4DWSA

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
543
structure length
526
Chain Sequence
GAVPTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEKIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADETIDMGPLYNPGEIYLSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
molecule keywords Chi2
total genus 186
structure length 526
sequence length 543
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsA02
3WFZA 1JZ8A 4MNKA 3WELA 4FMVA 1Q4NX 1V0NA 4KGLA 3SCPA 1WP6A 2VURA 4UCFA 5BYWA 2W4XA 3DC0A 4AEEA 1W9UA 5HOSA 4L4PA 3KL3A 3WDHA 2ZXDA 3VDCA 1JDCA 1XH1A 3AI0A 3NYDA 1HP5A 3OZPA 3RCNA 4E8CA 3VIFA 1KR1A 3VMNA 2V5CA 3AIEA 1UKOA 4UFMA 4UQDA 1XV8A 1M7XA 5JBEA 3LPFA 4H7VA 4PMUA 3RM9A 3WD2A 1FOBA 2CCRA 3RDKA 1VIWA 2DQXA 1FFRA 2E40A 4YPJA 1JXJA 3NJ3A 2BHYA 3TTOA 1GHSA 1E6SM 4IPLA 1XGZA 2BXZA 2IXUA 1BHGA 1CECA 1NOFA 5A6MA 2XUCA 4W8BA 5FIPA 2WVSA 1UWTA 3KZSA 3M7SA 1XSJA 3PZUA 1WO2A 2EJ1A 2XJ7A 3BLKA 4XUYA 2BHZA 2JF6A 4NI3A 2PBGA 5A94A 4PMQA 3VU2A 2UY3A 2WBGA 2J7EA 2VZSA 5ABGA 1QHZA 1BG4A 4C7FA 3MMWA 1UOKA 3EMQA 1W3JA 3UG3A 1XH0A 3OBAA 1QI4A 2O9RA 1FH8A 1XCWA 2XVGA 6TAAA 1KCKA 2J47A 4W7VA 5I2UA 1TZ7A 3WH9A 3WDIA 3VDBA 1E0VA 3K8KA 4S3KA 2CBIA 3GDBA 1CGYA 3WQ5A 1ZBKA 4MADA 4M8UA 3PTMA 1B3VA 2BV9A 2BHUA 1KXVA 5TD4A 2OLHA 5BRPA 2BY1A 4A4AA 2Y2WA 4GZJA 7A3HA 5CGMA 1DHKA 1UH3A 4KGJA 4CD6A 2WLZA 5M5DA 1J0ZA 2WZHA 1H09A 5FL1A 3L4UA 3BCDA 3O2LA 3PZIA 5E0FA 3G6MA 2E8ZA 1OGBA 3WD0A 1B3ZA 2X2YA 3JUGA 5DO8A 3QOKA 1GOMA 1JDDA 1JD7A 1C93A 3AIUA 1EDGA 1OD8A 2WSKA 3SUVA 3WDPP 1DP0A 2WBKA 4LPCA 3QOMA 1W1YA 4AD1A 4AXNA 1G0CA 5FKYA 4CD8A 2VC9A 1QI5A 5D9MA 3SCVA 4NRSA 4GZIA 1W9PA 4MDOA 1HIZA 3OB8A 2DT0A 3PTQA 4ATLA 3UESA 4PYSA 4AZHA 3WIJA 4AZIA 1E55A 3CIVA 3IJ9A 3T0BA 1V6YA 3BMVA 3OLGA 1BYBA 3U57A 1ZBVA 3SCWA 5FD0A 3SCTA 4AY1A 4AC1X 3PZ9A 4X9YA 3WY1A 1JZ3A 3D5HA 2WANA 4YHEA 3VIPA 2G41A 4AEFA 4KMQA 1F4HA 1LWJA 2V3GA 3WD4A 1C8YA 2J75A 3WH7A 2FGLA 3WQVA 1OCQA 2YA0A 3EDDA 4XZWA 1HL9A 1PX8A 2DH2A 1KQZA 1RD6A 2WVUA 4XB3A 3OZOA 1TG7A 3GXIA 4AD4A 3CHDA 2CXGA 3WH6A 2GDVA 3N04A 2QMJA 1AMYA 2JEQA 4UOZA 2F8QA 2GJPA 2W62A 4LYPA 3I3BA 1NWUA 3ZJKA 1V0LA 1UZ1A 5A3HA 3ARPA 3WNPA 1UR8A 4GO8A 3CUJA 1VBUA 3ARXA 3UR7A 1MW2A 2PWFA 3WNMA 5C71A 3MV01 3NSXA 1NWSA 1HKJA 1G01A 1EH9A 1E71M 4PMZA 5I6SA 4TX6A 4CKQA 4W86A 1NWRA 4P7LA 2XIIA 4OBSA 3OG2A 2BY2A 4AD2A 5IDIA 3AHTA 4DWSA 2WMKA 4OOUA 3BSGA 1EO5A 4GXPA 3GXFA 5EBAA 1GHRA 1YHTA 2VCAA 1NP2A 3CPUA 2ZUSA 4FK9A 4QLJA 1QNRA 1W3KA 1CLVA 1C3FA 1KBBA 2ESCA 1E3ZA 1VENA 3BC9A 3ZOAA 3N1AA 1JF6A 4UQCA 1SFSA 2W63A 4D6CA 5DEZA 4HMEA 4JFWA 4AIOA 3O9NA 3M07A 2XVKA 1WNOA 1RPKA 3GZAA 1UWQA 3N12A 3WQ4A 4F66A 2G3IA 1UWIA 3T09A 3B8SA 3PZTA 3NCOA 4N42A 1ITXA 3PTKA 4M80A 5D8ZA 4E2OA 1W2VA 3K8LA 4MTVA 2A3BA 1Z32X 4BQ5A 4M56A 4CN6A 3KL5A 4M29A 1ODZA 4W5ZA 5LA2A 4EK7A 1E1EA 1B90A 1WB0A 4TTUA 3VGHA 4MB5A 1UD4A 2J4GA 1TE1A 4J3UA 5KEZA 5D9NA 3VD9A 3W4RA 4JAWA 4CCCA 4OZOA 1W9BM 3WNLA 5BWFA 1E4MM 2VVNA 2ZXAA 5E6ZA 1GQLA 3MS8A 5E70A 3L4ZA 4CN1A 2VMFA 1HF6A 3PZQA 2QPSA 2J77A 2OSXA 1LG1A 2YDQA 3ZMRA 2VRJA 3AZTA 4AIEA 2E0PA 2X05A 4CU8A 8A3HA 4JIEA 4U5IA 2VZTA 1L0PA 3AOFA 3EDJA 4B3KA 3VGFA 2CBJA 2J7DA 4D72A 3WF3A 4RE2A 3VDAA 2DSWA 3WF1A 1J11A 2OYLA 4K68A 1UR4A 2WPGA 3VM7A 3NSMA 4P8XA 5BXPA 1QHOA 2OWWA 2VR5A 4V27A 4R27A 1E0WA 1NQ6A 1ISZA 4GINA 4EE9A 4ACZA 2ZE0A 3RIKA 4LQ1A 2AMGA 2ZX8A 3AMDA 1E6PA 3ARWA 1WZAA 2YDRA 1BF2A 4V2XA 3WMSA 3WEZA 2EQDA 4CCDA 1J0IA 2J74A 2Y8VA 4CN4A 1ZB5A 1DTUA 4F9JA 4HPHA 1ZBWA 1MWOA 5A8MA 3DECA 1BTCA 5LA1A 1WZMA 1LF1A 1LL7A 1E6RA 2VVSA 3MUY1 2GUYA 4W93A 3HN3A 4W7UA 4CU6A 2XM1A 4XV0A 2YBUA 1PBGA 2WCAA 2ZX6A 2E9LA 4NZCA 1V3MA 3SCUA 5IXEA 3CH9A 1H1NA 3AQUA 1LG2A 2XVPA 5I78A 1J01A 1E4LA 3OGRA 1DWGM 2WSPA 4U31A 4UFIA 1GQIA 1H49A 4P7QA 1QOXA 2GK1B 4UNIA 1JFHA 1QNOA 3FHQA 3EDKA 1CBGA 3QR3A 2JALA 1NARA 1W9DM 1C90A 3AICA 2IXVA 4KRTA 1MQQA 2WW5A 3KL0A 3DHPA 4EKJA 2WB5A 3A47A 3MU7A 1V3LA 4AISA 1O7AA 2X8RA 3W37A 3K8MA 1M04A 4D71A 1C7TA 1V0KA 1E4NA 3AHZA 1GOIA 4HU0A 4D1IA 2YLLA 2ZXBA 4AZGA 2PBOA 3VD4A 2YA2A 1DWJM 4MPKA 3GNOA 5D9OA 5CQ1A 3WQWA 3WBEA 2XFRA 1NM9A 2YKKA 4UQ9A 3VMPA 5M03A 4DWSD 4W85A 1CXIA 1U33A 4B15A 3VD3A 1KXQA 1VB9A 2PWDA 4HZ8A 5EFDA 1I1XA 2O9PA 3MO4A 2DSZA 3OIHA 2PB1A 3AMKA 2WHMA 2XHYA 4P7OA 2ZUMA 3VIKA 5A6AA 2VUYA 2X0YA 3L4TA 4UZSA 5BXTA 3AROA 3AHXA 2ZUTA 1OBAA 2HISA 1BPLB 3FXYA 1NH6A 3BCFA 1GVIA 1X6LA 3MMDA 5AC4A 1WCGA 4DM1A 1FH7A 3AXHA 1XCXA 4ATWA 1B0IA 1V6UA 4BZYA 1RP8A 1E15A 4ML4A 1CLXA 1UYQA 4OUEA 4DUWA 1EGZA 4HMCA 3FN9A 5A6SA 4Z2HA 4UOJA 3VNYA 1CXKA 3ZO9A 4EAMA 4IISA 1GOQA 3POHA 1C92A 4HOZA 2D0GA 4DUVA 5A6BA 3PHAA 4URIA 1FP9A 2ZXQA 2PF0A 1B3YA 1B3WA 4W88A 1E4IA 1QBBA 1IZKA 5M3WA 1C7SA 2G3JA 3ZJ8A 3ALFA 5A6BD 1R8LA 3WH8A 1JZ7A 1JGIA 1CIUA 4QDMA 3W38A 4X0VA 8CGTA 1JZ2A 1BG9A 4Z2LA 1HNYA 2CBUA 3G6LA 3BAYA 3U5YA 4JZ5A 3VIIA 1J12A 2WHLA 4H04A 1EDQA 1SR0A 3VIMA 2XWEA 3PZGA 3E1F1 1PIGA 1RP9A 4FLQA 4RE4A 1UR1A 2JFEX 4C7GA 3II1A 3B9AA 1CYGA 1EOMA 3F5JA 1KWGA 3LPPA 1B1YA 3A4WA 3MUZ1 2JIEA 2YL9A 2VZUA 2CHNA 4PRWA 5EB8A 1TMQA 3AFBA 2DDXA 2WKLA 4X0NA 2DSKA 1HJVA 2QF8A 3T08A 1JI1A 5A8NA 3GXMA 4HZ7A 3EMZA 3DYMA 1PX4A 2VX4A 1E40A 2DSUA 2CETA 1XYFA 5JH8A 2WCGA 3IK2A 1HN1A 4AZ7A 5CLTA 4ZEPA 4YHGA 4PMDA 2EEXA 3VIOA 4ACZB 2VX7A 3ARZA 2JF7A 1O6IA 1TR1A 1CXHA 5EFFA 3UERA 2XWDA 4JL1A 3ZSTA 2O9TA 2AOSA 3TONA 4TXEA 1UD2A 2FHBA 2A3HA 4U2ZA 3KE0A 3K1DA 3VX1A 1J0KA 1XYZA 4AD3A 4JFUA 2VI0A 1JIBA 2DH3A 1E6ZA 1JAKA 3GH5A 3UCQA 3S2CA 4M82A 1VAHA 1GVYA 1MXDA 3CHFA 1H4PA 1F4AA 2XGBA 3ZIZA 2CERA 1JNEA 1GQKA 3L2MA 2YIHA 5HNNA 4JKLA 1J0JA 1GW1A 2XTKA 2C8NA 3I3EA 1VEOA 2VX6A 1WKYA 2BNJA 2XVLA 2V5DA 3L4XA 4H8HA 4HA1A 1KQYA 3CMJA 5DT7A 3L4WA 1UQYA 2X1IA 4RE3A 2G8ZA 5E6YA 3W6LA 2CKSA 1B30A 3RJXA 3LPGA 1SYTA 2VCCA 1JF5A 2DPEA 1BFNA 5A69A 5IHRA 1DWIM 1MYRA 1EHNA 3TTQA 3WUGA 3BSHA 1U2YA 5A2CA 5A6LA 2WMGA 3F4VA 1QI2A 3ECQA 4DM2A 1X6NA 2WWDA 3BAIA 1VEMA 2D3NA 2W92A 2WVVB 4MB4A 1GUVA 1IZJA 1ZJAA 4JCMA 3ZJ6A 4UFKA 5DMYA 5C8BB 5IFTA 5E09A 4F79A 1AVAA 3B9EA 1ZL1A 1JL8A 2Q8XA 4JL2A 1HKMA 1WZKA 4GZEA 4Y7EA 1LJYA 1S46A 3GYCA 4PEEA 1DWAM 4W87A 5IHSA 2D20A 4D6DA 4P8VA 4AMCA 1D3CA 4PMNA 1XSIA 1EIBA 3W27A 2D22A 1Q6DA 2XG9A 3WD1A 5CG0A 1GOKA 2PC8A 2QMKA 4ZE5A 2VZVA 4DWSB 3MV11 3K4DA 2NW0A 4MAVA 3OLIA 1W1TA 4LGXA 1CWYA 1BYDA 1H0GA 4U2YA 3CBWA 4UQAA 4Z2IA 1MW3A 4Z2KA 1CGXA 1ISWA 4PMVA 5M17A 1WAWA 1W1VA 2W61A 4ZXOA 4AWEA 5AC5A 1TVNA 1JYXA 4JFSA 1UD5A 2OYKA 1V6WA 1V6VA 2FGZA 2J8FA 3KWXA 4BCEA 3SUTA 1HT6A 3PZMA 3D3AA 5AYIA 3CZLA 1CDGA 2ZWZA 2WWCA 4UFJA 1V6XA 2C7FA 3A6OA 2VT0A 4WKHA 1J0HA 4FLOA 4CVWA 1Y7VA 3N18A 1H5VA 5HXMA 1JYWA 1KWKA 4P8WA 1MW1A 1VFOA 3BAXA 4KRUA 3WF4A 2NSXA 4TTGA 4B9ZA 4TVDA 1HJUA 3W29A 5ABHA 2XFFA 3AS2A 4GQRA 1CXLA 4HOWA 4H8UA 4E8DA 4QFUA 2F61A 2YA1A 3VM5A 1KXHA 4JHZA 3WUEA 2WCSA 3VKKA 2ZUWA 4WSKA 2PI6A 2GFTA 1HKIA 4E4PA 3GXDA 4LXFA 2FH8A 4AZ5A 2XYLA 5A8OA 4BQ2A 3VO0A 5AYBA 2YJQA 5CLWA 3WBAA 3OGSA 1H11A 2J7BA 1FHLA 4CVUA 3HJEA 3TA9A 3RMEA 4DUXA 3AMCA 3WL0A 1I1WA 1R7OA 3AS1A 1VRXA 4GI6A 2GJXA 1Q6GA 1CGVA 1W1PA 3ARTA 4BQ4A 2EPMX 3AHYA 2Y5EA 1UD6A 4D6JA 3MUIA 4TOQA 3DYPA 4UFLA 4WF7A 4DWSC 4P7NA 5BCAA 3SIMA 4A3HA 4PSPA 1UQZA 1I75A 3UR8A 1B3XA 4M24A 5AY7A 3CZGA 4QAWA 3WH5A 3CHEA 2J7GA 2QLYA 3IJ8A 5I77A 4Z2GA 1OGSA 1G1YA 7CGTA 5JIWA 3AXIA 3NDZA 5C70A 1UHVA 1E73M 3VOCA 3AIVA 3POCA 2J25A 1BYCA 2WM0A 3M46A 1KGUA 2CITA 2CPUA 2FHFA 1JXKA 1CPUA 2VRQA 3WN6A 4HP5A 3VX0A 3WL1A 3GNPA 1D7FA 5CZKA 1ECEA 4OJYA 2J7FA 1LQ0A 5CGTA 4FF5A 4RL3A 1QVBA 2CBVA 4ZFMA 3AIRA 4JKMA 1XD1A 2E3ZA 2XFYA 5A1AA 1PZ3A 2EPOA 2ZX9A 4WIWA 3CZKA 1M01A 1XH2A 4J3WA 1GZJA 3K4AA 3CUIA 3AZSA 3UG5A 3N9KA 4BQ3A 5D9PA 5LA0A 4C7DA 2CNCA 1JZ6A 1DWFM 3BH4A 2DSVA 3BLPX 4YN5A 3WKZA 3CO4A 1RH9A 3MMUA 3PZNA 4JCLA 2DIEA 3VD7A 1HJSA 1GOWA 3QGVA 5A6JA 2WXDM 1M03A 3NUKA 3DHUA 1NWTA 2Y8KA 4OKDA 3I3DA 1MQPA 4AIUA 1V3KA 1UKSA 4AD0A 3NIYA 1J18A 2YDSA 3BXWA 2TAAA 1ZU8A 1BVZA 1H0IA 2QHAA 4H41A 2WC7A 2OSWA 3GTNA 5JBFA 4IPNB 3WQ6A 2BXYA 1DEDA 1BAGA 3ARQA 5A8QA 3ZSSA 3VGBA 3GBEA 1E43A 3A4XA 2VQUA 1GONA 2YBTA 3VGGA 1WDSA 2A3AA 3WENA 1K9DA 3OLEA 4JFVA 5BRQA 3CUHA 1G94A 3AXXA 1R87A 1JI2A 1UD3A 1R7AA 5BROA 2PWHA 1XHGA 1MVYA 3SEPA 3ZT6A 5JUVA 1OGGA 5HBFA 1JYVA 3AZRA 4XX6A 4UFHA 5EMYA 1CGUA 3GBDA 3K46A 5CJ5A 3W0KA 2WVTA 3CZEA 4TX8A 4FLRA 3CMGA 1CZ1A 5CSUA 2UY4A 3CUFA 2BVYA 4WSJA 2OWXA 1WDPA 1TFVA 3T2OA 1UA3A 2D0FA 4D6FA 3B9DA 4HMDA 3ARRA 3THDA 5JBDA 2XIBA 3TOPA 1B31A 1OT1A 2DGAA 2EPLX 2ZUVA 5GNZA 2BVDA 3F5KA 3SUSA 5JIPA 2UWFA 1E1FA 1OD0A 3VGDA 2D1ZA 2ZX5A 1JNDA 4PCTA 1HL8A 4CGTA 2D23A 1C8XA 1N82A 1TCMA 3AS3A 3WUBA 1KCLA 1R86A 1NP0A 4S3JA 2YL6A 1K9EA 4CD5A 3SURA 2FDMA 3VILA 1HVXA 2AAAA 1MFVA 2YOCA 4MDPA 3QHOA 3AJ7A 3RM8A 1ISVA 4AZCB 4J28A 1W3LA 5E0CA 2Z1KA 1KR0A 2XSAA 2J79A 4LYQA 3UEQA 1BGAA 1W32A 2NT0A 4GIAA 4M81A 3W24A 3LPOA 3AMGA 4PCSA 4OIFA 2BY0A 3SCRA 1Q6CA 1QPKA 1GNXA 3ZR5A 3ARUA 1W9VA 3WMBA 3BGAA 3APGA 3RM4A 1QI3A 2WHKA 3ARYA 3L4VA 2VX5A 3S6TA 4WK9A 3WDRA 4F8XA 1KB3A 4PTWA 1UUQA 1TUXA 3W25A 1EOKA 1MXGA 2EPKX 4UZUA 1W9XA 4D6HA 1K9FA 4AYSA 1CGWA 3KEHA 3FY1A 2YLAA 1HVQA 5GQBA 3WNKA 2O92A 4F9DA 4TVCA 1ZJBA 1J0YA 2GVYA 3EDFA 3VNZA 2WMJA 2ZIDA 2W66A 1UKTA 2QPUA 1V03A 1VJSA 5A2AA 4HU8A 1E6QM 4OBRA 2WMHA 5DFAA 1LL4A 3N13A 4Z2JA 1FFQA 1EXPA 4LX4A 2BS9A 1CXFA 1E70M 4W8LA 3T0DA 4CD7A 2VZOA 4D6EA 5HPOA 2V3EA 4P7RA 3U7BA 1OINA 3ZT5A 1V02E 3N15A 1E0XA 2RGLA 3AIBA 4H8VA 3AHVA 3MANA 3SUUA 3T2QA 1QI0A 3TP4A 3T0AA 4BS0A 5ABFA 4J7RA 4MAZA 1VBRA 3AS0A 1D2KA 1K6AA 2WVVA 4MB1A 1QNPA 3GH7A 1E6NA 2WMFA 4MJ2A 1ITCA 2CESA 3VD5A 4CD4A 1TA3B 3BMWA 1Q6EA 1QBAA 2G3NA 1JFXA 3U5UA 3VGEA 1W2PA 2ZUUA 2WNWA 6CGTA 3N17A 1UR9A 1JYNA 3GNRA 2ZUNA 2W91A 1JDAA 3RO8A 1GOOA 1PIFA 1KGWA 2EPNA 4HOXA 3OLDA 2WKGA 5I23A 2DT3A 1GQJA 1UWUA 3NSNA 1CTNA 1XD0A 1OWQA 1BGGA 1FP8A 1G5AA 4U3AA 4J3SA 1JD9A 1GJWA 2VL4A 3WFLA 4AZBA 1UR2A 3AISA 1NOWA 3PN8A 3CTTA 4JFTA 3N11A 3WD3A 1C8QA 1H3GA 4J27A 4OOZA 1VEPA 3ARVA 1B9ZA 5CPTA 5F7UA 4H2CA 3RPMA 2UY2A 4QLKA 1OSEA 1P6WA 4KWUA 3ZM8A 3O6AA 3EBVA 5I24A 3HMCA 4XZBA 2VOTA 4P8UA 3ZQ9A 3PZOA 2CEQA 3OGVA 1BLIA 3WF2A 1CNVA 4D1JA 1W3HA 3TTYA 4QLLA 1VJZA 4QCEA 2D0HA 1GJUA 1IV8A 1ISXA 3U7VA 1AQMA 3W28A 5GNYA 1V3HA 3THCA 5FL0A 3BAWA 2ZX7A 4CUCA 2OYMA 4PN2A 5FCZA 1QHPA 1EQCA 4NF7A 1PZ2A 3W26A 2EBNA 3BAKA 4AZCA 4WLCA 1KXTA 3IJ7A 3CZ8A 2DIJA 2J7HA 3VIJA 3W53A 3WQ8A 2RGMA 2Z1SA 3J7HA 4W89A 5A8PA 1BVNP 5I5RA 2YL5A 3W81A 4JHOA 1LLOA 2VR4A 4PTMA 4UOQA 2VQTA 4PTVA 1OB0A 1M53A 4MNMA 4PUEA 1BSIA 1BQCA 2WZIA 1UZ4A 1HX0A 2WMIB 3OA5A 1U30A 4WKAA 3AMLA 3VINA 1US2A 1E9LA 3AYRA 2GJRA 4W84A 2EO7A 3HU7A 4JKKA 3CUGA 2GDUA 4WKFA 1UKQA 2XPKA 1FH9A 5CXPA 1CENA 4ACYA 4J3XA 4GQQA 4TVUA 5A6KA 4AW7A 2V3FA 3NDYA 4KH2A 3FAXA 2W67A 1KGXA 1HJXA 3UG4A 5BXRA 2EXOA 4B16A 3WEOA 3L4YA 3ALGA 5CSYA 1GPFA 2OWCA 3EDEA 1WZLA 5GNXA 1ODUA 3VVGA 2O9OA 4NSBA 4U5KA 5GPRA 1E5JA 1V0MA 4CCEA 3PBGA 3PZVA 4GI8A 2CYGA 1UD8A 4HTYA 4PBGA 1SMDA 1Q6FA 1ZS2A 3BAJA 1E72M 2BVTA 2Y24A 1NOUA 1YQ2A 2WHJA 1DWHM 2WZEA 4ATDA 2XGIA 1UWSA 4MJ4A 2C0HA 3TTSA 3WNNA 4LYRA 1A3HA 3EMCA 1JG9A 4W7WA 3GH4A 4HZ6A 2ZICA 4PMRA 3WDQA 2V38A 1CGTA 4MNJA 3RJYA 6A3HA 2G4FA 3SCNA 4W8AA 2VCBA 2J78A 1OT2A 2XVNA 3UETA 3W82A 1SMAA 3L2LA 1UKPA 2GJXB 1TA3A 2JIWA 4GKLA 3QHNA 5A2BA 4EANA 4M1RA 3FHAA 3ZR6A 2E9MA 3QHMA 4IUGA 4Q22A 3MSGA 2OSYA 2YL8A 3IAPA 4V28A 4UQEA 1WDQA 3VTRA 4B9YA 3T2PA 3A3HA 7TAAA 1L8NA 1ISYA 2J8GA 3IAQA 3WF0A 3MKKA 1QNQA 1JAEA 2W5FA 3CHCA 4NRRA 1QNSA 1PJ9A 1CEOA 1BYAA 5BXSA 1EO7A 1JZ4A 4GO9A 1XC6A 2PWEA 1AQ0A 1V08A 1E6XM 1E56A 2WC4A 5CPQA 2A3EA 4HA4A 4PMXA 1J10A 2B31A 3SUWA 2WK2A 1C91A 2E4TA 2BY3A 4BF7A 1MQRA 3VIHA 3ARSA 4N0RA 5DF0A 4A3YA 3SCQA 5E9AA 2F2HA 3CLWA 3SCSA 2E9BA 1JZ5A 4UR9A 4L4OA 3GM8A 3ZJ7A 1LL6A 5D8WA 2CKRA 1XRVA 3WNOA 1OIMA 2WC3A 4U33A 4AD5A 2UY5A 3WEMA 4Q7NA 2FH6A 1PPIA 3MUAA 5I3DA 4D6GA 1H41A 1HP4A 5KZ6A 2XM2A 2Y4SA 2D24A 1R85A 1HXJA 3VUPA 3EYPA 4GI9A 5ECUA 5I0DA 2GK1A 1HJQA 2WLYA 2VJXA 4B3LA 5HDRA 4U3CA 3WMCA 3WDJA 4J3TA 1QW9A 2X09A 1UWRA 1EQPA 4QP0A 1E5NA 1GORA 4GPNA 1UH4A 5A95A 3VDHA 3WUFA 1VFMA 3LMYA 4MNLA 1UG6A 3AYSA 1G9HA 1OM0A 1E3XA 3AIWA 5ABEA 1FHDA 3ZT7A 5CPSA 1K9TA 1VFFA 3WSUA 1IT0A 3CGTA 1LWHA 4D6IA 4PSRA 2BFGA 2G3MA 1UH2A 4CU7A 3A4AA 2J62A 1GCYA 1FA2A 1VF8A 2PWGA 3F5LA 1PEZA 1KFWA 4PUDA 5D4YA 3RILA 1VFUA 1ESWA 9CGTA 3IANA 2CIPA 2VNCA 4ZXLA 4MB3A 1MW0A 1V3IA 4TUFA 2XSBA 2A3CA 1WE5A 2IUZA 4W5UA 2VRKA 4HA3A 1US3A 3VMOA 4PMOA 1XSKA 2WMIA 5HPCA 2FHCA 2DT2A 1AQHA 3VPLA 4R5EA 5I79A 5LYRA 4BA0A 3VIGA 2VO5A 2WYSA 5IFPA 1PAMA 1EDTA 1UA7A 1WPCA 3FAWA 3MSDA 4PTXA 2NT1A 4ZENA 4ZE4A 2V3DA 2HVMA 2X0HA 3FW6A 5ABFB 1ZBCA 5FOOA 3DYOA 1MFUA 1OIFA 1J9YA 2D3LA 2JEPA 3W6MA 4J3VA 2DT1A 2J7CA 5DT5A 1QW8A 4WJXA 3M6DA 4UTFA 2QV4A 1PX3A 2GSJA 1X1NA 2E8YA 3FNDA 2JE8A 1CXEA 2WAGA 3CZJA 4AZ6A 2D2OA 4FLSA 1A47A 1KBKA 1TVPA 4IM4A 1WDRA 2ZWYA 1EHAA 3SCOA 2VTFA 2CHOA 1UR0A 1W91A 1H2JA 4QCFA 2DEPA 4UQBA 4PMYA 2MANA 1HKKA 1EA9C 4HPGA 1B2YA 1V3JA 3AIQA 1V02A 1HJWA 2ZOXA
chains in the Genus database with same CATH superfamily
2BDQA 2NUXA 2WJDA 3A3XA 3WELA 4FMVA 1Q4NX 2QKFA 4C6DA 1UB3A 1V0NA 3HF3A 1OF6A 3HG5A 3SCPA 5HK4A 5D37A 3U2OA 2YYUA 1QW7A 3MBDA 4QXIA 4IJCA 2W4XA 3DC0A 2INZA 3H2OA 3TU9A 5HOSA 3NQ2A 3KL3A 4MM1A 2I9EA 4EF8A 2XH7A 2IKIA 1KR1A 4IIHA 1QPRA 4UFMA 4XTIA 3QGAC 1XV8A 1M7XA 4IQ2A 4AWSA 1DJXA 3LPFA 3RM9A 3WD2A 2BVWA 1LWIA 1D7HA 3WLKX 4ZQRA 4YPJA 3O5IA 1JXJA 3BL3A 2KAUC 4HA0A 2BHYA 1UOZA 4CQ8A 3R58A 3NEHA 3OZMA 3LY0A 1NDVA 2XH0A 3P84A 1XGZA 1P0NA 3M0KA 3TMLA 2X16A 3SY8A 1NOFA 2XUCA 2WVSA 4A8LA 1UWTA 3KZSA 1XSJA 3FA5A 1F73A 1QK2A 1UZDA 2QIWA 2A7RA 1LBFA 1BL4A 4JN6A 5FJTA 2GQAA 3IJIA 4GUIA 2WBGA 2J7EA 5ABGA 1DJWA 3MMWA 4C7FA 1UOKA 1P0DA 2BB0A 1QI4A 1FH8A 2QCCA 1KCKA 3AUOA 3H2NA 1LDCA 2SFPA 3SBFA 2AKMA 3K8KA 3UG8A 2VN1A 3GDBA 4XAGA 4DJED 3WQ5A 4JIQA 4MADA 2ZA1A 4H2HA 1RJRA 3BWWA 4GCAA 2EULA 4S1FA 4GZJA 4YCPA 5CGMA 4CD6A 2WLZA 3FSUA 5I03A 3EKGA 3PZIA 2XFWA 2E8ZA 3FAPA 3MUCA 1B3ZA 2C71A 3QOKA 1PDYA 5DO8A 5DIUA 4LAUA 1JDDA 1JD7A 2NLYA 2RQSA 3CGMA 1YPFA 1OD8A 3WDPP 1W1YA 4GH3A 4AH7A 2HK0A 3PULA 1M7JA 5C9XA 4QJ5B 3CWNA 2VC9A 3DG3A 2QJMA 3TYUA 5D9MA 2VC5A 1QMLA 2I5GA 3C3NA 1I45A 4AZHA 4PYSA 3MP5A 3PUDA 4UTLA 1GJPA 3CIVA 4K1WA 4PULA 1BTMA 1XIBA 5CBIA 4JD4A 5FD0A 5C2CA 3SCTA 4AC1X 3TN3A 2BASA 4X9YA 4ZPVR 4Q6XA 1Z89A 5LXXA 3D5HA 3B7XA 3VZXA 3P6LA 3KTCA 3REQA 4BF9A 3ME3A 2NQHA 2FGLA 2DG9A 3EWDA 3O1NA 2QDHA 5CPLA 1OCQA 3DFYA 2A1YA 1HL9A 2WSRA 3NQBA 4GA8A 3HM7A 1FAPA 3I65A 2CXGA 4DBUA 3CL8A 1WXZA 3WH6A 1NSGA 1VPYA 3N04A 1EFZA 3M0YA 4UOZA 1IR1A 4HYRA 4QJ3B 3UXIA 4D8AA 3I3BA 4FXJA 4F2BA 4H3DA 1V0LA 3BGGA 2IKGA 4ZPTR 1UR8A 1F3TA 1SJDA 3R4IA 1V77A 5HNUA 2BG5A 3DFPA 1FKFA 1AZ2A 3RFWA 3NSXA 1XI3A 4MWAB 3BO9A 4CKQA 4P7LA 4OBSA 1SZNA 3UY7A 1IXQA 4EPDC 4WDUA 2AAMA 1KT0A 5EBAA 5CC5A 1YDOA 1YHTA 1ZFJA 4DQWA 1WKEA 1W3KA 2IPFA 4EWJA 2ESCA 1E3ZA 1VENA 4JYEA 3TCEA 4UQCA 1SFSA 5K9DA 3BJFA 1RCXB 3D6NA 1B57A 3O9NA 3M07A 1XR2A 1UUOA 3S3GA 3S2JA 3W71A 3N12A 4K7VA 4PMJA 3C52A 2MPHA 1EBGA 3BDKA 1VFLA 2CLOA 3PZTA 4GGBA 3HFYA 1ITXA 4HHMA 3H12A 3GU1A 4S23A 2X0SA 4Q8TA 2FFIA 1Z32X 2HSAA 3F4DA 4M56A 1JQXA 1SZFA 4ASTA 4N02A 4W5ZA 1B90A 3O8AA 3THQA 2DU2A 3MCNA 3MBFA 5DY3A 3VD9A 2F2DA 3W4RA 4JTDA 2I57A 3VABA 3GDKA 1W9BM 3MS8A 1BWKA 1F05A 4A21A 4CN1A 1VLIA 1PZ1A 1F8AB 5C9UA 2OQLA 2QPSA 3AU2A 3PNZA 2YDQA 1NMWA 3PR2A 2E0PA 5DRCA 1ZCCA 4JIEA 4U5IA 3M5YA 1GVQA 1L0PA 4DXVA 4Q8PA 3QKZA 2CBJA 3C8NA 4D72A 3WF3A 4RE2A 1TWIA 1A3WA 1O68A 1FCQA 1FX6A 3NVDA 1N8WA 3O5OA 1Q7ZA 2AQWA 5I07A 3VM7A 1SFLA 1BVWA 4IFOA 2ZDRA 2VUNA 4R27A 5D04C 1E0WA 1NQ6A 1ISZA 4EE9A 3PBWA 1K6WA 3RRAA 1M9HA 3C0QA 4P5UA 1E6PA 3ARWA 3WMSA 2YDRA 4G2DA 4ZB0A 4RUBA 1J0IA 2Y8VA 4Z1YA 4XZIA 5DCBA 4UNKA 1F74A 4F9JA 3G1SA 4FOUA 4PEKA 5A8MA 1THFD 3B3DA 1XDMA 1WZMA 1LF1A 3CT2A 5BWAA 4DF0A 3EY6A 3HN3A 2OGJA 3OG3A 4XV0A 1DJQA 3IVSA 1XIGA 2WCAA 4K8GA 2E9LA 3W2KA 1TRDA 2OELA 3EXRA 5EMMA 4AAJA 3A13A 4G7EA 3OGRA 2FB2A 4EOUA 1DWGM 1GQIA 4P7QA 4ZQMA 1ITUA 1JPHA 2QF7A 3S42A 1YBQA 1PE1A 2VHLA 4IPPA 1QOXA 1DJNA 1JFHA 1QNOA 3QR3A 2PS2A 1C90A 1MQQA 3KL0A 4EKJA 5LNVA 2X8RA 3FJ6A 3K8MA 1M04A 4RPPA 5CC6A 1C7TA 3V0UA 2ATMA 2G5WA 4CQDA 4PE8A 4GK8A 1LBMA 4HU0A 4I5XA 1SJBA 1VGAA 2YCJA 3DFHA 3INPA 4AZGA 1FCUA 3OU8A 5CSRA 3EEGA 3NRKA 3IJDA 4DJDD 1AW2A 4MPKA 5D9OA 5ENLA 4RX0A 1NM9A 2YKKA 3CT7A 2XP8A 2GQ8A 1G4SA 1Q8JA 4W85A 1CXIA 4A05A 4A3QA 3U2CA 5CPNA 3IHZA 3OIHA 2R14A 4XKMA 4P7OA 2BGSA 4DZ5A 1F6YA 1LOQA 3S9YA 1PYMA 3AROA 4Y9AA 2ZUTA 3BCFA 4HNUA 1GVIA 1XRSA 1X6LA 4JIHA 4Z08A 5AC4A 2QDDA 3SFKA 3VCRA 1U5JA 4UTWA 4GOAA 3CL7A 4ATWA 3O0FA 1AUSL 1ZLPA 2FZ9A 5HWBA 1RP8A 1E15A 3MDUA 4M51A 4IPXA 3SJNA 4RK8A 4HMCA 1PKYA 4NX5A 4XZ9A 3ATZA 4LS2A 4EAMA 2OEKA 1C92A 4ZOCA 1FD9A 2PC4A 4HYWA 4HOZA 3PJXA 4DUVA 4H6QA 1RK6A 1JCNA 4URIA 2DVXA 3IWPA 3M0HA 4PFMA 2JBMA 4GUGA 4GMEA 1BD0A 3C0JA 5M3WA 2G3JA 2XPBA 3ALFA 4NJHA 1R8LA 2P5NA 1UROA 1JZ7A 1CIUA 4GZ7A 1O5XA 4G9PA 3G6LA 4TW8A 4DZ2A 4Q8MA 4XAPA 1Q6UA 2XWEA 1F61A 1ZY9A 3QH2A 4TO8A 4ODMA 1JULA 2E6AA 1GZGA 4A3RA 4WOQA 1CYGA 1KA9F 1KWGA 3URAA 4KCWA 3C8FA 1B1YA 3A4WA 3MUZ1 1QR7A 4TNSA 2A0NA 4DYJA 4PRWA 3B9NA 4DJEC 1TMQA 2NX3A 2VEKA 4ZS6A 2IQTA 2CHRA 3I10A 1IZCA 3GXMA 4HZ7A 4O12A 3HO8A 3UI5A 1S38A 1Z69A 3AALA 1PX4A 1P7TB 2VX4A 5XINA 2DSUA 4PL2A 2LPVA 5BNKA 3MCOA 4KERA 3QZEA 5E1QA 3QZAA 4JR5A 3FDGA 2EEXA 3VIOA 2JF7A 1CXHA 3HG4A 2Z1BA 4M5PA 2RHGA 2G0WA 1GOXA 2O9TA 3TONA 1J6OA 1V5XA 4U2ZA 3KE0A 4HJWA 4KQZA 4JFUA 1TPVA 1Z42A 1TJRA 2I7GA 5FSEC 4L7ZA 1KFKA 2QDGA 1GVYA 3PB0A 1QATA 3QY8A 1XYBA 1T11A 2VX6A 1WKYA 2XVLA 4HA1A 1IEXA 1TV2A 4EWND 2GGGA 3L4WA 4F2UA 4RE3A 2CKSA 3GVRA 3RJXA 2CXEA 4JFLA 3RXZA 3WLQA 4NL1A 4U84A 2VCCA 3UXDA 2PDNA 2DPEA 4GY1A 4IL0A 1DWIM 1PCWA 2JQXA 3BSHA 1OC5A 4RZ5A 5A6LA 3AUJA 3SY1A 1GGOA 3F4VA 2I5IA 1YEYA 3ECQA 3DFOA 4OUIA 4JCMA 4PL1A 3M5XA 1LRQA 4UFKA 1IXOA 5C8BB 5IFTA 2C19A 3B9EA 2GUBA 1FRBA 4LB3A 3W88A 4MYXA 4DIAA 1HKMA 4GZEA 4Y7EA 1J4IA 4M6UA 3KCJA 5HATA 3USZA 4P8VA 3CC1A 4PMNA 4PR4A 1FUYA 4C6QA 3MPGA 1DBTA 1Q6DA 2XG9A 3SGZA 2OO0A 3MQTA 2QMKA 3SQLA 4ZE5A 3TX9A 1TX0A 2AL2B 2ZA3A 3OLIA 3A21A 4GYJA 3QV9A 3GXTA 4Q8NA 4Z2IA 5HWMA 4JTIA 4L9YA 1AL8A 2OEMA 2PDGA 4Z2KA 2WZTA 2E7FA 3G77A 3DI1A 3ERPA 1W1VA 2W61A 4ZXOA 4NZ5A 1S2AA 4PGLA 2FGZA 4ES4A 2QAFA 4GIEA 3RLHA 3CV7A 3D3AA 1OFDA 3CZLA 4IUOA 4UFJA 2WWCA 1V6XA 1GEHA 4WKHA 1PSCA 2XN2A 1J0HA 1A0CA 3N18A 1F3EA 4NY2A 2DZUA 4GUHA 3LLDA 5HXMA 1JYWA 3R10A 4P8WA 3L0GA 3AXMA 6XIMA 1ZQ5A 3HZ3A 2PDYA 3DFTA 5LGZA 2QPXA 5FJUA 3B9OA 2XN1A 4E8DA 1ONXA 4O0QA 3VM5A 4BHYA 4KFNA 4JHZA 1MEWA 2KR7A 3LI0A 2WCSA 3BJTA 2GPTA 2NZLA 3GG8A 2ZUWA 4WSKA 4E2BA 5F1UA 1HKIA 2VM8A 1Q6OA 4E4PA 4LXFA 3WLMA 3OVRA 4AZ5A 4NG3A 4BQ2A 1OZQA 4NAEB 5CLWA 4ICMA 1H11A 9XIMA 3TA9A 3GVQA 1FWIC 3TE9A 4TIMA 1PTAA 1UIPA 3TKFA 1Q6GA 1PKNA 3ARTA 4BEUA 2KE0A 2PD5A 2NV2A 1TZZA 4DZAA 4YWIA 1AH3A 3MO7A 1A5KC 4DWSC 4P7NA 1KD0A 2OQYA 4O57A 4RCXA 4A3HA 3T4CA 5AY7A 4M24A 3CZGA 1XBYA 4QAWA 1P6BA 4JTTA 5E9XA 4AHOA 3PPHA 2YXXA 1Q8AA 1OGSA 2G4JA 1KM4A 2E6FA 3GTYX 1G1YA 3C6CA 4H19A 4OE7A 5C70A 1UHVA 1V6TA 3GYEA 3VOCA 3OVPA 2J25A 2WM0A 3M46A 3HGRA 4FB7A 7ODCA 3SADA 2PRLA 4K7YA 4DJFA 1MZHA 3UPBA 1D7FA 1EGMA 4WVXA 4C60A 2J7FA 3UVIA 1SQ7A 4FF5A 1RQHA 2VDHA 4R85A 4ZFMA 3EA3A 2E3ZA 5A1AA 4WIWA 3CZKA 3HOJA 4YNGA 4J3WA 3NM3A 4DPPA 5D9PA 1DWFM 4LVDA 3BLPX 3RR1A 2ZQSA 1OYAA 2QIIA 1I9CB 2ACUA 3BPWA 2J6XA 3MUXA 1P7TA 4CLMA 4FNTA 4AU0A 4LC6A 2Y8KA 3UQIA 3I3DA 3UQAA 1KCZA 4K36A 3M0VA 3GB6A 5DANA 1VPXA 3BXWA 2HPIA 1ZU8A 5H2ZA 1OX4A 3HB9A 1H0IA 1XPYA 1K8YA 1VP5A 5JBFA 2J8TA 4CQCA 3ARQA 1OG6A 3LSCA 3WLHA 3ZSSA 1KM6A 3V5FA 3O3RA 4F0SA 3P5ZA 1S5MA 1ML1A 3N2XA 1DJGA 2VQUA 3ITYA 3AC0A 2YBTA 3VGGA 1JPKA 1EL3A 1K9DA 3GIPA 3SGUA 1Q5MA 3JYMA 5DITA 1R87A 2WPBA 3CB8A 4NQ1A 1JI2A 1VYRA 2VD8A 1UD3A 3R8HA 4Q8VA 5LHEA 4PH6A 4KKXA 3ZWSA 1R2RA 4G1NA 3GPKA 1FKSA 3ZT6A 1XYMA 1OGGA 4WJ8A 1JYVA 4U86A 4DNHA 4UFHA 1R9YA 3BVJA 5CJ5A 3K30A 3B8IA 1JUKA 1JPDX 4R53A 3OO2A 5T26A 3W1MA 4RV8A 4QIBA 1A5SA 3MP3A 3LTSA 1ECQA 4JY8A 3V7PA 4WGXA 3URQA 3R8GA 5JBDA 2R1MA 5I06A 1OT1A 2EPLX 5TF0A 2ZUVA 2I1OA 3HV8A 3F5KA 3SUSA 2ABAA 2ZQUA 1Q7MA 2L5HA 4QBXA 2YCKX 2VD9A 2X1UA 1YNPA 5U4NA 2XGZA 3BQ5A 3ITVA 4C6PA 2PV3A 3R0UA 1B4KA 2A6LA 2G3FA 1EBHA 1N82A 3AS3A 3REQB 1KCLA 4GLEA 1TV5A 3TC5A 2YL6A 4CD5A 1A53A 3A23A 1W5QA 4B90A 2YOCA 4MDPA 2XISA 3VE9A 1ISVA 2QCEA 1F40A 1EUAA 1TPFA 2CLFA 2Z1KA 3IGHX 4LYQA 1TO3A 2NT0A 4GIAA 1NEYA 3LXCA 3LPOA 1KRMA 4XO7A 5AKQA 4DBEA 2PDWA 3SCRA 3URNA 1QPFA 1Q7QA 4R9OA 5LNWA 5FJJA 3ARUA 3ZR5A 1W9VA 1PVNA 1UIOA 3UCDA 3WMBA 1T0OA 3SO7A 2A6NA 3APGA 1NDZA 3RM4A 3ARYA 2I14A 2NXHA 3NAVA 5DX7A 2AWGA 3FFSA 1KB3A 2ISSA 1EPXA 2AGTA 3P2VA 1FJDA 4CQBA 2EPKX 1C29A 1W9XA 4K6AA 4P2VA 1K9FA 3BARA 4ADSA 4PRTA 2CLMA 4FNRA 5AC7A 4ZSTA 3E96A 3SW6A 1GQNA 4PB4A 3VNZA 2QVNA 3PF3A 4HU4A 2Y70A 3UI4A 4Q4SA 3O6DA 5A2AA 3LCFA 3K1GA 2WMHA 5DFAA 3ZZ1A 1LL4A 1M41A 3QVQA 3PPCA 4LX4A 4ZCWA 2VWSA 3ZS4A 1E70M 3MZNA 3A12A 1XLEA 1E0TA 4P7RA 1L2UA 3U7BA 1OINA 4LALA 1FKJA 3WQOA 3EX4A 4D8ZA 4ZO8A 1E0XA 4DRJA 4JTRA 3L21A 1BWVA 1M6JA 4H8VA 4AWTA 4J7RA 3W73A 4LF2A 1OCJA 3OODA 1VBRA 4J9JA 3AS0A 1D2KA 1K6AA 5GJMA 2MNRA 1TCOC 3FJ4A 1XICA 4NU7A 2OX1A 1LQAA 1S5WA 7XIMA 4NI8A 4JNMA 2ZRYA 4LV4A 3Q58A 4LUYA 1TKKA 3R94A 1VKFA 5DCEA 1XC4A 2HBXA 4M1BA 1W2PA 2YR1A 1FWTA 2YB1A 4OVXA 2I5QA 4JGDA 1SSDA 4S3GA 3P0WA 1JDAA 4HIBA 4I3GA 4WZHA 3BCJA 5IBXA 3P61A 4H7CA 2EPNA 2GWNA 3OLDA 1P5BA 1GQJA 1UWUA 1F5ZA 1XD0A 3F2DA 1EB3A 1G5AA 4R88A 4J3SA 1VHCA 4H9UA 4DB7A 4DUOA 4ZB2A 1XLAA 1L6YA 3C61A 1NOWA 3PN8A 3CTTA 3N11A 1V79A 1NMVA 3SRKA 1H3GA 2W9MA 4OOZA 1GKQA 3HIJA 1VEPA 4FI4A 2G96A 5CAKA 4LY4A 5CPTA 1T96A 1IQ8A 5F4WA 3FVMA 1K1DA 5HW7A 4LJ3A 1MRAA 3U9IA 1P6WA 3MC5A 2VOTA 4P8UA 1I2QA 3OGVA 2PGEA 4BI7A 4E2DA 1CNVA 1YPXA 4MSSA 5FF3A 2IS7A 4ODQA 2BOEX 2PFHA 2GQ9A 3BZGA 4IJRA 4QCEA 4JICA 1IV8A 8TIMA 3K4WA 3W7JA 3AU6A 4EP8C 3O5RA 1TZ9A 3QYSA 4FX7A 1H50A 4BK9A 1ZK6A 2YZ5A 1K3UA 1VRDA 4NF7A 2B81A 4RE0A 3PA7A 4FEZA 1FKBA 2E68A 3IJ7A 3KP0A 2DIJA 2J7HA 3NOYA 3DBNA 2Z1SA 1LUCA 3J7HA 4O16A 2AGKA 4JIRA 1G4EA 2FZMA 2YL5A 1OC7A 4JHOA 1OB0A 3CHVA 3THUA 4G56A 4MNMA 4MJZA 4OT7A 4PUEA 1BQCA 4PCFA 3T42A 4S3AA 1P4CA 1FWNA 4IGMA 3VNIA 2WNNA 2EO7A 1RSCA 4CNUA 4LAYA 5CXPA 4GD0A 6PTDA 7TIMA 5HUAA 4AW7A 3L67A 3EZ4A 5D38A 4O2TA 2EXOA 3NPVA 1WXJA 4NX0A 4IG2B 4MHBA 2ACSA 1KFLA 3L4YA 3ALGA 4S3FA 5CSYA 3E0IA 1QASA 2Y88A 1CI1A 3EDEA 4K38A 4R3UA 3PP7A 3VVGA 2O9OA 4NSBA 5JH2A 4Q8WA 1E5JA 4RW3A 3H7VA 1XS2A 5H1WA 3UZWA 1OFRA 2ALDA 4PBGA 1SMDA 1W8GA 1J5SA 1CB2A 4M7SA 1E72M 3K13A 4Q32A 2Y24A 3VI2A 3QR0A 4A8RA 2WZEA 2F7FA 1KV8A 3PJWA 3MB9A 4DYEA 2GQ3A 1A3HA 3SZ8A 3BURA 4HZ6A 2FIQA 2IMRA 1CGTA 4MNJA 6A3HA 3MKCA 3W72A 1ZPTA 2QW5A 3W1UA 4WQ6A 1OT2A 4HGXA 1GVSA 1DVJA 4FZIA 2Q09A 4J4OA 1LBLA 2GJXB 3VDGA 3GC5A 3VNKA 4IUGA 4P61A 1NF0A 3KLKA 2D73A 1AA1B 3VOIA 3UNTA 1M68A 2GVJA 4V28A 1R6WA 3KOWA 3A3HA 1L8NA 1XGEA 3ITOA 2FTYA 5HAOA 3IAQA 1VFHA 2ZRUA 1JAEA 4Y9PA 1PJ9A 1H7OA 1XC6A 1AQ0A 1V08A 1E6XM 1IWAA 3W1NA 4W4QA 2A3EA 2X41A 5HUPA 4HA4A 3T1GA 4PMXA 1J10A 2PP1A 4LUSA 3NQ8A 1L6SA 4BF7A 1IGSA 1EQ3A 1VFSA 4RXGA 3S4TA 3BQ6A 1EPVA 5E9AA 2NXGA 4LBUA 1HTIA 1JZ5A 2ZKMX 3ZJ7A 1LL6A 4UTKA 2CKRA 4JX4A 4U33A 2Z4GA 3WEMA 1N7KA 3W85A 1W31A 5I3DA 3XIMA 2Y4SA 1AW1A 1SZGA 4LNCA 3MWAA 3TWAA 3SN1A 3WLPA 1M3UA 2FKPA 5ECUA 5I0DA 1L2QA 3LM3A 2FVMA 4IXXA 4B3LA 5HDRA 4XZMX 4J3TA 1XIMA 3E38A 4J3ZA 1EQPA 2C13A 3P3BA 3SN4A 1Q85A 1GORA 3MTWA 5A95A 4X61A 1VFMA 3LMYA 3W1LA 4MNLA 1JUEA 3M0MA 1IR2A 1TRIA 2Z1VA 1G9HA 3ZT7A 3H26A 3LUOA 1K9TA 4TW6A 2QJJA 2BFGA 3MSYA 1RA0A 5FF4A 1VF8A 4FR1A 4J2PA 3F5LA 3W3OA 4PZVA 4TX0A 2V67A 4MB3A 3NO1A 1ZTVA 3IKGA 4NKCA 3RMJA 4A8IA 3M9YA 1KBJA 4HHLA 5F4SA 1YX1A 4PMOA 5HPCA 3VNMA 1AZ1A 1G4TA 2DT2A 1AMKA 4FX6M 1ONWA 4GYPA 2VO5A 3H4GA 1FKHA 1EDTA 1UA7A 1FCBA 3FAWA 3W83A 4NASA 4GY7A 3AYTA 3W00A 5HWNA 1YW5A 3DYOA 4QEEA 4JFKA 1EUNA 2D3LA 3QYQA 3OHMB 2JEPA 3EKZA 5F2GA 2J7CA 4AYGA 4Q8OA 1QW8A 2ZRZA 3OOQA 4UTFA 4Q4QA 3T44A 2BZNA 4JYDA 2E8YA 2ODOA 3EB4A 3ZLFA 5KZDA 4E8GA 2D2OA 4FLSA 3O5DA 3Q45A 4MVAA 3NL3A 2ZWYA 4IM4A 1EHAA 3BJSA 2CHOA 4WD0A 1ZCOA 2OOFA 3JZEA 1MSSA 2ZR6A 1EA9C 2Y0FA 4HPGA 2L2SA 3C2YA 3IIOA 2PDBA 3ATYA 3WFZA 2Y78A 4K37A 1Z3NA 3R13A 2VR2A 4KGLA 3E02A 2VURA 2Z7GA 3MCMA 1GG1A 4XKYA 5BYWA 1W9UA 2XP3A 1K7FA 3MVIA 5E93A 4XUGA 2ZCGA 1Y5XA 3WDHA 1VH7A 1Z7AA 1GVFA 3LCHA 1VHNA 3NGFA 3M1ZA 3OZPA 2FKEA 4DZ3A 1X7FA 2X42A 1FHUA 3Q67A 3S6DA 4IX2A 4DAFA 1UKOA 4UQDA 1LLZA 1KRCC 1FWDC 3C2FA 1UBPC 2CCRA 3OEXA 1VIWA 2DQXA 1FFRA 4FAPA 2V2HA 4DRIA 3TTOA 1E6SM 2ATSA 1Z8AA 2BXZA 4HKPA 1CECA 5A6MA 4IP4A 3ABZA 4GQGA 2UBPC 4Z42C 2XP6A 1WO2A 1RQBA 1KBLA 1JNSA 1J2WA 2BHZA 4LOCA 4O53A 3T0TA 4PMQA 3PAOA 3EOUA 3ANYA 4QQUA 4GIVA 3GHUA 3OBAA 4PB3A 2XVGA 4IICA 3GRIA 5I2UA 2QGYA 1GWJA 1TZ7A 3WDIA 1H61A 1QUMA 4DH0A 4E4FA 3NVTA 1E0VA 2JGQA 3VDBA 4S3KA 4O1CA 5D05A 4PUWA 4KR0B 1FDJA 3KM8A 1G7UA 4GNVA 4C6LA 4E6MA 1HKWA 4DX3A 5H91A 1XX1A 3APYA 4M8UA 1B3VA 3M0IA 2BV9A 1OX5A 2V68A 1FWEC 4PB5A 2OLHA 4LB4A 2BY1A 2ZZ3A 2Y2WA 4KGJA 3FEQA 1KTNA 2WZHA 2GGEA 3A9BA 3O2LA 1XINA 2MUCA 2X2YA 4C6KA 4RDYA 1GOMA 3UJFA 1TV7A 3IV3A 3PRDA 2VGGA 1FKXA 3QOMA 4AD1A 4QJ4B 1VC4A 5FKYA 4CD8A 1P0KA 5D30A 3QN3A 1QI5A 4NJGA 4RNHA 2ZQTA 4GZIA 1W9PA 1HIZA 4U28A 3HPAA 2VGBA 1YE6A 3UESA 4ATLA 4MFEA 3WIJA 4HVXA 2PSNA 3OIXA 3IJ9A 2DVTA 2QCDB 3BMVA 3EX2A 3OLGA 1BYBA 4GVFA 1ZBVA 3SCWA 4RZ6A 2E1DA 3PZ9A 5I3KA 1VYPX 2ZBTA 1TTQA 4K3ZA 2WANA 4YHEA 1UMYA 4DI9A 5I09A 4GXMA 3WD4A 4QHRA 2J75A 1Q45A 4HD5A 4ZZ9A 3NEVA 4JDBA 4N4PA 2FMNA 3G1VA 1J4RA 2YXGA 5DXYA 4DROA 1XIHA 1PX8A 4HT3A 4LS1A 4O8RA 4FOKA 3QC3A 4UMBA 4DNMA 2QMJA 1AMYA 2INFA 2VC7A 3KOFA 3SRDA 4LYPA 4XAZA 1NWUA 3ZJKA 1X8FA 2V5LA 2QR6A 1UZ1A 3TWBA 4DRHA 2WO5A 1CT5A 5J5RA 1W1IE 3UR7A 3WNMA 3JU2A 3LBOA 1Y5WA 3V3WA 1RR2A 3MV01 4DO5A 1HQTA 1G01A 3W1AA 4JTGA 4NUWA 1EH9A 3MY9A 1E71M 5I6SA 4TX6A 4H9ZA 4W86A 1NWRA 3W6YA 3VZZA 3BG5A 5HUOA 5CH9A 4LVFA 2BY2A 4KIRA 3RGCA 3BSGA 1EO5A 4GXPA 4G8TA 2E77A 4Q4MA 6ENLA 4WEVX 2VCAA 3VKDA 2ZUSA 1A5MC 1ALDA 3TDFA 3O5PA 4Q8QA 4QG6A 1HXVA 3S5YA 1EJUC 3TJXA 1XBZA 3VNDA 2W63A 4GACA 4RR4A 4AIOA 3F4NA 4GHRA 1L6WA 1POJA 1XYAA 2V0TA 1R3SA 1RPKA 1R38A 1UWQA 4F66A 3P81A 4F40A 3B8SA 3NCOA 5HR6A 5D8ZA 3WX7A 5FJPA 4MTVA 4BQ5A 4KFPA 4L61A 4CN6A 4QEHA 3KL5A 5K9XA 2HCVA 1QT1A 1ODZA 5LA2A 4HNOA 5BZAA 4L1XA 3R79A 2PN0A 4TTUA 3VGHA 3QPEA 4MB5A 1UD4A 2J4GA 1TE1A 4JN7A 4V1YA 5D32A 5D9NA 1ADSA 1T8QA 1NVMA 4BI5A 1E4MM 3GY1A 4GJIA 3STFA 2VVNA 5E6ZA 1GQLA 1XYCA 2P3ZA 5HMEA 1SGJA 4GC4A 4ZODA 3VA8A 2NX1A 4PCNA 4AIEA 3TSBA 2BGQA 2PF8A 3AYVA 1TV3A 3EDJA 4QSFA 4B3KA 2QCHA 3DOPA 3VDAA 1EF2A 5FACA 2DSWA 1BXNA 4K68A 2WPGA 2ICSA 1QWKA 1MDLA 4X22A 4PUNA 4JQ3A 3LTYA 1RHCA 1DJZA 1D9EA 1PO9A 3PFRA 1YNYA 2Z29A 3NR0A 4ACZA 5M2FX 4L4MA 3RIKA 2WKJA 2VKZG 4LQ1A 1NF7A 3UWQA 4O17A 3AMDA 1WZAA 4V2XA 1CW2A 3WEZA 4CCDA 1EEXA 2DJXA 1EP1A 1ZB5A 3RR4A 1QZ2A 1Q1CA 2GJLA 1ZRQA 2DZPA 2PLKA 2XIQA 1YXYA 1LL7A 2VVSA 2H90A 4CU6A 3GNNA 3H21A 1PBGA 4QR6A 2ZX6A 1V3MA 2OG9A 3SCUA 1UCWA 5IXEA 4ZTYA 1H7NA 5I78A 3UWYA 4PBFA 4UFIA 1V51A 2Y89A 5IRPA 1AG1O 1H49A 4IG2A 3B06A 4MSPA 3QF0A 1DE5A 1D8CA 2GK1B 3C0LA 3NA8A 1CBGA 1LRNA 1NARA 2IXVA 4MPQA 3R43A 3A47A 3MU7A 4LUTB 1OJXA 4RXFA 3GU9A 4D71A 4TMBA 2QGHA 4ICCX 3ZVHB 3G1HA 3WLRA 1ELSA 3BUVA 3HBLA 3KCLA 4JXCA 1W5PA 1PS9A 4H9XA 2YLLA 2PBOA 4L6OA 2YA2A 3E9AA 2BOGX 5BU9A 1DWJM 1QU4A 3NWRA 1ZUAX 4UB9A 4ZO6A 3WJSA 2R82A 3TQPA 4XVDA 3JYJA 1BQGA 1PV8A 1Z9AA 4I9MA 5CJMA 3LV6A 2H8ZA 2PWDA 4HZ8A 2OLSA 5EFDA 3MO4A 3AMKA 1W54A 1BKSA 3FIGA 5D75A 2XHYA 4QGCA 2B4GA 2ZUMA 5A6AA 1SO5A 2X0YA 1RUSA 2C0AA 1F9CA 1NH6A 3BOLA 3GFZA 3LUTA 3A22A 4TU1A 1MEHA 1XCXA 3GKFA 4EPBC 5BU6A 3W74A 2O55A 1CLXA 3EB2A 4H83A 4OUEA 1EGZA 3FN9A 1KFEA 3GZ3A 4HNCA 2ZZ4A 3RLGA 5A6SA 3TN4A 4Z2HA 4UOJA 3VNYA 2ZE3A 3WO8A 5A6BA 4R0XA 4JX5A 2PF0A 1B3WA 2TODA 3KAOA 1E4IA 3LENA 1C8VA 2F4EA 1C7SA 1Q6HA 1PB0A 1NQKA 5A6BD 4C1LA 3UI6A 1JGIA 2OEJA 4QDMA 3W38A 4X0VA 1JZ2A 4ONVA 4AEOA 1I4NA 2X1TA 4JZ5A 4GIYA 2OQHA 3VIMA 3V1PA 3PZGA 1KRAC 3E1F1 4RE4A 4KEVA 4QRNA 3UZZA 1G4PA 1XLJA 3II1A 1K03A 1A4LA 1AD4A 2V81A 3W7GA 3WBXA 3M0XA 1X7IA 1Q65A 4HPJA 5EB8A 2DDXA 2WKLA 2HS8A 3GWQA 4L80A 4Q33A 5EBUA 4MZ8A 1HJVA 4MY9A 1UWAA 3T08A 4RKAA 2JZVA 3E6EA 2HMCA 3N2TA 3KAHA 5K9CA 4O54A 3BGJA 3EMZA 1YIXA 3DYMA 1YDNA 1JCMP 1E40A 3IUHA 4LAXA 1QPQA 4LAMA 5CLTA 3C2VA 4LAKA 3GVWA 4Y90A 4PMDA 4ACZB 4C6OA 4DRNA 1PTGA 1IX5A 3VUSA 3ARZA 4LUIA 1TR1A 5A5WA 4YTRA 2XWDA 3KAFA 1SVDA 2HWGA 4IFKB 4TXEA 3VFCA 1IEQA 4L1GA 2GGJA 6REQB 2FHBA 3BANA 4B5UA 1J0KA 1XYZA 3IIXA 4AD3A 5DBTA 2G50A 1JIBA 4QE4A 5C55A 5KITA 1JAKA 4NJKA 1MXDA 3CHFA 1XCFA 1JNEA 1VR6A 1GQKA 5FJIA 5HNNA 4JKLA 3U8GA 2WV8A 3CO8A 1VYSX 3TCSA 2V5DA 4GX8A 4UIOA 1W1ZA 1WDWA 3CMJA 4IGSA 2Q3OA 5DT7A 4FNSA 1PXGA 2X1IA 4FHAA 5HW8A 4ODLA 6ALDA 3W6LA 5E6YA 3LBMA 3KCOA 2DORA 2A79A 1SYTA 1QRQA 4WXZA 3TH6A 5A69A 4GKTA 5IHRA 4MUPA 1DL3A 2G95A 3WUGA 1XP3A 3DERA 3UJEA 1ICSA 3NL5A 4C90A 1BEUA 2WMGA 3QFEA 1MEIA 3PRAA 3QW3A 1X6NA 3SECA 2WWDA 3STGA 4O0ZA 2D3NA 2W92A 1H63A 4IFRA 3S83A 3ZJ6A 5DMYA 4MZYA 5E09A 4H9YA 1T99A 3UZYA 1AVAA 5FAJA 4F79A 1MDRA 2QJHA 3MJMA 4Z17A 1JL8A 2ZFAA 3GNXA 1EC9A 1S46A 2OPJA 1FTXA 4W87A 3C86A 5AHLA 4HYVA 4WY0B 2VFEA 5DQPA 4BKNA 4AMCA 1D3CA 3DI0A 3Q2DA 2D22A 2B7OA 3O5FA 2PC8A 3SIZA 4I8YA 2NQZA 5D03A 3K4DA 2NW0A 4MAVA 1KTBA 2QUTA 3TC7A 1W1TA 1SJCA 3C2EA 3RAOA 4QAIA 2E5BA 5HQLA 4TX9A 3UWEA 1LT7A 4J5NA 1MW3A 4JQ1A 2QCNA 1CGXA 1ISWA 3C2OA 1WAWA 2M1IA 2CZDA 5AC5A 3VKJA 2DZBA 1JYXA 4JFSA 3PS7A 1UD5A 3MWCA 1V6WA 3ABRA 1V6VA 4C1KA 2PTZA 4BCEA 3SUTA 4E38A 3DCPA 4ODOA 3WQCA 1HT6A 4LV9A 3KAIA 2ZWZA 1VS1A 4Q4PA 3EPNA 4XSLA 4BJHA 2PBCA 1Y7VA 4CVWA 1KM0A 4C6BA 4HZMA 3FOKA 2Y5SA 3O6YX 3BAXA 2NSXA 4REQA 2FPYA 4DRKA 3GDTA 1U79A 4O4WA 1NDWA 5BMWA 3AWNA 1UC5A 3AS2A 1FKDA 4WDTA 5EYWA 4HOWA 2Z1XA 2F61A 5FF2A 1KXHA 1ICQA 2FPTA 1Y8BA 2EKCA 2W6RA 3KADA 2EG6A 4B4HA 5HKGA 3OZYA 3ENLA 2R1PA 3TW9A 5T91A 4HNLA 1F8IA 1UMLA 1IEVA 3LNMA 1CLKA 2BP1A 2A5HA 2XYLA 3E2QA 5A8OA 4QS5A 5AYBA 4H6RA 1XIEA 4WGHA 3L5LA 3E2SA 3WL0A 4NZFA 3QLLA 1UW9A 1VRXA 1YKWA 4XTDA 5D2TA 4GI6A 2WQDA 1W1PA 4R34A 3FXGA 1J79A 2Y5EA 4B5SA 4D6JA 3MUIA 1XRTA 2Z0IA 2CLHA 2HE5A 3SIMA 3QPZA 4ODKA 2VDGA 1I75A 3SQMA 2F84A 2KFWA 4G7FA 3CHEA 2DV0A 5CC3A 3IJ8A 4AX7A 5I77A 1E73M 3VKAA 4S39A 3SDOA 1K7EA 1H51A 2CITA 1JXKA 1CPUA 3WLTA 1T40A 1ADOA 3NTPA 4GC3A 3WN6A 4KBXA 2Q6ZA 3WL1A 4NJIA 3GNPA 3LLFA 1ECEA 2DY3A 2CLEA 1LQ0A 4RL3A 1QVBA 3UT0A 1FDZA 1ROTA 3GG0A 4B2DD 1U83A 1XD1A 2WJFA 3BMBA 2ZX9A 1L6FA 4G5DA 3EWZA 3GG7A 1XLCA 1XYLA 5I7GA 1GZJA 2D2HA 3K4AA 3CUIA 3UG5A 3ITLA 3RO6A 3Q4DA 5LA0A 4LCQA 1GT8A 2DFAA 3CO4A 4HCLA 3C3UA 4EPKA 1V7YA 4FNQA 4JCLA 1W5NA 1XISA 5AN7A 2DIEA 1HJSA 1EZ2A 1GOWA 3N2MA 3W2JA 6REQA 4M0XA 5A6JA 1S1RA 3VNLA 1M03A 4Q3MA 3NUKA 3UF9A 3DHUA 1NWTA 1X97A 2GSHA 1WOBA 4AF0B 4FR6A 3RITA 4WUIA 1VFTA 3QY7A 1VLWA 5LIWX 1OY0A 2XDFA 1ZAJA 2QHAA 4H41A 4S2CA 5CGQA 2WC7A 4IFKA 5MF5A 2YCIX 3TQ0A 3NL2A 4EXAA 3VGBA 4B91A 1E43A 4FNPA 3C2RA 3WENA 3EOSA 3S47A 3OLEA 2ZTKA 2NQLA 3UR2A 3R6IA 3OPSA 4J4KA 5DMLA 1OVDA 1R7AA 5EA9A 1ADDA 5BROA 2Q5AA 5HMSA 1ME8A 2Q02A 1XHGA 3CJPA 3SEPA 4KWOA 3KBVA 1KFBA 3UWVA 2XP4A 4IIEA 4Q6JA 1W56A 4XX6A 3LMZA 5EMYA 1CGUA 3GBDA 3K46A 2PPPA 3SR7A 2XSXA 4FLRA 3CMGA 1CZ1A 5CSUA 4LEQA 5LGXA 4TYOA 2BVYA 1B54A 3CNYA 1TFVA 1DE6A 3T2OA 4DO6A 1AJ2A 1UA3A 2ALRA 1LUCB 4MMWA 3TMQA 2TSYA 1B31A 2DGAA 4H9MA 4EPEC 3ABOA 5HTGA 4N6EA 2PPNA 2QCDA 2TPSA 3DAQA 3VGDA 1H7WA 1LLWA 5AHMA 4WX2A 1JNDA 3I4EA 4CGTA 4OWGA 1B9BA 3TCZA 3L23A 1R9ZA 1UP3A 3E5BA 2FDMA 5G1MA 4LFYA 2RFGA 4QM1A 1JCXA 2POTA 3NZRA 5KSWA 4ADUA 1A5BA 3AJ7A 4I8DA 4J28A 5E0CA 1DTNA 4FOJA 1OFBA 3ITTA 1KR0A 2XSAA 3LRLA 2PDXA 3UEQA 1W32A 3DU0A 5LKYA 4AMAA 1WKFA 3QEZA 1N1AA 5BW6A 4Y9NA 3AMGA 4PCSA 4R7WA 4OQVA 2OT0A 4AHQA 3N9SA 1R0MA 4B5TA 4HARA 2BY0A 2GL5A 1J4HA 1QPKA 3QV7A 1LROA 2K8IA 1GNXA 4LTSA 4HNVA 3MMTA 2KGJA 3RFAA 1EEPA 1QI3A 4I7VA 1D7JA 4FAMA 3HQOA 3N6JA 4KCTA 3UU0A 4WXYA 2E5DA 1UUQA 1TUXA 2PGWA 2REQB 3WCZA 4IH3A 3B8TA 4UZUA 1TWDA 4DJFC 4AYSA 2BXVA 3KEHA 3NQAA 2YLAA 2DQWA 5GQBA 3WNKA 4AQLA 3N2CA 1JPMA 4W9PA 1ZJBA 2D69A 2Z26A 4HHHA 3EDFA 4LVGA 1EJSC 3PWAA 1UKTA 3BLFA 5DN1A 1FKTA 1A4MA 2X40A 1HL2A 5AVNA 3T7VA 3MW7A 4Z2JA 1F3WA 1Y0OA 3BMXA 1PINA 4KCVA 2PDQA 1EP2A 3NQ7A 4CD7A 3T0DA 2VZOA 4V1XA 1KO0A 5TIMA 4D6EA 5HPOA 2V3EA 1OK4A 4CCZA 3BTNA 1FDYA 1O5RA 3W7RA 3AIBA 4N7QA 3MANA 2OX4A 3T2QA 3TP4A 5ABFA 4BS0A 2DJLA 3QPYA 1ZNNA 3UY8A 1E6NA 2WMFA 2PRMA 2ZA2A 3VD5A 3HG3A 4ICNA 3KS6A 3PG8A 1Q6EA 2VELA 1QBAA 1XLIA 2A4AA 1MO0A 4REQB 2G3NA 4FS9A 4QG8A 3VGEA 2ZUUA 3G0XA 3FGCB 3SFWA 3QQ1A 4A35A 2WNWA 6CGTA 1TREA 4FXRA 3BE7A 3N4AA 4QQ3A 3GNRA 3IKDA 1NY1A 4ZPWR 3VOJA 1I2PA 4QG9A 3WZ0E 2FAPA 2WKGA 3WLNA 1X6UA 3V16A 4K8HA 3WMLA 3EXSA 1CTNA 3EXTA 3KOZA 5H8MA 1FP8A 2VL4A 3WFLA 4E3TA 4DXKA 4J2MA 3ONCA 4AZBA 3BLDA 4O50A 1C9WA 2HNHA 3WLSA 3W7QA 3V5CA 2EHHA 1B5TA 2P4VA 1RLDA 1YTEA 3G8RA 1B9ZA 1WQ5A 2BSLA 3BG9A 5HANA 3IRSA 4GCXA 4JOMA 2VGFA 1KBIA 4QLKA 4D2JA 1GYMA 3EBVA 3ZQ9A 2CEQA 1T5AA 2P50A 3WF2A 2RSEA 3LSBA 2E1WA 1W3HA 2HZGA 4QLLA 1VJZA 3H7UA 2D0HA 1IEIA 2PPOA 4IQLA 5KINA 3DHDA 1K02A 3W75A 3GNDA 4JTFA 5GNYA 1V3HA 4IMGA 3THCA 5XIMA 2WJZA 2PTWA 2ZZ6A 4CUCA 1IIHA 2OYMA 4PN2A 2AQOA 3CMFA 1EQCA 4H01A 3KVKA 2OZTA 3LM7A 2RJHA 1TMHA 1PDZA 2EBNA 2A85A 1M65A 4WLCA 1QO2A 3VCCA 1KXTA 3IJLA 4JTLA 3CZ8A 2CU0A 3VIJA 3W53A 4DBDA 1DXFA 2RGMA 2FZBA 2LJ4A 4O52A 2ZTJA 4GYPC 3PRBA 3SQSA 4JY9A 2P10A 3W81A 3LTPA 1LLOA 4XK2A 1O95A 1R3QA 2VQTA 1H1ZA 3Q94A 2W79A 2ONEA 1W26A 2XINA 2V9DA 2WMIB 4ZQNA 4A29A 2H3BA 3OA5A 1IGWA 4WKAA 3CL6A 1FXQA 2V69A 4W84A 3HU7A 3CUGA 3GXPA 4WKFA 1UKQA 5JH1A 1V7AA 4ACYA 4J3XA 4JIIX 4TVUA 4ERIA 5A6KA 4PTNA 4GXWA 2V3FA 4KH2A 3PY2A 4A2RA 4XD3A 1YYAA 4XWUA 3R89A 3Q65A 3QY6A 3CU2A 4M6QA 4MYAA 5BOFA 3GU0A 1GPFA 3UW6A 1XKYA 1ODUA 4JQ2A 4A22A 4U5KA 3P7YA 3NPWA 4XO6A 1X8CA 1V0MA 1J2BA 4CCEA 3PBGA 3PZVA 3QRHA 1Y65A 4HTYA 2XN0A 4DF2A 3O5JA 4IT6A 3WJYA 3P80A 2WHJA 4ATDA 1FWWA 2ZR5A 2C0HA 3TTSA 5F4XA 4MJMA 3TC3A 1JG9A 3GH4A 3R0DA 4HBOA 4KEMA 1DIKA 2V38A 3O16A 5T9BG 3E5PA 3IARA 3BLEA 3LQLA 4W8AA 4DEFA 2VCBA 1UPPA 3W82A 3QQ0A 4O1AA 5AB3A 1KM2A 3W7NA 4BF8A 1RBLA 3SRHA 4GKLA 1RJQA 5A2BA 4M1RA 3O6CA 4EXQA 3ZR6A 3CQIA 2E9MA 3QHMA 3MSGA 2C3ZA 2OSYA 2YL8A 3MI6A 3T8QA 1WDQA 3KRUA 4DRMA 7TAAA 1ISYA 2NXIA 2PDIA 2J8GA 3MKKA 1QNQA 2W5FA 3KP1A 3L0NA 2UZ9A 4Y6GA 3HTWA 2XP9A 5BXSA 4LY8A 3UJSA 5I3JA 5B7ZA 3ABXA 1YPIA 2Z2UA 3QSTA 5H6HA 1ZJIA 1UP0A 1C91A 3LBCA 2BY3A 3L65A 1MQRA 4N0RA 5HJLA 4PCPA 4A3YA 3W01A 3SCQA 1DHPA 1I0DA 3SCSA 2E9BA 3FA4A 3S46A 4X63A 3UBPC 3TLLA 1OIMA 4DF1A 4L72B 2FH6A 2Z2AA 3U2ZA 1HW6A 1HKVA 1HP4A 1RPXA 2WNQA 1XIFA 1R85A 4D9PA 4GI9A 4FO4A 3O5QA 3BOXA 3VOHA 2C16A 2WLYA 2Z6IA 3WMCA 2X09A 3NXLA 1UWRA 1E5NA 1PKMA 1FXPA 1IHIA 4GPNA 1UH4A 2QZRA 3WUFA 3FKKA 4QT3A 3AYSA 1WV2A 1OM0A 3AIWA 5ABEA 2ISDA 2XP5A 3LHWA 1IT0A 3CGTA 3DC8A 1SW7A 4PSRA 4MKNA 4CU7A 2J62A 3IPWA 2Y7FA 1DIDA 2PWGA 4JTAA 4PUDA 3RILA 3TYDA 1VFUA 9CGTA 2LLEA 1FKKA 2VNCA 2PZ0A 4ZXLA 1O1HA 4ECLA 3O63A 1MW0A 4TUFA 5FI8A 3RRXA 4X60A 3O05A 3M16A 2ASHA 3PM6A 2ZQVA 4YU1A 4HA3A 1US3A 2QCGA 2QNEA 5F1VA 4LVBA 1S2UA 3VPLA 2X7VA 1A0EA 1VBGA 5D2WA 2GOUA 4UTWC 1SSGA 4EVZA 4OU1A 4LBSA 4KWSA 4RZ4A 8XIAA 5FOOA 2PV2A 1MFUA 2V5KA 1J9YA 3B4UA 3W76A 4J3VA 2HK1A 4WJXA 4L6HA 3M6DA 1SO6A 4LUJA 1PX3A 1NIUA 2IPGA 4IQDA 3FNDA 3G24A 2JE8A 2PDMA 1CXEA 4Y8EA 4O1DA 1J4EA 1UR3M 4MLJA 1UR0A 4QCFA 4GWEA 2HROA 3IJQA 3FKRA 2DEPA 4UQBA 2MANA 4G50A 2J27A 2E5CA 2DG3A 1A3XA 2OZ0A 1A5LC 5G1TA 3K5XA 1V02A 2EG7A 3O7UA 3B05A 3N14A 2OLAA 5BXJA 1G7VA 3R8RA 3PBVA 1AJZA 2VOMA 4KWVA 5IM51 1EX1A 1SO3A 4DJDC 1WP6A 1CX9A 2ZZ5A 2ZXDA 4PUUA 1XH1A 4N9CA 3AI0A 3NYDA 2NX9A 3RCNA 1AL7A 4PUMA 4AFYA 4MY1A 4E8CA 3VIFA 1P1XA 3VMNA 4PA8A 3AIEA 3TJ4A 3LGDA 3WQFA 2J24A 4PUJA 2OODA 1EIXA 9XIAA 4O18A 2KI3A 5D02A 3R0KA 1I2RA 3QMTA 2H8XA 1GHSA 3WK2A 4A6GA 3ORWA 3LXAA 4D8LA 1JDFA 2IXUA 1BHGA 5KZMA 4IMEA 5FIPA 4C6EA 1Q2SA 3PZUA 3QLDA 1BF6A 4LYKA 5AOUA 2EJ1A 2XJ7A 3DDMA 4NI3A 2JGYA 2PBGA 5A94A 4C5YA 3VU2A 2ISWA 4KFOA 3GX9A 4OGZA 3R11A 1QHZA 2NUYA 4JEQA 3HGJA 1W3JA 3UG3A 1XH0A 3TQVA 2O9RA 1JJKA 5L6UA 1XCWA 4MGGA 2Y61A 5FESA 2J47A 2IQ0A 3LK6A 4W7VA 2AKZA 3BSMA 3WH9A 4XBKA 3N3TA 2ZVIA 3RYSA 1P1MA 4HNNA 3H6OA 1WXYA 5AYZA 1ZBKA 4JBRA 3CH0A 3PTMA 1TPEA 2E67A 2HQAA 4Z1CA 3CGNA 1KXVA 5TD4A 1XJBA 4QX4A 5BRPA 4A4AA 3GDLA 5TBOA 3AO0A 1UH3A 3DH7A 2VEGA 1AQFA 5E0FA 3G6MA 3EEZA 1XLKA 1OGBA 1M5WA 3JUGA 3WQEA 4TV6A 4JTQA 3GQYA 3PSWA 1OYCA 1C93A 1EDGA 1QK0A 1IT8A 5DRIA 3SUVA 4LPCA 2XU2A 4MGVA 8RUCA 1R3YA 4AXNA 5K4XA 1X1ZA 1NTHA 2PTXA 3HQ1A 1XWYA 3NQEA 3SSJA 4BI6A 3H2MA 3NDOA 4NRSA 4MDOA 3LLXA 3PTQA 3D47A 3RPDA 4AZIA 1F6PA 3A9IA 5EY5A 1V6YA 2V63A 1TIMA 3KRZA 2QVHA 3B97A 5KTLA 3PPGA 1WBHA 4Y9MA 3WY1A 4O10A 3VIPA 2G41A 3I7QA 4AEFA 3XISA 3M64A 2V3GA 3M43A 3WH7A 3JS3A 1WX0A 3KX6A 3P82A 4B5XA 2C1GA 3WQVA 2YA0A 2OVLA 3DUGA 4XZWA 3F4WA 1DOSA 1F3XA 2WVUA 4V33A 3UP8A 3GXIA 1ROUA 1RY0A 2GDVA 2HXUA 1RV8A 2JEQA 4N9DA 2F8QA 3TW7A 3TFCA 4DELA 1ZALA 1FWFC 2EF9A 1TPH1 4E0CA 3JRKA 1JVNA 3STEA 1I60A 3HFTA 1TV8A 2Y6ZA 3G1YA 3RX4A 2NWSA 4ZQOA 3HURA 5G4EA 1EJRC 4GO8A 4PTDA 3ARXA 3O07A 1NDYA 5C71A 1NWSA 1XUZA 4EACA 1IXNA 4NP7A 2NV1A 3RK8A 4N19A 4DWSA 4S3CA 2WMKA 1KM3A 1R46A 1GRJA 3O5GA 2XIMA 4YTTA 5HWCA 1GHRA 4MWAA 3I6TA 4GBUA 3ITXA 1KBBA 5L9FA 4BF5A 3N1AA 3GC2A 4AF0A 4MIMA 5DEZA 1A80A 4JFWA 5I00A 2HBVA 4IMDA 3F2BA 4ZOEA 1WNOA 1SJAA 4IL2A 1BXCA 5PTDA 2DW7A 3GZAA 3WQ4A 4HMNA 4ENLA 3BLOA 1UZHA 4N42A 4C6CA 3PTKA 3KAGA 2NSOA 4E2OA 2HV5A 3UJ2A 3DX5A 3K8LA 2GVGA 2NVAA 3CV1A 2Z1WA 2V2DA 2QJIA 1LRTA 4S2BA 2Q01A 1E1EA 1WB0A 2YBVA 1GVEA 5AYYA 4J3UA 4DN1A 2ISFA 2GYIA 2H3DA 3MI3A 4HK6A 5BWFA 2ZXAA 3BG3A 4NYYA 2QUVA 1HF6A 2B7NA 4ODRA 1XLLA 2J77A 5LNRA 4ZTXA 1LG1A 2PGFA 3ZMRA 2VRJA 3AZTA 3O06A 1WOAA 2C1HA 3URBA 4CU8A 3HA1A 2VZTA 5CEWA 3AOFA 4CNOA 3GG1A 3VGFA 5EMKA 3V5OA 2J7DA 4DT4A 4IWWA 3TROA 3UGVA 3W7EA 1ZJHA 2B0MA 2D2GA 3WF1A 3LB0A 4UTHA 3SGGA 2E28A 3EOOA 3OYZA 4QROA 5BXPA 4ZGYA 2YB4A 2VR5A 5FJOA 4WRHA 2XH4A 4GINA 4FIRA 1G67A 4NT0A 3XINA 3P8JA 2GDQA 4MOZA 3GTFA 1GK8A 2EQDA 4FXSA 1DTUA 1MWOA 1AH4A 1BTCA 5LA1A 1BKFA 1KM5A 5CZTA 4AIBA 1E6RA 1TJ0A 4W93A 4GVGA 4KQNA 4DRSA 1W37A 2XM1A 3W2UA 4K1GA 3IUDA 3S2LA 2P76A 3LU2A 4YS1A 3ZLHA 1LG2A 3YPIA 1E4LA 4O1BA 4DBSA 2WSPA 1P6CA 4U31A 2BLEA 3GXNA 1GTEA 4S3DA 3MYPA 4UNIA 3W22A 1S3HA 2FDSA 5D2VA 3FHQA 3EDKA 2JALA 1FKGA 5G2WA 5FF0A 4BR1A 1PKLA 5LIKX 3DHPA 5B8IC 1O7AA 1ZCNA 1V0KA 3DFSA 2BTMA 1OYBA 1S5VA 3FYPA 4X3ZA 5HA7A 4Q7IA 4D1IA 4E2VA 2HRWA 2ZXBA 1TCDA 1J96A 5FF7A 3FGCA 1DJYA 2EAWA 3KDNA 4DLFA 1HO1A 3WBEA 2HNEA 2XFRA 1AJ0A 3C5QA 3STCA 1ZP4A 3VMPA 2HXTA 4GYFA 2ZZ1A 8XIMA 4HCHA 1U33A 4JFMA 3VD3A 1KXQA 4ML9A 1VB9A 3PSVA 2O9PA 3GR8A 2DSZA 4PRRA 1ME7A 2PB1A 3OTRA 4JPGA 2WHMA 1N8IA 5E5CA 2RUCA 3GR4A 1QPNA 3VIKA 3L5MA 4H7ZA 4UZSA 5BXTA 3AHXA 3F03K 1OBAA 4IP5A 3F1QA 3VOFA 1BPLB 3H70A 1BRLA 1TTIA 1FH7A 5CPMA 1NFPA 3MKVA 3M41A 1B3OA 1U5VA 2PPGA 4BZYA 4MWAE 1YXCA 2H6RA 5LXEA 1UYQA 5EGRA 3T6CA 1O66A 4C91A 2QCLA 2NQJA 3KDOA 1CXKA 4DYKA 4IISA 1GOQA 1PHQA 2D0GA 3PHAA 1SFTA 2OB3A 1B3YA 4C02B 4W88A 1D3GA 6XIAA 3QQWA 4KS0A 1IZKA 1HG3A 3IACA 1PTDA 4HN8A 5K7JA 4DHGA 1Q13A 1WDDA 5D2YA 2PDJA 1VCFA 3T0CA 1REQA 4GGHA 8CGTA 3LV5A 5GPGA 1HNYA 2CBUA 3U5YA 3DXIA 1PBKA 3BLIA 4H04A 1SR0A 1GKRA 1WUFA 4JX6A 1PIGA 1UR1A 1QPLA 1P0EA 2W0UA 2JFEX 1D7IA 3PANA 2RDWA 3UA3A 4LSBA 2QCFA 3F5JA 4ZBCA 1AODA 1R47A 2YL9A 3HPXA 1XDJA 2VZUA 4QITA 2CHNA 3AFBA 4F0RA 3L0KA 3IIZA 4IQCA 2QF8A 4IQEA 1JI1A 2DUAA 2I56A 4G7EB 2YFOA 3EWUA 2VEFA 3A5VA 3ICJA 3DG7A 2BMBA 4UDMA 2CETA 2WCGA 4QNWA 4JFJA 4ZEPA 4YHGA 3S1XA 5CCZA 4AWUA 3U3HA 5ECVA 3SM0A 5JMUA 3TYBA 1GW9A 4LW7A 5ABTA 2FVLA 3VK5A 1O6IA 1VD6A 3UERA 5MHBA 3ZSTA 3T81A 1YLVA 3RCMA 4IP7A 1UD2A 2A3HA 3GHTA 3K1DA 1VQTA 3NZ1A 5BMXA 3CASA 2GGIA 3GH5A 3S2CA 4M82A 2PE4A 1F4AA 2XGBA 3I7SA 2ZZ7A 2CERA 1J93A 5EMLA 2YIHA 4L3NA 1GW1A 2XTKA 3DESA 4UBPC 3I3EA 1VEOA 3OVGA 4N9BA 2BNJA 2ZRXA 3L4XA 1SPQA 3KLLA 1UQYA 1PWMA 2G8ZA 1ME9A 1B30A 2CC0A 4RPQA 1BFNA 2Y85A 2VWTA 2RURA 1MYRA 1EHNA 3TTQA 2DZVA 2WZMA 1T41A 5A2CA 1AD1A 2FFCA 1QI2A 3E74A 3UNDA 3WJXA 1XIDA 1VEMA 5DMMA 2IPJA 4MB4A 1GUVA 1UUMA 1IZJA 1ZJAA 3FLUA 4B3ZA 1RAKA 2UV8G 2P0IA 1X39A 3QV8A 4NYUA 3WLJA 4W9TA 3U48A 1WZKA 4IXHA 4I90A 3IVUA 2FQIA 3GYCA 5IHSA 2D20A 2MNTA 4IGNA 2PMQA 2X7WA 1J6YA 1XSIA 3V0SA 2FPVA 1EIBA 5LHFA 4QISA 1EF3A 3EX3A 1S2TA 3A3WA 3WD1A 1GOKA 2W3ZA 2VZVA 4DWSB 4UCGA 4LGXA 3ISIX 4R7JA 3CBWA 2Y62A 2HDJA 4UQAA 3GHSA 4Z1AA 1JGMA 1A0DA 1R3WA 5CPOA 3I4KA 1ZSXA 5M17A 3ANVA 4AWEA 4YXGA 1TPUA 1TVNA 3CWOX 2QUNA 4J35A 2E6YA 1VZWA 1XM3A 4MKV