A 1NWUA 4RE3A 1J0IA 1UR0A 1ZL1A 3N11A 1GUVA 3W24A 3VGFA 3MSGA 3OG2A 1NOFA 3ZQ9A 4RE2A 1PX8A 4U5IA 1ZS2A 2X2YA 3WSUA 4M29A 5AY7A 1I75A 3TTQA 2VURA 2W67A 3ZJ6A 2BV9A 3UCQA 4NF7A 2DDXA 5I79A 1B31A 3AIVA 1KXVA 1BYCA 2GK1B 3WD0A 1XRVA 3PTKA 4UFKA 3L4VA 3ALGA 3LPGA 2VUYA 4AD2A 2D23A 4AISA 1RP8A 2A3CA 3WUFA 5A6JA 4D6IA 3HMCA 3L4ZA 2CITA 1DTUA 2GUYA 4TTGA 4AZHA 5FL0A 1V6WA 2YLLA 3VIHA 2O92A 1G5AA 3VDCA 3SCQA 3PZQA 4D71A 2C8NA 4MAZA 1OB0A 2PWFA 1FFQA 2RGMA 4OOZA 3VGHA 4D6JA 4U31A 2DSVA 1DWFM 4P8VA 3MUIA 3EDKA 4DUVA 3VU2A 1E0XA 3VO0A 2ZIDA 1IV8A 2QHAA 4CD4A 2CESA 4HU8A 1W9UA 3KL0A 2ZUVA 2YIHA 3VD5A 1V3HA 5I6SA 1H3GA 4QCEA 2PBOA 2WBKA 3RMEA 1H11A 4P7NA 2DH2A 4KGJA 3MS8A 1ZBCA 2WC4A 2WXDM 1CBGA 2ZUNA 5I24A 1OD8A 2F8QA 1UH4A 2BVDA 1UUQA 2G3NA 2CPUA 3G6LA 4HZ6A 4AIUA 2BS9A 1PZ2A 1V3IA 4V2XA 2DSKA 1MW3A 1EH9A 2JEPA 4OBRA 4ZE5A 4Z2HA 4AMCA 4WKAA 3PZ9A 3DYOA 4UQDA 3AHVA 3VIFA 4JL1A 3A6OA 1ZBWA 1XGZA 4PMRA 3U7BA 1UWSA 3WDIA 4AEEA 4CKQA 2FH6A 2IXVA 2A3AA 4GIAA 1FH8A 2D0FA 1OIFA 1K9DA 1NWTA 3CGTA 2J7CA 3WBEA 1AQMA 1XCWA 2FDMA 2Y2WA 3UEQA 7A3HA 3VIKA 3ZO9A 1PZ3A 3WQVA 4UZUA 5ABFB 3F4VA 5FKYA 4BQ3A 4H04A 1GOKA 4QLKA 2UY4A 3AJ7A 4LQ1A 3EDFA 3O6AA 3OLGA 4X0VA 4CU6A 1C8XA 3T08A 1FOBA 4TXEA 3BGAA 2CBIA 2V38A 4AD1A 4UTFA 2WVTA 1RP9A 3PZUA 1TA3B 4DM1A 3I3BA 4OKDA 2XPKA 4JKLA 1EDGA 2E9LA 3CHFA 4GKLA 2VZTA 4P8UA 5ABHA 3VVGA 3SURA 2WMGA 2NSXA 2D22A 1NP2A 3BAYA 1H41A 1G94A 4AD3A 4UNIA 1GZJA 3SCVA 4MB5A 4OUEA 3SCTA 4D6GA 2MANA 4PTVA 3GYCA 4UQBA 3WQ5A 1V0KA 1CIUA 2WMIB 4J3TA 2DT0A 2PC8A 1QBBA 2EJ1A 5A94A 5D8ZA 2VCCA 3ZM8A 3BAIA 3CMGA 3MMWA 2ZX8A 1E40A 5BRPA 1UR1A 1R8LA 2D3LA 1MXDA 3W81A 4B3KA 1EDQA 2Y8KA 2Y8VA 3PHAA 3PBGA 5CSYA 2ZXAA 4S3KA 2UWFA 2QPUA 4HP5A 2A3HA 3ZOAA 3VIPA 4AZIA 3ARTA 1JZ4A 3CZKA 2YA1A 2WHJA 1OM0A 1Q6DA 5EFDA 2JEQA 1JZ3A 1EIBA 1NWSA 4BF7A 1B30A 1R7AA 4UQCA 4C7DA 3MUY1 3DC0A 2OYMA 3IAQA 1CGYA 2BFGA 3L4WA 1UQZA 4P8XA 3SEPA 4AD4A 1ZU8A 1F4AA 4GO9A 4Z2GA 3BSGA 3QOKA 4PSPA 1XH1A 1ECEA 4XB3A 1V6UA 4HPGA 5AYIA 1MFUA 4DWSA 1HVQA 1I1XA 5HPCA 1LWHA 4ATWA 1TMQA 3W0KA 3M46A 2YJQA 1C93A 3U7VA 1JGIA 1NM9A 5GNXA 4ZENA 5IHRA 3WF0A 1M53A 3CIVA 4A3YA 3W37A 1XD0A 3ZJKA 2E8ZA 9CGTA 5E0CA 3AIWA 1CNVA 2EO7A 3GNRA 1QHZA 2ZUTA 1J0JA 4WF7A 1O6IA 1XC6A 4ZXLA 5A69A 5A2AA 1GVYA 3OB8A 2CXGA 3FN9A 1FH9A 3MV01 2GJXA 5A8OA 2X09A 4XV0A 1XH2A 3WNOA 3MANA 2QPSA 1VRXA 1OGBA 4D6HA 3CHCA 1QHPA 5A8QA 3ARXA 1CXEA 2XHYA 5A8PA 1ISZA 4EK7A 5KEZA 1JF5A 2XM1A 3CZ8A 1HP4A 4W7WA 1KXQA 1BTCA 1JI2A 2J8GA 5M3WA 1MQRA 1KWGA 3K4DA 1C92A 5C8BB 2NW0A 5A6BD 3AISA 2WCAA 2UY3A 6CGTA 5A8MA 5A2BA 4CUCA 3K8KA 3WUEA 1K9EA 2YL6A 3ZSSA 2ZUUA 1UWRA 3GH7A 4E2OA 1QVBA 3RJXA 3KEHA 3OZOA 1AMYA 4M56A 4NSBA 1E6RA 5CPQA 3RO8A 1KBBA 1Q4NX 1J10A 4X0NA 1XSJA 4FMVA 1UD4A 1EO7A 3K8LA 1FH7A 1J9YA 2CKRA 1QOXA 1HKJA 1P6WA 3FXYA 4RL3A 1QI5A 3KE0A 2GK1A 2V3GA 1TE1A 4AY1A 1XSIA 1D3CA 1B3WA 2ZE0A 3BCDA 1EO5A 1EA9C 1R7OA 1NOUA 2WLYA 2WVVB 4UFMA 3BAWA 2E4TA 4V28A 2CNCA 3AIUA 4GO8A 2B31A 4GQRA 5LA0A 4YPJA 5CG0A 4TVDA 3ARWA 3AXIA 4UFJA 2BXZA 4PSRA 3MMUA 1UKTA 3SUSA 5A1AA 4YHEA 3EBVA 1PAMA 4JHOA 2BY3A 2XGBA 5CGTA 4XUYA 5EBAA 3AS0A 4KRUA 3T0BA 1WZKA 4MPKA 1F4HA 1UR9A 4BS0A 2YL5A 4C7GA 1PJ9A 1QNOA 1L0PA 4Z2LA 3SCOA 5JIPA 3HN3A 3GBEA 4AYSA 4HU0A 4TX6A 4ZEPA 4MB1A 2VQUA 1NP0A 1V0LA 5BXRA 1JYVA 3POHA 2O9OA 4P8WA 2D0HA 2VVSA 1QNPA 2YA0A 3L4XA 1E1FA 4WIWA 3WH9A 3MUZ1 3WQ8A 1WZMA 5AC5A 1VENA 5GQBA 4UR9A 5BRQA 2Q8XA 3CZLA 1OINA 1WCGA 3MMDA 4F9JA 3GZAA 2BHZA 3DYMA 2VCAA 2VZSA 4CD5A 4U5KA 4XX6A 2OYKA 4OIFA 1E55A 1E6XM 4M1RA 4CGTA 1W1YA 4AD5A 3AS2A 2ZUMA 2ZUWA 4PRWA 1M01A 2WKLA 5EMYA 3VMPA 4PYSA 4M80A 1V03A 3VIMA 3PTQA 1BG9A 1JNDA 4AD0A 2YA2A 4PN2A 2QMJA 3FHQA 3NJ3A 1E0VA 2VX5A 3GXIA 2DIEA 2XM2A 3TA9A 2UY2A 4TX8A 3HU7A 5ABFA 1E4MM 1CENA 2WBGA 4FLSA 1M7XA 2CBVA 1UZ1A 4JFSA 4DUWA 1EHNA 2XJ7A 3ZMRA 5E9AA 2DT2A 1GONA 1KFWA 1E6NA 4UZSA 5FD0A 4CCEA 4U3AA 4JHZA 3AZSA 1JXKA 4IISA 2X05A 2XYLA 1CEOA 3MO4A 1EXPA 2PWDA 5CPTA 1SFSA 1CDGA 3D3AA 5I2UA 3DHUA 4L4OA 2ZWYA
chains in the Genus database with same CATH superfamily
1NWRA 3EYPA 1VYPX 4WKFA 1A47A 1LBMA 2W6RA 3NNTA 3B9AA 1QATA 1J0KA 4YJ5A 4D1IA 2F4EA 4OTKA 4XIMA 5LIWX 3CL7A 3PRBA 3WLLA 1AZ1A 3CH9A 1Q6QA 3GUWA 5LHEA 2IS7A 3N2BA 3GM8A 3PY2A 4GNJA 1TIMA 1YPIA 3VGBA 2YZ5A 1X39A 1B3VA 4LUTA 3L9CA 4CN6A 4YN5A 4LAZA 1W1B1 2BASA 1QOQA 2PDFA 2W9MA 3WD4A 2V5JA 3AICA 1XPYA 2VGFA 2WJZA 3S2LA 5BWAA 3OHIA 3T0CA 3VGEA 2IPJA 4Q4MA 1ZCOA 3G8RA 5GPRA 1FKLA 1DQXA 4RE0A 1GZ1A 1P4CA 3NFUA 4ZGYA 3CUIA 1JD9A 1LWJA 4X3ZA 1SSGA 2ZXQA 1H1YA 2QGHA 3E96A 1IEIA 3TYUA 2KFWA 3W2KA 4U2YA 1OX4A 1E5NA 2VELA 2XSAA 4REQB 5DANA 1M3UA 1PX3A 3N13A 3U5YA 1LBLA 3B4UA 3DH7A 3GDTA 3T2PA 2I9UA 2D9FA 1CLVA 4QEHA 4LRTA 4EAYA 1AMKA 2ZICA 2YKKA 2A2IA 3T4CA 2ZR4A 1C29A 4EXBA 4RR4A 3BQ5A 4NZ5A 4XSMA 1MRAA 4W5UA 1TKKA 2XWDA 4JTSA 2ZX7A 3EMQA 2FMOA 3P84A 4LS2A 5D02A 4ACYA 1Q6HA 1WP6A 1E73M 3E0WA 3H55A 3W22A 2VEFA 5DT5A 4F2UA 3OEXA 1XLFA 5FCZA 3I68A 1EKOA 5DF0A 3NEVA 5E6YA 2Y1HA 2FZNA 3GHUA 1X8FA 1NU5A 4DBEA 1MXGA 1JFXA 3M0MA 4RCXA 4Z1AA 4IPNB 4ZOBA 2NV2A 3RRXA 2BXYA 3W27A 4O11A 1EYMA 4UTLA 4BY3A 1EPVA 1MO0A 3UESA 1ZQ5A 1L9WA 1UD2A 7PTDA 3SM0A 2QPXA 4ZQPA 4GG9A 3PSWA 3B4YA 2Z6JA 1J11A 4XG1A 3CV6A 1QUMA 3MYOA 2YLAA 3W7QA 2IXUA 5BXPA 5CXPA 2GDUA 3DFTA 3B8TA 1DXEA 2OO0A 4PUWA 2V8ZA 1WOBA 2QV4A 8XIMA 3MV11 3W23A 5K7JA 5HMFA 4ZQCA 4QSHA 2ZXBA 3O5GA 4NAEB 1W1A1 3PN8A 4LAWA 3ARPA 1KRCC 3LENA 1U2YA 3QMTA 4XD4A 1VBRA 3GYEA 2E40A 3N4FA 4YMZA 2VL4A 3A3XA 4AZ5A 3N25A 3HGJA 2FMNA 1WZLA 3TTSA 4DUOA 3P2VA 2UZ9A 4WXZA 3TN6A 2V30A 1YDOA 1Q6LA 4XIAA 1OX5A 3WQ4A 5HQMA 2ZRWA 1IGWA 3G1SA 2WVVA 3NL5A 4K3ZA 2ZR6A 3TDBA 1KLYA 1ITXA 1BYAA 1TV8A 2VX6A 1XLKA 3PB0A 3GZ3A 2QUMA 4RZ4A 1D8CA 2NLYA 4P7OA 3DGBA 4EACA 1UWIA 4ZSTA 2VD8A 3MSRA 2RJHA 3MUAA 3VDHA 5D2WA 3TFXA 1FP9A 1VJSA 1E4NA 1LORA 4JZ5A 3A22A 3B9DA 2E28A 3R43A 2BGQA 3LU2A 5ECUA 2GDQA 3VKKA 4AYGA 1GOMA 4Q8MA 1EQPA 3TNBA 2Z1KA 3WJZA 1TCMA 3KDOA 1J6OA 1WKDA 1EF3A 4JOMA 4PFHA 4DJDC 3IEBA 3ZT5A 1TJPA 6TAAA 1R46A 3TLQA 2ZX6A 3I7RA 4AG0A 3ARQA 3NL6A 2G3IA 2PTZA 5AKQA 2F6KA 3RM4A 2CU0A 3OLDA 3WCZA 3DHPA 4HMCA 5D05A 3W6YA 3CTLA 4HNTA 1E0WA 3AYRA 5BMXA 1V6YA 4C02B 3KVJA 5AN7A 1NARA 4DBSA 4ZR8A 4M82A 4EOUA 1A0EA 2WZTA 3VE9A 3WD1A 2PDYA 1WUEA 3UT0A 4B9ZA 3EDEA 3UG5A 1ITUA 4FHAA 1EQ3A 1KV8A 4NJHA 3T81A 3PA7A 4DM2A 3UETA 2GJRA 3H2AA 1Q63A 2JIEA 1OFOA 4QROA 4BQ4A 1V6VA 2TODA 1B90A 4QDWA 4UFHA 1ZNNA 5F1UA 1M6JA 2I5IA 1V3KA 2ZZ5A 2C7FA 3FSTA 3TXZA 5FJRA 1J4EA 4OU1A 2GOUA 3KRSA 4UTMA 4O0KA 1E44A 3KLLA 3PB2A 4F0MA 3EXRA 4GINA 4S3FA 5LA2A 1BQCA 4ACZB 4S23A 3MT1A 5AC7A 3R5EA 2XPAA 3NQMA 5HOSA 1SUXA 4WY0B 4WCJA 5TD4A 4CCDA 3U57A 1V6XA 1K8CA 2Q01A 3WQGA 1VGAA 1F6YA 2PDQA 1OD0A 4ZBCA 2C1IA 4MKSA 1GVOA 3ZR5A 4TR9A 1AL7A 1C90A 3OBEA 3NM3A 4S39A 3OZPA 4UFIA 2C91A 2Y7FA 4JAWA 1VC4A 1GVEA 1A3XA 4HHHA 4IP5A 3VKCA 3RRAA 2L5HA 4FNUA 3M0VA 2OQHA 4IPLA 4LEQA 3NVTA 1MUMA 4NRSA 1W91A 2OQLA 2PTYA 3KTXA 5LA1A 3WK3A 3N1AA 3AMLA 4R0XA 2H9AA 3ZR4A 4ECLA 1F3EA 3MCMA 3CUGA 4MJ4A 1CWYA 1BXNA 3UNDA 4O57A 3AROA 1QO2A 2EPKX 2QZRA 3GAYA 2FPVA 2W66A 4NILA 1TV5A 3T8LA 3PZVA 2E8YA 1D7JA 3S47A 5D32A 1UWUA 5DIUA 3TSDA 1JEZA 4RZ5A 2OYLA 4MWAD 2CIPA 3BANA 2RHGA 1JUEA 1M5WA 3HV9A 1FKDA 4I5RA 5I06A 3LGEA 5A8GA 2PWGA 4JTFA 4PMUA 3EB2A 1TTIA 3WLRA 3I7QA 2QDDA 4K7VA 4U10A 1YXDA 1I2NA 1JPIA 1OG0A 1OY0A 1MDLA 1JZ6A 4JIPA 3P93A 5K3VA 1W3IA 1XRSA 3ZVHA 1JR1A 3EMZA 5HQLA 4UR8A 1N1AA 3H4GA 5BXSA 4N7QA 2CLHA 2VJXA 5RUBA 4U85A 4W93A 4GGQA 5D9PA 1X6NA 1RAKA 4PMZA 1H1ZA 7XIMA 1HJXA 3WLKX 1V3LA 1VFLA 2CW6A 4S2CA 4LC6A 1IEXA 1BGGA 3FJLA 3GU1A 3WN6A 4NNBA 1E3ZA 1WDWA 2IKGA 3BOFA 3CWHA 3OBAA 4A2SA 3DGRA 3JS3A 3EZ4A 3KS6A 4IF2A 4JQ4A 1G4TA 2RUQA 2NSOA 1VLWA 2PDBA 2I1OA 5BOOA 3N6QA 5FJOA 2FVLA 3UG4A 2JQXA 1AZ2A 2GJXB 2Y7EA 3QPZA 1KKRA 4JTKA 4WSJA 2BGSA 4RV3A 4FA3A 2JKPA 3FCPA 3V0UA 3L5MA 4UCGA 1UJPA 4IIGA 2F2HA 5XINA 4ODLA 3WEMA 4EVZA 1RUSA 2AAAA 2OX1A 5C55A 2L2SA 3PNUA 2AGTA 4DF2A 4F40A 4AF0A 2GSHA 1LQ0A 1QTWA 1JCLA 3H12A 4ZFMA 1UH2A 4JGDA 3TONA 1H7OA 4R7WA 3H7RA 3W6LA 1W9XA 4H9TA 5KZEA 4JKMA 6REQA 5AC4A 1JDCA 5DMYA 2ZRXA 4HT3A 3MBFA 4Y9OA 4F3HA 1WQ5A 1R3QA 2DZBA 4C6MA 3BOXA 1F40A 1XIFA 3NYZA 2ZDSA 4YHGA 1ISXA 3DIPA 4QQ3A 1AQ0A 4JFTA 3PVFA 3L12A 1J18A 3SDOA 3MUXA 3WNNA 3HF3A 1XD1A 3NZPA 3V35A 2FKPA 3WJYA 4W7UA 3VNJA 4KCWA 2DU2A 1V3JA 2WSQA 4L6HA 4DNMA 4HTYA 4L56A 1A5UA 1MVYA 2FH8A 2FZ8A 5F4SA 1R2TA 3MCOA 3RPTA 2EAWA 3WF4A 4PUDA 2GPTA 3BMWA 5G2WA 4RNIA 1Q3NA 2QCHA 3O2LA 5DCDA 2MLZA 1PO9A 1CXIA 2BG5A 1G9HA 1W6TA 1RR2A 3VM5A 3N3TA 1NH6A 2IQ0A 1YDNA 1XFBA 3B0PA 5BZAA 4Q8WA 2VRKA 3CPGA 5CC6A 1QNSA 1FWJC 1G4EA 3HG4A 5HMSA 4B5NA 3HQ1A 2GFTA 1J5SA 4RW3A 4H7VA 3WDHA 4O13A 3EWDA 1CGVA 5HKGA 1G7VA 1OC5A 1TCDA 3H2NA 4GGBA 3GTFA 3GXDA 4J27A 5KZDA 3CV7A 4FI4A 4FX6M 1ZZMA 1K6WA 2GOKA 4FXFA 5CZKA 3S6OA 3FKRA 2J75A 1D7IA 5CAKA 3WDRA 3G1VA 4LCSA 3WLQA 2H90A 1UP2A 4A3HA 1VS1A 4LYRA 5IFTA 5DBUA 1KCXA 5JMUA 4LOCA 4DY1A 4PMNA 4KEUA 3GE7A 1HFBA 1W5QA 3LZ3A 2YYUA 3GY1A 1W9DM 2W61A 1IE7C 3BG3A 1KT0A 4MTVA 2HEJA 3W4RA 2V5CA 1B5TA 1SR0A 1JZ2A 3M41A 1CGTA 1XPGA 3O5RA 1Q6UA 3GXMA 2QCGA 3NL2A 1RJRA 1GPFA 1KTBA 2OGYA 4YTRA 1C7SA 3R0DA 4OE7A 2OLAA 1B1YA 1JDEA 1H5VA 3PZGA 2E5DA 2E9MA 1MMFA 4TMCA 5T9CE 4AEOA 3AIRA 3QV9A 1UP0A 2Y8UA 4BQ5A 1DBTA 4IIBA 1HJWA 2WCGA 4US6A 5TAOA 1KM1A 1R0MA 3KWXA 3BAJA 3TAOA 3QGVA 1K7EA 3OLIA 2GGIA 4HARA 3EEZA 3ICJA 1JYXA 2BOGX 4AZ7A 3WLOA 3W2UA 3FVMA 4EANA 2CZVA 3H70A 5E5CA 4HBKA 1X1OA 4D6DA 2PBCA 4LRSA 1UR2A 1EOMA 1FUYA 3LBMA 4H83A 2WSKA 3LBCA 4Z2JA 3MP5A 3UI4A 2V3DA 5E09A 3JUGA 1VEPA 3A21A 3RR1A 2WPGA 1FHUA 2ZQSA 3QHNA 1YIXA 3V75A 3G1FA 2VRJA 4DLFA 3OLEA 3L4TA 3OVQA 1ZFJA 4NL1A 1NELA 1TG7A 1UC5A 1KXTA 3UJRA 3NCOA 3VX1A 2BVYA 3ABQA 3NPUA 3VOIA 3SN0A 2KI3A 1NF7A 3S2NA 1BWLA 3CH0A 1UR8A 3AALA 1FKIA 4HNCA 4QIBA 2WMHA 1FRBA 2NX1A 4LUJA 4US5A 2PRMA 1UWQA 2WMKA 2TSYA 3QZAA 3A23A 4F4RA 1XXXA 3LMYA 4BI7A 1KBKA 4AZCA 3EX2A 1DL3A 3PBYA 1E9LA 2M1IA 4L80A 3WENA 1UD3A 3O6YX 1SYTA 3ANUA 1JDAA 2FZDA 3U3HA 3KOFA 2J9YA 1UCWA 3AIEA 5I77A 4MAVA 4HPHA 3HQPA 2YDSA 5HNTA 4NUWA 3FEMA 3OIXA 4FX7A 4LWWA 3QYSA 4C6LA 3S46A 5CC7A 5J6EA 4MNKA 3TCSA 5EMMA 1AK5A 4MYXA 3TW9A 2W62A 4GRSA 2VQTA 4FALA 1XG3A 3M5YA 3V0TA 4QP0A 3WF3A 3ARYA 2ZZ1A 3UNTA 2D1ZA 5BNKA 3G1YA 3VDBA 1EC8A 1YLVA 3APYA 3HPAA 3OA5A 1DJYA 1X97A 1RH9A 3R2GA 3KACA 4NAFA 2X1IA 3AWOA 3NO5A 3BV4A 1GQNA 3MO7A 1E6PA 2EBNA 1UA7A 1UD5A 3T05A 5BOFA 1BVZA 1G4SA 3U0HA 1BRLB 3CL6A 4JFKA 3PTMA 2ZX9A 3E6EA 3IKGA 5GPGA 4NJIA 3GHSA 2EPLX 3WJWA 4ORMA 2CZEA 1KLZA 1OADA 1OHLA 3LV6A 3LCLA 3GKAA 1K4GA 3WUGA 1GOIA 2DY3A 1GQKA 4TIMA 4AWSA 1EXBA 2G97A 3TW7A 1HKWA 3U4AA 5C9UA 5HT1A 4M3PA 5C70A 3AYVA 2G3JA 2XZ9A 1YHTA 3AAMA 1ZJIA 4UCFA 4J3UA 4ATDA 1E9IA 1KQYA 2YOCA 1KWKA 3IWPA 2CHRA 3N29A 2EEXA 3W38A 3WQPA 4G7FA 3JVAA 3RAOA 4PR4A 4HA4A 4OFCA 1C8VA 3WD3A 1MDRA 2VT0A 3W3OA 5A6AA 2MUCA 1W8SA 2J8TA 4AC1X 1VYRA 3BLKA 3EWXA 5HUOA 1OWQA 3GTHA 3TN5A 1DJQA 2X30A 4H8VA 4EF9A 3WF2A 5H8UA 4IXHA 5ECVA 3FGCB 1ME7A 1AH0A 1H7RA 3M7WA 3TTEA 4MB3A 3AQUA 3P60A 4IIHA 2B0MA 1QMLA 3GLCA 3Q94A 4KKXA 3GU2A 4WSKA 1ENUA 2HSAA 1NVMA 3R79A 1JAEA 1V0MA 2DW6A 4D2JA 3G1DA 2DUXA 3N04A 4DROA 2GVJA 4PMOA 3S2JA 4O8AA 4UNLA 4AXKA 5BRBA 4JIHA 4RE4A 5FEWA 4URIA 1LUCA 2DT1A 1AH3A 3W7IA 3FJNA 4FEZA 4J4KA 3IARA 3EMCA 3TYZA 4KESA 1JNEA 5B7YA 1W3TA 3JRKA 3QH2A 4AZBA 1XCXA 8CGTA 3A47A 4ZO9A 5L6UA 1R87A 3P81A 4J3XA 5KZ6A 3UXDA 2VDHA 2IF4A 2HS6A 3GXFA 5B8IC 2V63A 2J7BA 4WDXA 2W3ZA 3BQ6A 3LHTA 1KB3A 5HWCA 1R3RA 3N19B 3EXSA 3BGJA 1BKSA 2QEZA 3LUTA 5MHBA 4M1BA 1E70M 5REQB 1RK6A 3WIJA 2XIBA 3ECQA 5A2CA 3G5EA 3GG8A 3WH8A 5ABEA 4JXCA 4W88A 2IPGA 4HBEA 5CEWA 4LGXA 2DUZA 1AW5A 3NPWA 3VD4A 4RLIA 1R3TA 4X9SA 4HN4A 2NVDA 3UGVA 2POTA 3NO1A 3B7XA 3DZ1A 4JICA 5EKYA 3TNOA 1JPHA 1EIXA 1ICSA 4MKNA 2YCJA 4DF0A 3BCFA 2JZVA 1EWDA 1J0IA 3PG8A 3EB4A 3W24A 1AFSA 2QDGA 4JTHA 2Z1XA 1NOFA 3HFYA 1PX8A 4U5IA 2X2YA 2QAPA 4M29A 2FKEA 4ODKA 4N2YA 1HQTA 3BG9A 3UCQA 2DDXA 3JYMA 3NQ7A 2F7FA 2GK1B 1XLGA 1VFTA 1KRMA 1XRVA 5G4HC 4IPXA 3SB0A 2HROA 4MMWA 4XVEA 3LPGA 4DJDD 1HG3A 1RP8A 2XISA 4MKVA 2RUCA 3STPA 4DRHA 3NWRA 1KFCA 2FZMA 2G4JA 5A6JA 4KR0B 1EGVA 3DG3A 3TKFA 1OZMA 3HMCA 2LGOA 1PZ0A 5HJYA 1LT7A 3OVGA 4IPJA 2HK1A 3PJXA 2PV1A 2AQOA 1GYLA 2O92A 4O1CA 4D71A 4G7EB 1FFQA 2RGMA 4D6JA 1V4YA 2QJIA 2Q8LA 1P5BA 2YCKX 4HYRA 3MUIA 4GX9A 3EDKA 3WK2A 4DUVA 3QV6A 3EWUA 1E0XA 3VU2A 2ZIDA 3KBVA 2GGHA 4CD4A 3IUHA 3MKCA 4KQZA 4KERA 1W9UA 2FDSA 4DB7A 2YIHA 1V3HA 1EWEA 1KW1A 3NXFA 4QCEA 4IQJA 3SQSA 3RMEA 4JD4A 3BARA 2DH2A 4KGJA 3M5XA 3O05A 4C1NA 2WXDM 5I24A 2F8QA 1V79A 1ZAJA 2XH0A 4LBUA 4HZ6A 3W7GA 2BS9A 3UZYA 4B92A 1F7BA 2Q8ZA 1W31A 2VR2A 1YRRA 3BW3A 4K7YA 4OBRA 3KCLA 4ZE5A 4GQ0A 4XUGA 4WKAA 4GY1A 1HO4A 2PLCA 5A5WA 2VFEA 1ECQA 2WO5A 3DYOA 4JL1A 3PUOA 1VH7A 4YVXA 4QAIA 4JN7A 2FH6A 1XLBA 4L1XA 5H91A 2R9RA 1NEYA 1W54A 3GW0A 4J40A 1AQMA 4AC7C 4FOKA 1XCWA 3Q4DA 2Z7GA 3PK7A 3E38A 2ISVA 4PB3A 4ASTA 4PTNA 4A21A 3ZO9A 2ZQTA 4GVIA 4ZB5A 5KMYA 2ZC1A 1XLLA 1GOKA 4I8YA 4DO7A 3LHWA 2UY4A 2XZ7A 4ZQNA 2QUNA 5EU9A 3O6AA 3URBA 4X0VA 4LUSB 3V16A 3IACA 4TXEA 4ZO8A 3V36A 3M5VA 2CBIA 3ABXA 1RP9A 4W4QA 5I3GA 3E0IA 3CC1A 3VOGA 4JKLA 4KWVA 4ZO6A 1QPNA 1J2WA 2OO6A 4I5XA 4P8UA 1JCNA 1QPFA 7REQA 1JCHB 1Z89A 2WMGA 1XIIA 1H41A 4OT7A 4AD3A 1TQJA 4Y90A 4QRNA 3VCRA 1FAPA 3GDRA 4JX6A 3W1TA 2MANA 4LC8A 1UBPC 1V0KA 1S2WA 3LXBA 3S83A 2DP3A 4LUTB 4YCOA 1QBBA 4GH1A 1JPKA 5D8ZA 2VCCA 2RUSA 3NZRA 4GIYA 2BMBA 3BPWA 4G56A 3E02A 3KXQA 5CG7A 2N87A 1O66A 1MXDA 1XL9A 4B3KA 5HWNA 3KOXA 3GVWA 3GQYA 1W5NA 1CI1A 3RFWA 4ROPA 3ZOAA 1JZ4A 3DENA 5HQEA 1TV7A 3M4HA 1O68A 1OX4B 5EFDA 1XYBA 3UFYA 3O5QA 4ZOAA 2ZZ3A 1XFCA 5I3JA 3FFSA 1J6YA 2BFGA 1O5XA 4JTUA 3GTIA 2P3ZA 4Z2GA 3SIZA 4A8NA 1HVQA 4TU1A 1LWHA 1PINA 4NJGA 2PPPA 3W0KA 1RVKA 2YJQA 4IZGA 3U7VA 1JGIA 1FWSA 4ZENA 4R3UA 4EPEC 5IHRA 5LXXA 1M53A 4POCA 1XD0A 3ZJKA 2E8ZA 3N9SA 1CNVA 3GR4A 1DORA 1C9DA 3GNRA 3BLFA 1KFJA 3MCNA 1P7TA 5A69A 5I7GA 3OB8A 2PAJA 2DZTA 1FH9A 3M43A 3MV01 3QYQA 3CU2A 1XH2A 3ZLFA 3DOPA 3BJSA 5A8QA 2PE4A 3C3UA 2C18A 1MUWA 3BMBA 3KRUA 3RGCA 1Q4WA 3C56A 5HWBA 1H63A 2XM1A 5T26A 1R2RA 4W7WA 4JHMA 4MJMA 3L68A 1DIEA 1OF6A 4UIOA 4HPJA 3AISA 4A29A 1WA3A 3N9RA 3KWSA 5H6HA 4Q6JA 4IGNA 5A2BA 1Z6KA 1K9EA 4ODNA 2YZRA 3LCXA 1UWRA 4C1KA 2BLEA 3RJXA 3NOEA 1AMYA 2PSNA 1YE6A 3RO8A 3W9ZA 2R94A 1J10A 4LVDA 1SSDA 4RNHA 3WQOA 5EMUA 3BDKA 1J9YA 2CKRA 4GHRA 3QBUA 4HHMA 1P6WA 1S5NA 1TYGA 4Q6XA 1QI5A 3UCCA 3GU9A 3G3DA 2VEGA 2V3GA 2WSYA 1NIUA 4AY1A 3SBFA 3VC5A 2ZCGA 1VLIA 4DVOA 3S8HA 4L1WA 1R7OA 4WOQA 2IPWA 3ITYA 1WXYA 2WVVB 3GG0A 4V28A 4UFMA 5HMEA 4GO8A 4S3EA 2A79A 2QCMA 3MB9A 1AJZA 4RX0A 1K03A 1M7JA 1F9CA 1G69A 4PSRA 3S3GA 5A1AA 5LIYX 5LZLA 3W1PA 3CNYA 2FFIA 3AWNA 3T0BA 4PE8A 1FVPA 4DXVA 3APTA 4MPKA 1UR9A 4BS0A 1R9XA 1OCBA 1PJ9A 1QNOA 1L0PA 1RPXA 3TLLA 3FKKA 1NJJA 5CGQA 3HN3A 4AYSA 4HU0A 3IGUA 1S2UA 4ZEPA 1GK8A 2MLXA 2VQUA 1V0LA 2O9OA 1SO5A 4L5ZA 4OQVA 3CGMA 3O5DA 2VVSA 2GVLA 3GVRA 1DKWA 2V82A 3S9ZA 3L4XA 1S5TA 3WH9A 3MUZ1 2MLYA 5FF4A 5C54A 3PBWA 3RGTA 3S1GA 2A7NA 4BK9A 3SSZA 5I00A 1NY1A 5TNVA 1SZEA 3F4NA 3V4BA 4C65A 2VCAA 3HV8A 4C6NA 4R85A 5CKSA 2FFCA 1RALA 1E1CA 4M1RA 4CGTA 3W7OA 3AS2A 5FJJA 2X40A 5CSRA 5I09A 2YW4A 4PYSA 3LHYA 4H6KA 1E0VA 2FJUB 2VX5A 2XM2A 3U6WA 1IWPA 4JFSA 2WBGA 1J4HA 2OZTA 5HWMA 2XJ7A 3UD6A 2KE0A 1XW8A 4UZSA 4JHZA 1JXKA 3CV1A 4IISA 4GY0A 2QF7A 2X05A 2F2KA 1HL2A 2AKZA 3P82A 2POZA 1SFSA 3D3AA 5I2UA 4LANA 2FPYA 4KIRA 1LQ2A 4I9JA 5JBEA 3SCUA 2HE5A 1OGGA 5BU6A 3STCA 1PB0A 4O0ZA 2FHBA 1WKYA 3A4AA 4DUXA 1BL4A 2WJDA 4W7VA 3DXIA 1K7XA 1TVNA 4YWIA 4IICA 4B5XA 4IL0A 4LVBA 4IQEA 1VBJA 4AX7A 1W1VA 1K8ZA 2BOEX 1IWAA 1XH0A 1OBAA 4KT2A 2XP7A 1VFUA 1KFBA 1UKQA 3TDFA 5EMLA 4WZHA 2XFFA 3T09A 2O9RA 5LYRA 2HWGA 1UOZA 1DQWA 1J0ZA 1FCQA 3WMBA 1EX5A 5HUPA 4GZJA 1BGAA 3THDA 3QY8A 3HPSA 4HK5A 3TQPA 4BFAA 3SGUA 2CLEA 4FB7A 1AD1A 3TWAA 4QR6A 3OQEA 2VP8A 1V02A 3ARSA 1R3WA 3ES7A 2H9AB 4IFKA 1PIIA 3R25A 3EOOA 2A21A 1VQTA 3DERA 1R30A 3BGGA 1GVIA 3TE9A 1KBJA 3GIQA 2X1RA 5H8PA 4QXIA 1K02A 5C0QA 3W71A 2P0IA 2R1NA 4DPPA 3V5CA 4NZFA 2RDTA 4EKJA 2VOMA 2XVLA 2ATMA 3A5FA 2WHKA 1B57A 1C8YA 1XGDA 4Q22A 5BROA 3GB6A 5BWFA 4ZSUA 5D9MA 1FWNA 2XUCA 1I45A 3K46A 1YMYA 1QNRA 1PIGA 4TUFA 3L21A 4FNRA 1FKFA 1V8EA 3PZIA 4DZ2A 5KINA 2VDGA 1XYFA 3UR5A 3ZVHB 3E2QA 1WPCA 3L2MA 3PBUA 2PF0A 2J25A 1ROUA 4X9YA 4UQEA 2WVUA 1NQ6A 2INEA 3QJAA 1FWDC 4TNSA 4Q8TA 3ZXWA 5ABTA 1BWKA 1VAHA 2P10A 2V69A 2NWSA 4KWSA 4H8NA 4IUOA 3WQ6A 3TYCA 3UBPC 3W2JA 1T96A 3VZYA 4J9JA 2GUUA 1B3ZA 3RR4A 2VO5A 3UY8A 5HXMA 3P62A 3TA6A 2FVKA 5DITA 1VIWA 4M24A 3DFPA 3ITGA 1VBUA 3M0IA 4IIDA 5MKGA 2Z2UA 1OFQA 4JFVA 4YLWA 3VCNA 4PZVA 3C2OA 3AJXA 1Q6EA 3CUJA 4O19A 2OT0A 1KV5A 1P48A 1XUUA 4BQ2A 4G8TA 4X61A 4PMDA 2WCSA 3IJQA 2Z1BA 3JZEA 5F2IA 4NYYA 4JIEA 3PZMA 2KGJA 3O06A 4XISA 1US0A 3S2MA 4FAPA 3KW3A 3N73A 1Q2SA 5JH8A 2YFOA 2Y70A 2X41A 4AF0B 1NFBA 1YPFA 2VFHA 4MPQA 1W2VA 2JBMA 3RF9A 3THQA 4E2BA 6REQB 1S2VA 1M5YA 3WBWA 1CB2A 3NTYA 3B8IA 1KRAC 2O7QA 3SUVA 3NUKA 2DZVA 3ORWA 1CB7B 2Q09A 2DORA 1FKXA 3F2DA 3K13A 5DRIA 1Y65A 3GD6A 1YDYA 3TH6A 4GI4A 1H4PA 4A2RA 3KBNA 2NXGA 1TSIA 4TVUA 2ATSA 4JTRA 1BPLB 3IPWA 4H1ZA 3RHGA 1AVAA 2HQAA 4JIQA 3VKJA 3VYLA 1I8JA 1TREA 2P0OA 4HPXA 2TRSA 1CXHA 2OZ0A 5CLWA 3ITOA 1G7UA 1EDTA 3PWIA 1FWAC 2PRLA 2DZXA 5ENLA 2A6NA 3N3MA 4OBSA 4DAFA 3PZTA 3C2RA 4GD0A 1ZAIA 3EDDA 4BZYA 4DEFA 2O4QA 3QY6A 4FNTA 4S1FA 1A4LA 3LUOA 4XZBA 2R1KA 2O9PA 3W75A 3N17A 1GEHA 2GSEA 4EAMA 4WY0F 1KR0A 3NQVA 4K8GA 4V1YA 1CPUA 3SSJA 4RPQA 3I4EA 4XZMX 2FTYA 4GH3A 1U30A 1SMAA 1BG4A 4D8ZA 3VMOA 3BJFA 3STEA 1SJAA 1D7FA 1FDJA 1C7TA 4E4UA 3KAGA 2ABAA 4TX0A 2HS8A 4O54A 1J96A 2F21A 2Z29A 1SU5A 5EMKA 3E2RA 3P5YA 3G24A 3MI2A 4JCLA 1P5QA 4MSPA 4MB4A 4GYPA 4ZOEA 2QDHA 4E2VA 1TPUA 3B03A 4XSLA 3QFEA 1RPKA 3BH4A 3K2GA 2ZDRA 3OGRA 5E70A 3E12A 3RPMA 4C6DA 4IG2B 3UA3A 1P1XA 3BLLA 3BSMA 1BSIA 4JTJA 1TJ2A 3E3HA 1ZB5A 2AMGA 2D0GA 1W5OA 4MOZA 3IK2A 3CZEA 2A4AA 3BZGA 3OJGA 1QK2A 1A5LC 3UXLA 4XZHA 4GIVA 4J3SA 5M2FX 4ZPTR 3BK0A 1UOKA 4MM1A 3FLUA 1RJPA 1F6PA 1PE1A 2BWGA 4PMVA 4QQUA 3AOFA 4UTKA 2C19A 2H3DA 1VFOA 3BLOA 2NX9A 2FGBA 1HJUA 3AS1A 1GOWA 2PBGA 4MWAE 3MI6A 1UYQA 1HZYA 1F74A 3P74A 1YATA 1UB3A 1EP3A 4ENLA 2D2OA 1TRDA 1UWTA 1Q6IA 1HUVA 4H2CA 1IIGA 2NQHA 4RNFA 4O1DA 1QI2A 4GIRA 5EFFA 3M1ZA 3NQBA 1G67A 2HBXA 3OTRA 3M0XA 1H09A 5EGRA 4MVAA 5D2YA 2OODA 1JRBA 2WM0A 2DV0A 3TQKA 1PX4A 1T99A 3O63A 1YTEA 4JNYA 3DFQA 3RDKA 1A50A 4GA8A 2BVTA 2QJJA 1WB0A 3W85A 3WEZA 3UPMA 5D2VA 1I0BA 4Q4PA 3W7HA 2MNTA 3MKKA 3GH5A 3TYAA 4GVFA 3W1NA 3KVMA 1TWDA 1TPFA 4TOQA 1S39A 1WDDA 1DWHM 1RQHA 3OGVA 3L0GA 4MF4A 1VEMA 4N9BA 1VP5A 1ZLPA 2A7PA 2DSZA 1Q66A 1MFVA 5FF0A 1WKEA 4LS1A 1MW0A 1IIHA 1W26A 2FHCA 3LPPA 3LX9A 3VDAA 2DIKA 4AZCB 3MQTA 1HKMA 3O1NA 4F2TA 2HMCA 4A35A 3L2LA 2ZYFA 1DJNA 3IVTA 3GR7A 2PP3A 3W2NA 3KVLA 1SPQA 3UP8A 1EJXC 4OHQA 3WBAA 3SY5A 2C0AA 4KGLA 3EKLA 1ZP3A 4Z2KA 1O1HA 1GQLA 5SWUA 3EXTA 5DELA 2CWXA 1VF8A 2JIWA 1L6FA 4O16A 2W92A 4OV9A 3HBLA 3W1LA 2EPNA 3CWNA 3VTRA 4ZE4A 3G77A 1LG2A 2GGJA 4QE5A 1EL3A 3RM8A 2OTDA 1OC7A 1TA3A 3NZ1A 4N0RA 3N2TA 4KMQA 3N9KA 1LM1A 1UBSA 4NAFB 2YYTA 2XVNA 3AFBA 4H00A 5C7HA 1W3JA 4FR6A 2NUWA 2J9ZA 3EA2A 1Q7QA 1ESWA 3BC9A 3HGSA 4DYKA 1I2QA 3OU8A 3TCEA 2HV5A 1UZ4A 4UWMA 1FXPA 4F79A 4OZOA 4DXXA 2GJNA 1KM2A 2PWEA 3K8MA 1US2A 1LL6A 3MWCA 3LNPA 1K6AA 3T40A 3QZEA 3SIMA 3WNLA 3R8RA 5FA5A 2DZSA 3ZLHA 5C6MA 1GEQA 2WNQA 1DVJA 1A5BA 2D2GA 4WJEA 3CMFA 3AI0A 2NUYA 1MWOA 3CHDA 1DWIM 4NZ1A 1L8PA 2EQDA 3PWAA 3QW3A 4NIRA 1B4KA 3RXZA 2E67A 2HVOA 4U33A 3GXTA 4R7JA 2Z28A 4Y6GA 1KM4A 4C6FA 3VNLA 2AQWA 2IMRA 4D9PA 1A3WA 2B7OA 3UA4A 1YKWA 1YQ2A 2A1YA 1CGUA 1PCKA 5CJMA 3OYZA 4LYPA 1L6SA 4KH2A 4JYSA 3HTWA 4UUIA 3H7UA 5GVJA 5CPOA 2C1HA 1WDRA 3VNDA 5CQ1A 1SW3A 5EA9A 1A80A 1R9HA 3T0TA 1FKGA 3EWYA 2QYGA 5G2HA 1XIJA 3E1F1 4JR5A 3VD7A 2V67A 3LEPA 3WELA 1G1YA 2CLKA 4F0RA 1LUCB 1Z42A 3ANVA 2WLZA 1PHQA 1PUDA 1DWAM 3BWWA 4H9XA 3F4WA 3NQEA 4V15A 1TELA 3TX9A 1PEZA 2RJGA 3AYSA 4MLRA 4GX8A 4N19A 2QT3A 5DO2A 1YW1A 5CPMA 3UQAA 1ICPA 2QR6A 2ISDA 2GQ8A 2Y5SA 5HJXA 3Q67A 3RLHA 3LG3A 1RSCA 2J7GA 2J8FA 1ROTA 1JD7A 3GK0A 2YCIX 3HJEA 4HMEA 5KETA 3HGRA 2F61A 7ENLA 1XYAA 2VZVA 1BVNP 4JS3A 1TPC1 3DESA 1FKSA 4Y2WA 4RDVA 1F3WA 3OO2A 1G01A 3LM7A 3EDJA 2X7VA 4IIFA 4ZFCA 1DQUA 1Y5VA 4NZ3A 1K8YA 5CGMA 1B6CA 3V0SA 3C86A 3J7HA 5J5RA 1H51A 1CT5A 4LCQA 4IJCA 2H3BA 3WLMA 3NA8A 4EPBC 2ZWZA 1QXLA 4JL2A 3W86A 2D24A 3B0YA 4H9MA 3A4XA 1KR1A 3XIMA 4ICCX 1U79A 1XUZA 3W1MA 1E71M 3P0WA 1PSCA 1VPQA 1BVWA 1MW1A 1UKPA 1DIKA 3FNDA 1XISA 1PDYA 1HXJA 4S38A 5I3KA 1KBLA 5DFAA 2OLHA 4NXSA 1CZ1A 3M9YA 1EOKA 3C6CA 1J5TA 2YCLA 1CXKA 4JYFA 1Q6OA 2P88A 2FHFA 3VX0A 3L65A 1CECA 4IFRA 3GR8A 3G18A 1TZ7A 1GQIA 4KRTA 1FDYA 1QW9A 2WKGA 4QM1A 1GJUA 3ZWSA 2VN1A 4H6RA 3QPEA 5G1TA 4W9QA 4M5PA 1HP5A 4BI5A 3V1HA 4I7WA 1QJWA 2W79A 3U4FA 1IYXA 3C52A 3KP1A 3IJ8A 1UKOA 1GORA 2VFFA 3CAVA 2DZUA 3TU9A 4NY2A 1P1MA 4DJEA 4A8IA 5T9BG 4MJ2A 4OV4A 1LDCA 4PUKA 5I0DA 3C0LA 5FESA 1E6QM 2OXNA 2EG8A 1FKHA 2QLYA 2LPVA 3NI6A 2EKCA 2BY1A 3DFYA 1QI0A 3II1A 3AXXA 4O12A 3TTYA 5DY3A 4W9OA 4FNPA 4HU3A 5L9FA 4E38A 5CLTA 3SO7A 3WDQA 1TTPA 1GYNA 3EOUA 4C1NB 1BAGA 3T0AA 2LJ4A 4NKCA 3SUTA 3CO4A 1J0YA 2PGRA 3WO8A 3CT7A 2VMFA 3W7RA 4D6EA 1OCNA 2GJLA 2A3EA 2Z27A 1KM0A 5I5RA 3VKBA 4E4FA 2VNCA 1ME8A 2A3BA 2ZXDA 3N34A 1RJQA 4ODPA 4ZPWR 3MWAA 1OYCA 2B7QA 2OSYA 4BHYA 3VFLA 2JE8A 1ZRQA 4LBRA 4GZEA 4I90A 4BA0A 4MLJA 3HG3A 4FZIA 3MA8A 1GG0A 4NZ4A 3LDVA 3BLIA 1OCQA 4QDPA 4CVWA 3CHVA 2QQ6A 1ZSXA 3SCRA 3EB3A 1JQXA 2G8ZA 2WV8A 4CNNA 1AODA 1TV3A 4E3TA 4GIEA 3TOPA 4JPGA 3R12A 2A85A 1T8XA 2QKFA 4FLQA 5CPSA 2VENA 2VX7A 1FTXA 4XBSA 3NSNA 1H61A 4YNGA 1J4RA 4P5UA 1QNQA 5E9XA 5IM51 1A7XA 3ABOA 2GSJA 1M41A 3CMJA 6A3HA 3BUVA 4H9YA 2PDKA 4L1GA 5FOOA 3OVPA 1OFAA 2WC7A 7REQB 2QUUA 1V93A 1ZAHA 3LTSA 4BF9A 2R1MA 3HQNA 4Q8PA 5G4WA 4C6BA 4XD6A 4PMJA 3CK5A 2ODOA 3R8HA 3NVDA 4PEKA 3PG9A 4XZWA 1UUMA 1WKFA 3UW6A 3KADA 4GJJA 1DIOA 1JF6A 3W70A 3ISIX 4GI6A 4Z17A 3UQNA 1DJHA 2Y89A 3UGRA 1TRIA 4B91A 1QDSA 3TR9A 2NQLA 3WEOA 3KS5A 3QOMA 4PCPA 3RILA 4UQ9A 3AZTA 2FB2A 2P8BA 3SCSA 1ELSA 1SO3A 4B5UA 1IXOA 1HJSA 4JKKA 3VD9A 1SMDA 4RZBA 1VPYA 3C2VA 2V5DA 4FK9A 3QSTA 1E5JA 1MQPA 3OVRA 3UG8A 3EIPA 1VRDA 1BSLA 3SECA 2J62A 3JZUA 3W1RA 1X98A 1R6WA 1CLKA 2RSEA 3KZSA 1H7WA 1MUCA 2IQDA 2MNRA 3CPRA 1J8VA 3CJPA 4CU7A 2R8WA 1A3HA 3N2MA 2ZZ7A 4KF1A 3LZ5A 3DI0A 2X42A 2CBJA 3S9IA 4AZGA 1U1UA 3USBA 3WZ0E 1FHLA 2EXOA 1TPWA 4YCPA 1EJTC 3S42A 4HYVA 4FXJA 2YW3A 3D5HA 5C5YA 1RD6A 2VI0A 3PPFA 2XDFA 3QQ1A 5FF7A 1Y5XA 5C9WA 4NHVA 5HR7A 3CPUA 3CWOX 1Q5MA 2XIQA 3CTTA 4QEEA 1P7TB 1EP1A 4JN6A 1X1NA 4M6QA 3VC6A 3O5PA 2NUXA 1SW7A 3IJLA 1XQKA 4YTUA 1J12A 4PL2A 1JCYA 5I23A 3LGDA 1UIOA 5E1QA 2XIOA 4J28A 4GVGA 1G4PA 1OABA 1EPXA 2PURA 2ZBTA 2IUZA 1LRNA 2WNWA 3PFMA 3M5ZA 2HVMA 2PP0A 4PFMA 2VEIA 3BLDA 3BMXA 1P0KA 5HNUA 2NLIA 4J3VA 2INFA 3F5LA 3QHOA 3FW6A 1UR4A 1SZFA 5HJLA 4MY8A 4ONVA 1ZL1A 4H6EA 2ISSA 3SGGA 4YTSA 1GUVA 5I03A 2VCDA 2VKZG 1F3TA 3ZQ9A 3IIZA 4M6VA 3WSUA 3KHJA 1TV4A 1B31A 1KXVA 1BYCA 1GT8A 1XIDA 3WD0A 2KO7A 4LUYA 3PTKA 4H7CA 2V5KA 4F2BA 3ALGA 4AD2A 3LGGA 5FJIA 3RX3A 3PFRA 4M7TA 2D23A 4HK6A 2VC6A 2EKGA 2A3LA 3UQBA 3WUFA 2XH2A 3STFA 1A49A 3P5ZA 2OT1A 5DQPA 3DHDA 1HTIA 3T6CA 5EBUA 3PBMA 1T8QA 3QM3A 4X60A 4TTGA 3ELFA 3VIHA 5C9XA 1XP3A 1F6KA 2C8NA 1OB0A 5AVHA 2E6AA 1X7FA 1EJWC 1NFPA 3VGHA 3WX7A 5D38A 4GQGA 3RLGA 3R11A 4JIRA 3H2EA 4XK2A 3BL3A 2DVTA 1FJDA 4WUIA 4QNWA 3CUXA 2PDMA 1DJIA 4LV4A 3KL0A 3UYCA 4WGXA 5TIMA 3T1GA 4X2RA 5K2ZA 5LNUA 2PBOA 1WX0A 4G1NA 1O4UA 1PYFA 1V6TA 3MS8A 2WC4A 3G6LA 3ZZ1A 4AIUA 1KTNA 4DRMA 3TV8A 3HO8A 4LBSA 4Q8QA 4A3UA 2A7RA 3PZ9A 3AO0A 1YNYA 3AHVA 3MVTA 4DXKA 3EKGA 1XGZA 4PMRA 1E1CB 2QUVA 3M0LA 5FF3A 3WDIA 5CZ0A 4S3CA 2A3AA 4I7UA 1XRFA 2JGQA 4GIAA 2D0FA 3VXGA 1K9DA 2YB1A 2X1UA 1LCOA 2ZADA 3WBEA 2P53A 4WOZA 2FDMA 2Y2WA 4PBEA 5HATA 3B40A 4MY1A 4UZUA 3O5LA 1EFZA 2ZQUA 3MUCA 4BQ3A 5U4NA 4KETA 4QLKA 3OLGA 1EUNA 4MUZA 2RFGA 2XH7A 1FOBA 4Q32A 3OOQA 4IMEA 3JR2A 2VUNA 1XIBA 2ZA3A 2V38A 4UTFA 2KZHA 3BVJA 4DM1A 1RBAA 1EDGA 2E9LA 3CHFA 5DLCA 2VZTA 5D33A 1XF0A 5GJMA 5E0KA 5ABHA 1FWRA 3LSCA 3SURA 3B8WA 3NPXA 5JU6A 1EF2A 2DZPA 4DRSA 3MP4A 4AH7A 1GZJA 4KFOA 3SCVA 3URQA 2DQWA 4OUEA 4D6GA 4CQAA 3EY6A 3MMTA 1CIUA 1PCWA 7TIMA 3GIPA 4ZMGA 3LLDA 2JKEA 1EJ7L 2J9XA 4HJFA 3RN6A 2DJLA 5A94A 4IX0A 3ZM8A 3VK5A 6ENLA 2ZX8A 3P14A 1U1HA 3SW6A 1A4MA 2D3LA 3W81A 3UJEA 3K1GA 4EWJA 4JN8A 1PS9A 2ZXAA 3LLXA 4DZIA 3P8JA 4S3KA 4IFKB 3VIPA 3GC2A 3ARTA 1JCXA 1OM0A 1D7KA 2V6AA 3B9NA 1Q6DA 1EIBA 1Z48A 4HKPA 5LXEA 4C7DA 1U22A 3DC0A 2PGWA 1ZGDA 2OYMA 1HKVA 4YTQA 4IL2A 5TQLA 4DH0A 1A5OC 4CQDA 4AD4A 1SJCA 4GO9A 4IJBA 3IK4A 5B80A 3TW6A 5D04C 4XB3A 4HPGA 1MFUA 4DWSA 2PDCA 2AMXA 1TMQA 3M46A 2GGGA 2JGYA 3KAOA 3W37A 4AHOA 3IIOA 3WBYA 2O4MA 5E0CA 1BWVA 5C9ZA 3AIWA 2EO7A 4UMBA 4E3VA 3GUGA 2C13A 5I3IA 3KBWA 4ZXLA 4FIRA 4GLEA 5I02A 4UDMA 2GJXA 5A8OA 2JK2A 3WBXA 1OGBA 2PFHA 4D6HA 3CHCA 3HFTA 1QHPA 4J4OA 1X6UA 4EK7A 5KEZA 5DIVA 3FDKA 1HP4A 4FXRA 1KXQA 1Q65A 3G2GA 4FSAA 5M3WA 1KWGA 3K4DA 1NDZA 2NW0A 3V7PA 5K9XA 1A5MC 4Q4QA 1W56A 2F23A 1F8AB 5A8MA 2VHLA 5E93A 3ZSSA 4BWLA 3O5FA 3I6RA 3S5NA 3C0JA 2NWRA 3KEHA 5MKGB 4H01A 4NSBA 2XN1A 3PC0A 5CPQA 1XBZA 1Q4NX 2FVMA 5HW8A 4X0NA 1EO7A 1K1DA 2FYMA 3K8LA 1FH7A 4E5TA 4DZ3A 4GYPC 3WLIA 3FXYA 3MYPA 4WDUA 2PU0A 1GWJA 1TPB1 5LGZA 1TE1A 2C1GA 4G9PA 4MSSA 1XSIA 2ZE0A 2QJMA 3BCDA 3AUOA 5D30A 4JIIX 2VGGA 4X22A 2ABBA 3DCPA 4Z1YA 1NOUA 2WLYA 1PWMA 3BAWA 1UZHA 1MEHA 4BEUA 4GQRA 5LA0A 5CG0A 3W7CA 5F2LA 1L6YA 3T7VA 3TC6A 4YHEA 3S5OA 3EBVA 1PAMA 3RPDA 3NL3A 4XUYA 3AS0A 1WZKA 3WG6A 3R58A 4PBFA 3KHDA 3UXKA 3BW4A 1UIPA 3RU8X 1TMHA 2Q5AA 2YL5A 3QKEA 3MPGA 3NURA 1UP3A 1S2TA 3SCOA 2G96A 3N4AA 1SGJA 1NP0A 3KBSA 1JYVA 4QT3A 5AECA 1YBQA 2D0HA 5AC8A 4NP7A 2BODX 1MNZA 4Q7BA 4GE8A 2BDQA 5CZTA 4QHRA 3WQ8A 4DRJA 1WZMA 4P2VA 2PLKA 2WQDA 5GQBA 1KM5A 1GRJA 3CZLA 4I9TA 2G95A 2PDUA 4Q4SA 3B8VA 3KDNA 3P67A 5C7VA 1IF2A 4CD5A 2OYKA 4HHPA 4OIFA 1E55A 1E6XM 5I07A 3OBKA 1W1YA 4AD5A 2QW5A 1U5JA 2D2HA 4PRWA 1HGWA 2F38A 5EMYA 4LEFA 4TQTA 2NVAA 4M80A 4QG9A 1XG4A 3VIMA 1IWBA 1BG9A 1JNDA 4ERAA 3SY1A 2QMJA 3FHQA 1YYAA 2A5HA 4CEUC 1VIZA 4NNRA 3KLKA 4UMAA 3TA9A 4JFIA 1XLEA 3CEUA 4FO4A 4Z0JA 3ZVIA 3E74A 5ABFA 4DUWA 4FLSA 2CBVA 1UZ1A 3O6CA 2BBFA 3JU2A 5E9AA 1NDVA 1CCWB 1RBLA 4ADUA 2PEVA 2FPTA 3HOJA 1CEOA 3MO4A 2UZ5A 3IGSA 5CPTA 2WSRA 3DHUA 2ZWYA 1GHSA 4Q8OA 1TVPA 3PUDA 4MYAA 2G41A 4LAOA 5CC3A 2E1DA 1ZALA 4PMQA 3AIQA 1AW1A 4C6JA 1A5CA 4PH6A 3S5SA 3LY0A 1WDQA 3DFSA 4ZODA 3GNXA 3ITLA 2VRQA 2D20A 4LYQA 3NQDA 4P7QA 4C1LA 4N02A 3LK6A 1LL4A 3ES8A 3H24A 3A12A 5FF2A 1IR1A 2WMIA 5A95A 1ZBVA 4CEXC 3U2EA 3ENLA 4LAUA 4PCTA 1LLZA 4C5YA 1RHCA 2R24A 1FWIC 4XZNX 4W9PA 3UWQA 4GUJA 5JUVA 3ONCA 5C9RA 3L0KA 5F7UA 1MZHA 1E1EA 1QPKA 1L1PA 3KL5A 4RW5A 3B0UX 2KAUC 3DKJA 1DJXA 2XSXA 2PC4A 3VZXA 3DECA 4JTAA 1EC7A 1O7AA 2B5UB 2E25A 4JNMA 1XYZA 6TIMA 2J4GA 3GAKA 4C5ZA 5BU9A 4DRNA 4IMDA 1UKSA 3W7LA 4MFEA 3N2CA 5AYZA 1V77A 1V0NA 4O1AA 3VD3A 1JZ8A 9XIMA 1W2PA 3CQKA 4PUNA 4W89A 4U3CA 3SCNA 1F3XA 3UJFA 4N4PA 1R9ZA 1KGUA 1REQA 1Z69A 2P8CA 5CH9A 3WF1A 3LRKA 5HNRA 3IKDA 2DSWA 3M47A 4IUGA 1HIZA 4MNLA 3LTPA 1LP6A 2P76A 1S2AA 5HAOA 3GNOA 8TIMA 4UNKA 4AWEA 4AWUA 3ITVA 3GXNA 3PUEA 4JTIA 2B4GA 5D9NA 1LQAA 1UZDA 3BXWA 1CW2A 1NSGA 3BLPX 5FSDC 2XSBA 1Q7MA 3I6EA 3UWVA 1K9TA 1PL9A 3W07A 4W87A 1EJSC 1P0EA 1CX9A 2RURA 1KTCA 2HXUA 4YWSA 2OFNA 4R9OA 1KM3A 3W7EA 4KCVA 2A6LA 4MJZA 5DY2A 1WNOA 2XP9A 2ZR5A 2ZOXA 3DYPA 2VC5A 2PLMA 4JTEA 3EAUA 3BG5A 2GWGA 3AHZA 4W5ZA 3FAPA 3O16A 4JTQA 3WUBA 1YNQA 1EEXA 1HNYA 1XLIA 3B3DA 3NOYA 1U33A 5F4WA 4N6EA 3FA5A 3PAJA 5CZSA 4EPKA 3W00A 2DJXA 3W2LA 2QXWA 3C2YA 4LXFA 5PTDA 5T91A 4LCRA 4JTDA 5HTGA 4F9DA 1ZJHA 4WK9A 2CYGA 4IQCA 2OEMA 2YBUA 4J3WA 3D0CA 3VNYA 4DYEA 4N9CA 3CYJA 1CLXA 3W88A 5CZJA 1C3FA 4KCTA 3IAPA 5A6LA 2R91A 3GHRA 3W53A 3DUGA 1U5VA 4BF8A 4G2DA 2DH3A 1XIGA 2REQA 3EPOA 4IIEA 4ROQA 5ABGA 1GW9A 1FWCC 1K77A 4R9XA 2YDQA 1DJGA 1B3XA 1VCFA 5HPOA 1UH3A 4C7FA 4LT9A 3RK8A 3GVGA 2PDIA 2FTWA 2WYSA 2YCEA 4HQVA 4KS0A 4B4FA 3FA3A 3NDZA 2NVCA 2PP1A 3UZXA 3RX4A 3FOKA 3FA4A 4BCEA 3UPBA 1V5XA 3ANYA 4L4LA 3BZJA 4ILSA 1FCUA 3C3NA 2QMKA 4BR1A 3B9EA 3IUIA 3WLPA 1ISVA 5C71A 3NG3A 3M16A 2VXNA 1LZOA 2X1SA 4AZ6A 5KZMA 3GU0A 2H6RA 2PMQA 1YX1A 3WL0A 1XSKA 3UZZA 3H2FA 4Z1DA 4QJ5B 1A5NC 4ERIA 3GS6A 1DXIA 8RUCA 1KT1A 4EWND 1W5MA 5KITA 3W2MA 4EXAA 3N2OA 3F7JA 3H54A 3DAQA 3KCOA 1S3HA 3LMZA 3PANA 4NX5A 4JTGA 4DJEC 4IMFA 1YXYA 2AWGA 3DBPA 4FNSA 4YYCA 4Z1BA 5E0FA 3G1AA 3L5LA 1N2VA 4HB7A 4DBUA 2B7PA 2ESCA 2PGFA 2FB3A 2GVYA 4Q4OA 1GQJA 4XD5A 3QR3A 2DPEA 3K4WA 3TN4A 4UC5A 3SI9A 3MJMA 4HA3A 4ADSA 4QSFA 3ABSA 3PPCA 4H4IA 2RAGA 3GC5A 2FGLA 2UV8G 1PDZA 3S1WA 1LWIA 3CZGA 5D9OA 1RXOB 1JAKA 3AXKA 3T55A 3W01A 4A8LA 5CC5A 3K1DA 1N8IA 2XP5A 1AW2A 3G6MA 1QI4A 3KX6A 3HPZA 4QFUA 3CAKA 1E56A 2M2AA 3THAA 1SM9A 1A0CA 5DMLA 4HGXA 1H2JA 1FWTA 2BY2A 4QT2A 3O15A 4AX6A 4O10A 3WDPP 3PUGA 2B7NA 3FK4A 5T8GA 3QC0A 1PKMA 3IJIA 3SQMA 2P5NA 1NMVA 4L65A 3FDGA 2PV2A 1VB9A 2CKSA 3RJYA 2QCFA 3VIOA 1TWSA 1YDVA 5DXYA 5GJNA 4JFLA 2NZLA 4AQLA 3GFYA 4DJFA 2IKHA 2ZRZA 2YXOA 1EBHA 4DLMA 2WW5A 1NQKA 5G1MA 4UTUA 3B0VC 2G4FA 1QPLA 1BYBA 3V3WA 4DRQA 4PRTA 3RNDA 4XAGA 1JFHA 1VFSA 4UTTA 2YCLB 3N18A 4KEVA 4L9XA 1XM3A 2PTDA 5CPNA 4K8EA 5D37A 3HURA 3UVIA 5F2GA 1MEIA 4CN1A 5IXEA 1TJRA 4B9YA 2PF8A 3RCYA 3LLFA 4ZXOA 1BXCA 1H49A 2J27A 3W6MA 3NXLA 5I3DA 4F0SA 3SJNA 4V1XA 3B8SA 4D72A 3ATYA 4FF7A 4XTDA 2I17A 3CHEA 4NG3A 3PF3A 4P7LA 1M04A 3EX4A 4JY9A 5A6MA 2VDIA 3GTXA 3OZYA 1NFGA 2EG6A 1FXQA 2I56A 4HN8A 3FAWA 3BTNA 3DX5A 1Q7ZA 4PULA 1TUFA 2PDLA 2P4VA 1EZ2A 4GC3A 3BLEA 2J66A 5FEXA 2Z0IA 3LCGA 3LCWA 5DX7A 2RGLA 5LIKX 2R1LA 1E15A 2WWDA 1DHPA 4B15A 4GBDA 4KWUA 4GKTA 2V3EA 4O53A 5D09A 2FGZA 4JFWA 2V2HA 3VOCA 4MDPA 4PTMA 4R88A 5JVLA 4DO6A 2J88A 4W84A 1SJBA 4S3JA 1UC4A 3GWQA 3AHXA 2VR5A 4CD8A 1RY0A 2G50A 1JG9A 1F8IA 3CUFA 3QMRA 1M1BA 4PEEA 2J74A 2VGIA 4QLJA 3B8DA 2E5CA 3EX3A 5FSEC 5A6KA 4GCAA 1TUXA 3GG1A 4ITZA 4Y8EA 1W3LA 3SUWA 2CLOA 1Q8AA 1JCTA 3TJIA 2V5BA 1DIDA 2D2JA 3VUSA 2EPOA 4WHBA 4UOZA 2W91A 4AXNA 2WMJA 4PUMA 1P0BA 2QJHA 3U9IA 4ZQRA 4DELA 4Y8FA 2F6UA 5CJNA 2EPHA 1W37A 1CXLA 1F61A 1GG1A 3L7RA 4QBXA 4IJRA 4ERGA 2BB0A 4IPIA 1HKKA 3H9RB 4XZIA 4YTTA 3SADA 2CLMA 3OPSA 2WZEA 1I60A 1SZNA 4EX4A 1NTHA 1AQHA 2C6QA 2NV1A 2C14A 4G6CA 1OFBA 5FEPA 4W8BA 4CQBA 4LU0A 2YFNA 7TAAA 1HX0A 3R1ZA 2WMFA 3DC8A 4C6QA 5LNSA 3HB9A 1VFFA 3OGSA 2KX9A 1DJWA 4JX4A 3NQ2A 1E72M 4A3RA 1PYMA 4L4MA 1ZUAX 5BW6A 3C8NA 2J24A 4ML9A 1A5SA 1SVDA 4XWUA 3PR9A 3QXBA 2PTWA 3V1PA 5IDZA 3ARRA 1CGWA 2OVLA 5G4EA 1W9PA 2WC3A 3SN4A 4C6EA 2BHYA 4LAXA 3WNPA 1DTNA 3W1AA 2OMAA 4E8CA 2YR1A 2HBVA 3R13A 5LNVA 1WDSA 1ZP4A 3VM7A 1FKWA 1UW9A 4J2MA 4IH3A 5AZ1A 4GYFA 3ITTA 1EHAA 2AOSA 1Z7AA 2RUDA 3H4WA 4B2DA 1Q6CA 2W63A 3KM8A 1D2KA 5IOBA 3RX2A 4GZ7A 4RUBA 3THUA 2OWWA 3TZNA 3IS4A 1VR6A 4N6FA 1GKPA 5K4ZA 4H8HA 2ZRYA 4CNSA 3FV9A 3TN3A 5DCBA 2IKJA 4R33A 5JIWA 5BOEA 3VA8A 4AW7A 2V5LA 1ZJBA 1AH4A 1FA2A 4NU7A 5GNZA 2DVXA 2OEKA 4C6KA 1H1NA 3VGGA 4GI8A 2ACSA 2G3MA 4LUIA 4M8UA 3HG5A 3I3DA 1RV8A 2ZQVA 4M0XA 3KAFA 3NSMA 3IJ7A 4IT6A 1YADA 2PS2A 2CLIA 4GK8A 3HMJG 1Z9AA 1RCXB 3TOYA 2JF7A 5FJUA 2H8XA 3MDYB 5I78A 2XTKA 2YDAA 2EPMX 1JXJA 1CXFA 2VR4A 2WZIA 4K2SA 1UPPA 2BHUA 4PCNA 1OVDA 2WANA 3QLDA 3T78A 3KCEA 3DKLA 2CLFA 5AVNA 2J6XA 3M07A 4H7ZA 4WKHA 1QPRA 3B8UA 4AAJA 3PRAA 1SFLA 1ZHAA 1EGZA 2PDWA 3S2CA 1LJYA 4LW7A 3XISA 1QWGA 4HSNA 4PB5A 1IZJA 3LQGA 4MNJA 4QAWA 1X6LA 2DSUA 1FWBC 3QTGA 1KGXA 3WMLA 5AFDA 1WAWA 1ISWA 3KFTA 4Q4KA 2W5FA 2J6VA 4XZ9A 1LOSA 2VWTA 1KC7A 1B4EA 2BZNA 2Z26A 3L67A 1MYRA 4HZ7A 3OOBA 3L23A 1XQLA