4DWSA

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
543
structure length
526
Chain Sequence
GAVPTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEKIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADETIDMGPLYNPGEIYLSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Chi2
publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
total genus 186
structure length 526
sequence length 543
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsA02
1FHDA 3OB8A 3SUUA 2ZICA 2FGLA 2OYMA 3VIFA 1XRVA 1E43A 4Q22A 2YL9A 3UG4A 5I5RA 1OM0A 2WVUA 2EO7A 2RGLA 5JBDA 4P7QA 1B9ZA 3LPOA 3VDCA 1M03A 4XZBA 2J62A 4MNJA 1KXVA 1LL6A 6CGTA 4R27A 4P8VA 4AC1X 1ODZA 3IK2A 2WNWA 1Q6EA 1JZ3A 1LQ0A 1HXJA 1XH1A 3NDYA 4F79A 1BVNP 4NRRA 3SEPA 1NWTA 4TVCA 1TA3A 2W5FA 1ZBCA 1R8LA 5A6LA 4OOZA 4WK9A 3MUIA 3WD2A 5DEZA 2DGAA 3ZQ9A 4JL1A 1W2VA 2JF6A 3VIGA 3CZEA 4BF7A 9CGTA 2BY0A 5ABEA 1CGWA 3CHFA 1AVAA 2PWFA 2UWFA 2YA1A 1C90A 3ALFA 4IPLA 3BCDA 3N15A 4W84A 3SCTA 2CXGA 2WZHA 5DT7A 5IXEA 1J0YA 5BXSA 1WPCA 2CESA 3CLWA 5DT5A 1JG9A 1LF1A 1BAGA 1FH7A 3VKKA 2CITA 3VMPA 3ARTA 3K8KA 1SFSA 3WMSA 4J3TA 5A6KA 4BCEA 1US2A 1PZ3A 3WEZA 1HIZA 5EB8A 1PEZA 4BQ3A 5A6BA 1UZ1A 1JZ7A 1GQLA 1CZ1A 1CIUA 1VJZA 4W8AA 3WMBA 1P6WA 1W32A 1JD9A 3W6LA 2GJRA 8CGTA 2FHBA 3AI0A 2G41A 2YBUA 3ARWA 4Z2LA 3W27A 1CEOA 1JYNA 2YLLA 1K9TA 1QBBA 3LPFA 2DSUA 3L4XA 3T0DA 4X9YA 3SIMA 3TTYA 3BC9A 4GZIA 1XSIA 1N82A 1NOFA 2XVNA 5IDIA 4B9ZA 5A69A 5GNYA 2GUYA 2WKGA 1H1NA 2JALA 3MUZ1 1UR1A 2WMGA 4W86A 1E56A 1JDAA 2VOTA 3ZOAA 1UKSA 1V6UA 1E72M 1CXEA 3AIBA 1EDGA 1UKPA 3KE0A 4N42A 4RE2A 4R5EA 2B31A 3VGBA 1ZL1A 2XJ7A 1F4AA 1GORA 2A3EA 2GVYA 1JIBA 4CD7A 3GH4A 4HA3A 4UQCA 3GBDA 3VD4A 1BF2A 2VVSA 1VJSA 4PCTA 4W5ZA 3G6MA 2ZUTA 1JXJA 2CIPA 2W91A 2BVDA 3SCSA 3THDA 1C8YA 1JZ6A 1K6AA 2PBGA 4DWSD 4AXNA 1KB3A 3VGGA 1JDDA 1V6WA 2WPGA 1TR1A 3CPUA 2VZVA 3VX1A 2NT1A 4H41A 4RE4A 1KQZA 4M81A 4P7RA 3NYDA 3RM4A 1E6QM 1A3HA 2JF7A 3CZJA 1PIFA 1C92A 5D9OA 4MDPA 2VCCA 2XGIA 3VPLA 2CEQA 3GTNA 3WD0A 1CNVA 1EH9A 5I6SA 4HPHA 1VFUA 4CD5A 1G01A 4MADA 2VX6A 5I79A 5BXRA 5JIWA 1PAMA 1ISYA 1OGBA 2OYKA 1B3XA 5CXPA 1H0GA 1JDCA 3BMWA 5AC4A 3PZGA 3GYCA 1J18A 1ZJBA 2WWCA 1BVZA 3WENA 3CZKA 2DQXA 3WL0A 2Y5EA 1DHKA 3SCQA 3ARPA 4PTVA 5C71A 1GJUA 4UFMA 1W1YA 1L8NA 3GXDA 4KMQA 2WANA 3WQ5A 1XC6A 2ZX9A 5LA2A 2W67A 5GNXA 3M46A 1RH9A 3OIHA 1D7FA 4MNLA 2G3JA 1BG4A 3A4WA 2A3AA 3MUY1 3NJ3A 5LA1A 2IXVA 1CGUA 2WMFA 4M8UA 1KFWA 3VVGA 2W92A 1UWSA 3WUEA 4Y7EA 4P7NA 4FLSA 1OCQA 3WFZA 2E9MA 2QLYA 3L4VA 1EDTA 1GONA 1DEDA 1JF5A 3T2PA 2WC4A 3ECQA 1DWFM 5IFTA 4HOZA 4M80A 2WMIB 4MB3A 5I3DA 4C7DA 4H8UA 1V03A 3DYOA 4D1JA 1FHLA 1CECA 3UG3A 1JAEA 3PBGA 1E55A 2GDVA 3W82A 4PMNA 1VFMA 1GCYA 2YA0A 3WF0A 3BXWA 4AZGA 2X0HA 2WKLA 3AHXA 4HMEA 2NSXA 2XM2A 3WF4A 4CCEA 3PZQA 1QNRA 1QVBA 4JFVA 1B1YA 3B9AA 3IJ7A 3VMOA 1Q6CA 4RL3A 4P8WA 1ISWA 1JFHA 4W85A 1QBAA 5HBFA 4BS0A 3SCPA 3UEQA 3WNKA 3QOKA 3DYMA 5JIPA 1WZKA 2J4GA 1UR2A 1KQYA 4GI8A 3VOCA 1V3KA 1J11A 5AY7A 2BS9A 1O7AA 3MV11 1V08A 3CHCA 2VX4A 2Z1KA 4AD5A 1C7SA 2JEQA 1RD6A 3K8MA 4UFIA 4CVWA 2JFEX 2YL8A 2EJ1A 1U33A 1GOQA 4U31A 3MU7A 4W88A 4LPCA 3CH9A 1FH9A 2Y24A 5FIPA 1G94A 5FL0A 4DM1A 1HP5A 4CD4A 4DUWA 4ZXOA 3OLDA 4ATWA 1W3HA 2GDUA 2GSJA 3DHPA 3VIPA 3BAYA 1NWSA 5ABHA 3LPGA 1UHVA 1V6YA 4RE3A 1G1YA 1QI5A 3SCNA 4TX6A 4NZCA 1E6RA 5CSUA 1H41A 5DO8A 4J3WA 1B90A 3VDBA 1HKJA 4AD0A 5CLWA 5CJ5A 1MW3A 3F4VA 1OT2A 2WHLA 1KGWA 1V3HA 2WCGA 4W8BA 4B16A 2D24A 2D2OA 3WBAA 3RJYA 3GM8A 3EDDA 1MXGA 2WXDM 4TTUA 3JUGA 1W1VA 1M53A 2DT1A 2XWEA 5D9NA 4JFUA 4LX4A 3TTSA 2VQUA 4QCEA 3TONA 4ACZB 4LGXA 5A2AA 3VIJA 5I78A 3L4TA 2EPMX 2ZXDA 4MB1A 2WK2A 1UKTA 2OLHA 4AIOA 4HMCA 3WFLA 3PZOA 3ARSA 3AHYA 3U7BA 1W3LA 5DF0A 3FAXA 1R86A 1UH3A 3F5LA 1LLOA 3LMYA 2YBTA 4WKHA 5ABGA 3CBWA 4Z2HA 1WDSA 2A3HA 4P7OA 3AIQA 2GFTA 1R85A 1BQCA 2PWGA 1UR9A 1OBAA 5BCAA 4JL2A 1NWRA 3WNPA 1UR0A 3CUIA 2VCBA 3IJ9A 5E6YA 3VGEA 2CBVA 2ZX5A 2V3GA 5IFPA 4W93A 1HNYA 1Z32X 1B2YA 4HZ8A 4M1RA 3QHMA 4UFJA 2CCRA 3SURA 1VF8A 3NUKA 3WEOA 1J0HA 3VUPA 1CGYA 5A6AA 2CBUA 4QLKA 3AISA 3RDKA 2XSBA 1QI2A 4D6EA 2VZSA 1W9DM 3VIHA 4EE9A 4DWSC 2FHCA 4AYSA 2WMHA 4PSRA 1H2JA 1B3VA 3WKZA 3EMCA 1E6XM 6TAAA 2WVVA 4AZ7A 3FHAA 2V38A 2J77A 2X0YA 3W81A 2WMKA 2ZUNA 1TMQA 5A3HA 4JKMA 4UR9A 5A2CA 2ZIDA 4JIEA 4CN4A 2J47A 1FP8A 3PTQA 3POHA 3T08A 3CUHA 3OGVA 4OKDA 4ZENA 5A8OA 1US3A 4AD1A 5CG0A 1HJQA 3VD9A 2CPUA 3WD4A 1GQIA 5E6ZA 4CD8A 2VI0A 3I3DA 1UOKA 1XSKA 1TVNA 2GK1A 1K9EA 4W8LA 3U57A 3KZSA 3WELA 2F2HA 2FHFA 3AS1A 1TE1A 5IHSA 4PMYA 1EDQA 3CUGA 1GOWA 4XV0A 2V3EA 1VAHA 3A47A 2VZUA 1ITCA 4YPJA 4CN6A 4NRSA 2XTKA 3GH7A 4U3CA 3AYSA 3KL5A 4HZ6A 2VURA 4UZSA 3WD3A 1DWJM 1J0IA 3A4AA 1VEMA 4H7VA 4UFKA 2DPEA 4IPNB 3WQ6A 4BQ2A 1WO2A 2XM1A 4GO8A 3VX0A 5JH8A 4AD2A 3CO4A 4CN1A 2ZUVA 1GUVA 3ARZA 3WSUA 1AQMA 4K68A 1E6SM 3HJEA 2QHAA 2YLAA 2QV4A 2XHYA 1QNQA 1HJSA 2D1ZA 3HN3A 2PF0A 1L0PA 3VTRA 4HA4A 4MTVA 1Q6DA 3KEHA 3CTTA 3A6OA 1JI2A 1V6VA 4TXEA 3WNNA 2WB5A 3PTKA 3TTOA 4AY1A 4HPGA 3WF1A 4MJ4A 3W53A 4D6IA 3VO0A 2J7HA 1G0CA 3WUGA 5GPRA 3WH7A 1UQYA 3W24A 4E8DA 1TA3B 3AYRA 4OJYA 2DDXA 3KL0A 4MNMA 2WHKA 3ZJ6A 1CXIA 2YJQA 1ODUA 5A6JA 4FK9A 3RJXA 2NT0A 3CUJA 3ARYA 1CLVA 4UTFA 3CZ8A 5GNZA 2J7BA 1Q6FA 4UFHA 1BGAA 4B3KA 2XYLA 3B9EA 1W9UA 4E8CA 2BY1A 2CHOA 1UD3A 4F9DA 1HJUA 4HZ7A 1X1NA 3MKKA 1BSIA 2VL4A 1RP9A 2WBKA 5BXPA 4GQQA 3MMWA 5AYBA 2CKSA 3FXYA 1WAWA 3BAWA 5M17A 3PZTA 3WD1A 5M5DA 1CTNA 1SR0A 4KRTA 4AZ5A 4PUDA 1NOUA 1VFOA 4F66A 4LYRA 3W29A 1KGXA 4WKFA 3K4DA 2GJXA 2XGBA 1OGGA 1XHGA 3N17A 5JBEA 3T0BA 5DMYA 2FGZA 1B0IA 1V0KA 1DWIM 3FN9A 2WHMA 1TFVA 1BTCA 1VEOA 2WW5A 2O9OA 3SUTA 1ISXA 3RIKA 4FMVA 1ZBKA 1JZ5A 3PZIA 3WDHA 4PMUA 3CGTA 4GI9A 1DWAM 3VNYA 3OA5A 4JHOA 2DIEA 3GDBA 2ZUMA 1QNOA 2BXZA 3BH4A 4PRWA 2YA2A 4DWSA 2YL6A 2XWDA 1KXTA 4S3KA 3OZOA 3ALGA 3O6AA 3IAPA 1S46A 2OWXA 3N12A 3TOPA 5BYWA 1UD4A 3W38A 1IZKA 2EPKX 5AC5A 3D3AA 1HVXA 4OBSA 4AEFA 4LXFA 4LYPA 1FP9A 1ISZA 5CLTA 1W3JA 5D4YA 4P8XA 1MVYA 2J7FA 1B3ZA 4W87A 4QLJA 4P7LA 3U5YA 1ZJAA 4C7GA 4KH2A 1EO5A 1QI4A 1LG2A 4JCLA 1TZ7A 1JZ2A 1MW1A 2WLZA 1IZJA 4WJXA 3MANA 2JIWA 1V3IA 3GZAA 2WMJA 2OSYA 1XYZA 3M07A 4MB4A 5C70A 4DUVA 4A3HA 3VGHA 1W9VA 4BZYA 4J3UA 1NP2A 3WH5A 1K9DA 2J7GA 1B30A 2PWDA 2ZE0A 4HP5A 2Y2WA 3U7VA 5CQ1A 3GH5A 1WP6A 3MSDA 2EBNA 3N18A 5BXTA 1LG1A 1H5VA 2A3CA 2J79A 2VX7A 3BLKA 1XD0A 1HL9A 3QR3A 4CU6A 2ZX6A 1GOMA 1GJWA 1NWUA 4UNIA 4LYQA 1EO7A 2J7DA 2XVKA 1XCXA 4D6JA 3DC0A 3AIEA 2UY2A 1JYXA 5CZKA 4P8UA 1GZJA 5LYRA 4D6FA 2EQDA 5HDRA 1VENA 4E2OA 1ISVA 3RCNA 3OGRA 3VM5A 3AJ7A 3AXHA 4HMDA 3ARUA 3I3EA 2Q8XA 4ZXLA 3UR7A 1QNPA 1E0WA 3N1AA 3BAXA 3EDEA 4QCFA 1JAKA 1WKYA 4H04A 2W61A 1GQKA 1UG6A 4U3AA 3AOFA 1YQ2A 1EQPA 1E4NA 3ARXA 3WH9A 5D8ZA 4WF7A 4NF7A 3AZRA 2WZIA 2BY3A 4IUGA 2J75A 2XVLA 3DYPA 3N9KA 1H4PA 3UESA 3S2CA 4AZCA 2XG9A 4UQEA 4XUYA 1QW8A 1FA2A 3K1DA 3EYPA 4ZFMA 1XH2A 1V02A 2CYGA 3MV01 3PHAA 4M29A 1CXKA 1UWRA 4J3VA 1KXQA 4UQBA 3VGDA 2HVMA 3N04A 5A8QA 5JBFA 3ZT7A 2WC7A 2C8NA 1PX3A 2V3FA 4PMOA 3VINA 5A6MA 2OWCA 2VRQA 5GQBA 3GNOA 2WSPA 2D3NA 2EEXA 1XH0A 1UD2A 1XGZA 1EQCA 3WNMA 2CBIA 4NI3A 1MQQA 2ZUUA 2YIHA 5I2UA 4X0NA 3BMVA 4JFTA 3RPMA 1W9BM 3HMCA 3LPPA 3GXIA 2XIBA 3UCQA 2DH2A 3RO8A 1BYAA 2ZUWA 3L4ZA 2W66A 2ESCA 2WBGA 1GVYA 1GPFA 1UD6A 4PTXA 1GOKA 1UA3A 4OOUA 3OG2A 2QMJA 4HA1A 3AMDA 4MNKA 4JZ5A 2GJPA 2UY4A 2UY3A 4N0RA 2AMGA 3BLPX 4J28A 3F5JA 4JKLA 1E0VA 2J7EA 4CCDA 1OD8A 5A8NA 4YN5A 4Q7NA 1NARA 4DUXA 3ARVA 3O2LA 3MUAA 4D6HA 3WDPP 2AOSA 1WDPA 1V3LA 1H09A 1MFVA 1W1PA 4MB5A 3WDIA 1W9XA 3AMCA 1E4MM 1WDQA 4CCCA 2DT2A 3ZJKA 1MXDA 2F61A 2E4TA 3AIWA 4KRUA 1E5JA 5I23A 1A47A 1E5NA 1H11A 3VU2A 3DHUA 4JKKA 1U30A 1V02E 3K46A 3T09A 2IUZA 1HN1A 3FY1A 1ZB5A 4KGLA 4UOQA 3AIVA 1C8XA 1G5AA 3AHTA 3AZTA 4CU8A 2D3LA 1WE5A 3L2MA 4URIA 3AS2A 1NOWA 2BXYA 2J25A 4AMCA 1CENA 1Q4NX 3M7SA 4FLOA 5A95A 4CD6A 1PX8A 3ZJ7A 5A1AA 7TAAA 2JEPA 3SUSA 2X09A 1X6NA 1BFNA 1UH2A 5FD0A 3UR8A 5HPCA 1MQPA 3PTMA 5ABFA 1V0LA 5E70A 3ZR5A 1E73M 4TUFA 2X2YA 3NDZA 1UA7A 1QPKA 4AZ6A 4Z2KA 3QOMA 1X6LA 2F8QA 3AXIA 3L4YA 3VD5A 2V5CA 2WWDA 4CU7A 1KXHA 2RGMA 3L4UA 1TUXA 1UQZA 2VTFA 3KL3A 1UWQA 2WYSA 3WN6A 4Z2GA 3CMGA 1MYRA 1UR4A 3AICA 4PUEA 4FLQA 1D3CA 1E3XA 4OBRA 3AS0A 5JUVA 1ZBWA 3VM7A 4D6GA 1JYVA 3AXXA 1MW2A 3MMUA 4UCFA 2DSWA 1K9FA 3VIMA 5AYIA 4PTMA 1J12A 2BHZA 4JFWA 2X1IA 4AW7A 2WCAA 1JYWA 1W3KA 3VIKA 5CSYA 4GKLA 4YHGA 3W6MA 2YDQA 3IANA 4JCMA 3WL1A 4D71A 3MSGA 1U2YA 2VX5A 1BYBA 3ZSSA 3PZNA 2E40A 2X8RA 1C8QA 2E8ZA 3K4AA 1E70M 1KCKA 3OLIA 3OLGA 2WVVB 3WQ8A 3WNLA 3ZM8A 3WNOA 4PMRA 5HXMA 4H8HA 4X0VA 2VC9A 2YDRA 3W25A 3THCA 1GHSA 3W37A 1E71M 1JL8A 4BQ5A 4MAVA 4AEEA 4HTYA 1NH6A 5DFAA 2DEPA 1YHTA 1MQRA 5I0DA 4IM4A 1WZAA 3RMEA 1B3YA 2D0GA 3VD3A 1BLIA 3AHVA 4C7FA 7CGTA 3IJ8A 5EMYA 1O6IA 2Y4SA 1XSJA 3EBVA 5KEZA 1GW1A 2VNCA 5FOOA 3W28A 1JNEA 2CNCA 2GK1B 8A3HA 3CHEA 2PC8A 1BYDA 4WLCA 1GOOA 3FW6A 6A3HA 1R7AA 1EOKA 3WDJA 5A2BA 1PIGA 1EA9C 3WDQA 1V3MA 2XPKA 3EMZA 4J27A 1C3FA 1C91A 3J7HA 3A3HA 2PWEA 5BRQA 5D9PA 1UYQA 2VO5A 3PZUA 4J7RA 1E15A 1TCMA 2XFYA 1KR1A 2D22A 3CZGA 3BAIA 2WHJA 3GNPA 4BA0A 2W62A 4M56A 1KR0A 1HL8A 1F4HA 3W4RA 1JF6A 1HT6A 3RM9A 3VILA 3E1F1 1JD7A 1ZU8A 3S6TA 1SYTA 2DSVA 3B9DA 5IHRA 4BQ4A 4OIFA 4AISA 2QPUA 1E9LA 1EHNA 2DSZA 5CPQA 1G9HA 4QDMA 4AZBA 1CLXA 1HP4A 3TP4A 2D20A 1PZ2A 3NIYA 3AFBA 3WQVA 3QHOA 3PZ9A 1WNOA 3RILA 4D1IA 4CUCA 5A6BD 1OIMA 4HU0A 1J01A 3GNRA 3UERA 1JNDA 4DM2A 2QF8A 3OZPA 1GQJA 2VCAA 3T2QA 2XFRA 1MFUA 1VEPA 1VB9A 4AIUA 2EPOA 2XUCA 5E0CA 2G3IA 1LJYA 1I75A 5M3WA 5A8MA 3WH6A 1FFRA 2J74A 4B3LA 1NP0A 1AQ0A 4H2CA 2XSAA 4ATLA 4A3YA 4PMQA 3T0AA 4ZE5A 5KZ6A 5FL1A 2C7FA 3WQ4A 3WDRA 1OINA 2HISA 4QLLA 2J7CA 2XFFA 4MAZA 3N13A 1R87A 3AS3A 3SCUA 3WMCA 5CGTA 5A8PA 3AHZA 3EMQA 1J9YA 5E09A 1UH4A 1BYCA 3POCA 3OBAA 3CHDA 2VT0A 1HX0A 1B3WA 2DH3A 2DIJA 1FFQA 1QI0A 2BVTA 1DWGM 2D23A 4EKJA 2ZXBA 3VGFA 2BV9A 1CXHA 1UD5A 2ZX7A 1CBGA 2X05A 3K8LA 3NSXA 3RM8A 3ZSTA 3BSHA 4F8XA 1W91A 1WZMA 2WCSA 1KWGA 2E0PA 4UFLA 1M04A 1OGSA 3M6DA 1QHZA 2A3BA 1IT0A 1UR8A 1DWHM 1J10A 4UQDA 2GJXB 3TTQA 1ZS2A 1CPUA 2YDSA 4L4OA 1UWTA 1QHPA 3GBEA 1E40A 1EOMA 4W7WA 4B15A 3KWXA 1QI3A 5A6SA 1PX4A 1CYGA 3HU7A 1LL4A 1GOIA 5BWFA 3WF2A 4V2XA 3I3BA 4JHZA 1WDRA 1CDGA 3APGA 2MANA 2ZX8A 5BROA 4S3JA 1B31A 4UZUA 4DWSB 1JXKA 1OT1A 4GINA 3SCRA 3WBEA 4TTGA 1JI1A 3FHQA 1XYFA 2XVPA 1KWKA 1BGGA 2Z1SA 4AWEA 4U5KA 1E3ZA 4AZIA 4OZOA 1J0KA 4A4AA 5D8WA 3ARRA 1RPKA 2V5DA 2BHUA 4WSKA 1GNXA 1E6PA 1E0XA 1VBUA 2W63A 2WMIA 1BPLB 4PN2A 4HOXA 4FF5A 1JZ8A 1J0ZA 3EDFA 2D0HA 2VMFA 3CUFA 2EPNA 4U5IA 2CKRA 3WH8A 1CGXA 3AIUA 4U2YA 4QP0A 4UOJA 1OIFA 1UWIA 2BNJA 2CHNA 3SCVA 1EGZA 5F7UA 7A3HA 1V3JA 4AD3A 3BAKA 1EIBA 2CBJA 4GQRA 1PJ9A 1WB0A 3MMDA 1SMAA 3ZT6A 1VFFA 3BCFA 2BY2A 3AMLA 4EAMA 1CWYA 4XX6A 1D2KA 1CGVA 3MS8A 5I77A 4H8VA 3NSMA 1PBGA 2J8FA 3VD7A 4B9YA 2DSKA 1PPIA 2G4FA 4GZEA 1HJWA 2PI6A 1H49A 1LWJA 3DECA 1DTUA 4AD4A 1OB0A 2PBOA 3VNZA 1HKKA 1E6ZA 1E4IA 3FNDA 4W7VA 3AIRA 3F5KA 1RP8A 2Y8KA 4PYSA 1W9PA 5CGMA 3PN8A 4TVUA 4FLRA 4MDOA 3AQUA 2EXOA 4V28A 2ZWYA 1C93A 5TD4A 4D6CA 4QAWA 1XV8A 4KWUA 1FOBA 2EPLX 4QFUA 5ECUA 3EDJA 4GXPA 5D9MA 4PEEA 3SUVA 4F9JA 3GXFA 4YHEA 3PZVA 4OUEA 4PMZA 4PTWA 4ATDA 4M82A 2WSKA 4ACYA 2VJXA 2YL5A 1J0JA 4W5UA 4AZCB 2VVNA 2G3NA 4MPKA 4PMXA 3W0KA 1ITXA 4EANA 4IISA 2E8YA 3NCOA 1HJVA 4MJ2A 4Z2JA 2E3ZA 3EDKA 3SCWA 3T2OA 2BVYA 1XCWA 2WVSA 3ZT5A 3SCOA 3B8SA 3AROA 1FH8A 4E4PA 1NM9A 2WC3A 4UQ9A 3U5UA 2ZUSA 4L4PA 2O92A 4WSJA 4ZE4A 4GO9A 5LA0A 4ACZA 1QOXA 1R7OA 3GXMA 1UD8A 2NW0A 5FCZA 2J78A 3OGSA 2WAGA 3CMJA 5BRPA 2ZXQA 3WY1A 1W1TA 1IV8A 1Y7VA 1ECEA 3WEMA 1SMDA 1QNSA 5M03A 1V0MA 4AZHA 1MW0A 2J8GA 4PMVA 2VQTA 1WCGA 2ZWZA 2G8ZA 1JGIA 4U2ZA 2O9TA 3II1A 2QPSA 1CGTA 4JFSA 1QHOA 2WZEA 2AAAA 1AQHA 2G3MA 2OSXA 1UUQA 1UKQA 3CIVA 4D6DA 1AMYA 2XIIA 2CETA 4J3XA 5CPTA 2VR4A 4TOQA 4ML4A 3A4XA 1KCLA 1EXPA 2DT0A 2O9RA 3IAQA 1UWUA 1HKMA 3WQWA 1XD1A 2BFGA 5EFFA 2VZTA 4GI6A 1HVQA 1OD0A 3N11A 1M01A 2JE8A 1KBKA 4NSBA 3VMNA 3AZSA 1E1EA 3NSNA 3W26A 1H3GA 5A94A 2FH8A 2FDMA 1V6XA 5C8BB 4LQ1A 4XZWA 4CGTA 3VDHA 1H0IA 2QMKA 2JIEA 1UZ4A 2PB1A 1TG7A 3QGVA 4TX8A 1LL7A 2O9PA 2WVTA 3BSGA 1LWHA 3CZLA 2YOCA 1DP0A 2CERA 3WUFA 4CVUA 4PMDA 3SUWA 2BHYA 1ESWA 1E1FA 1NQ6A 2V3DA 4W89A 2OYLA 4PBGA 4Z2IA 3TA9A 4HOWA 3D5HA 1E6NA 2VRKA 5EFDA 1ZBVA 3AMGA 2YKKA 1KBBA 1I1XA 3BAJA 3L2LA 2VRJA 3ZIZA 1OWQA 2UY5A 3OLEA 3WF3A 4JAWA 4TVDA 3PZMA 1BHGA 5I24A 4GIAA 4PSPA 4U33A 3AMKA 3L4WA 4M24A 5ABFB 3G6LA 3FAWA 3MO4A 1QW9A 1CXFA 4AIEA 4WKAA 1W2PA 1JZ4A 3UETA 5CPSA 3VIIA 4J3SA 2DT3A 2FH6A 3UG5A 2W4XA 3VDAA 4EK7A 1C7TA 2ZOXA 5FKYA 3ARQA 5E9AA 3ZR6A 2Y8VA 1OSEA 1BG9A 1TVPA 1GVIA 2PWHA 1CXLA 1HKIA 1Q6GA 2OWWA 4V27A 1GHRA 1VBRA 2VUYA 1EHAA 2VR5A 1VIWA 4UOZA 5HPOA 1KGUA 4W7UA 2E9BA 2WLYA 2D0FA 4PCSA 1UKOA 2WM0A 2ZXAA 1I1WA 5E0FA 4CKQA 2TAAA 1JFXA 5EBAA 4D72A 4HU8A 2C0HA 5HNNA 1M7XA 1MWOA 4WIWA 3WIJA 4UQAA 1HJXA 2VZOA 2XVGA 1E4LA 3ZMRA 1V0NA 3VIOA 1WZLA 3QHNA 4GPNA 4KGJA 4ZEPA 5HOSA 3O9NA 3WUBA 1HF6A 2E9LA 4XB3A 3ZO9A 3BGAA 2OSWA 4GZJA 3ZJ8A 1VRXA 2IXUA
chains in the Genus database with same CATH superfamily
3OB8A 3SUUA 5FEZA 4L9YA 4I7WA 4Q22A 2R1LA 3HA1A 2EO7A 5JBDA 4EWND 4KCUA 3VDCA 1PE1A 1R3TA 1XIDA 6CGTA 1XIFA 4AC1X 1ODZA 2Y8UA 1Q6OA 3W2MA 4EWJA 4E0CA 2WNWA 3CV6A 4XVEA 3NGFA 1EX1A 4F79A 2FGBA 4TVCA 3PVFA 4GI4A 1VPQA 3P2VA 1R8LA 1P4CA 2SFPA 4JL1A 3NOEA 4IMCA 3FKRA 5ABEA 1CGWA 3V5CA 2QIIA 4G9PA 2Y7DA 1C90A 1S5TA 3QSRA 1F40A 1FX6A 3SCTA 4HBEA 4DYEA 5IXEA 1DJIA 3WLHA 3UJSA 3CLWA 5DT5A 1JG9A 2ZQTA 1BAGA 3HG4A 3K8KA 1N7KA 3B04A 4IFKB 1VLWA 3H54A 1PEZA 4H7CA 4AH7A 3MVIA 4BQ3A 1UZ1A 2CZFA 2GGIA 3UWWA 4F4RA 4DO6A 4U28A 4F0MA 2Z26A 4QJ3B 2POTA 1TPWA 4JTAA 1Z9AA 3MHFA 3PF3A 4S2CA 2FHBA 2WNZA 2G41A 2YBUA 3W27A 4C6FA 1EC9A 3LI0A 4I8YA 4NY2A 3LPFA 2W79A 2DSUA 3CNYA 4X9YA 4GZIA 3BW3A 5IDIA 3PUOA 3N29A 2J6XA 5I07A 2JALA 1M7OA 3MUZ1 2OEJA 1D9EA 3IRDA 4I9TA 4IGMA 1VFLA 5DCDA 1OZMA 4NJIA 1JDAA 1VHCA 2OU4A 1M3UA 4PULA 1UKSA 1ECQA 3PPCA 4MJMA 1ZL1A 2WSQA 1MUWA 2PPNA 3W2NA 1JIBA 2O7QA 3B0VC 3F4NA 3TN6A 3C8FA 3G1FA 3IGXA 1VJSA 2CIPA 2E5CA 3LV6A 1XBVA 2BVDA 1R3YA 3UNDA 1C8YA 1VKFA 2PBGA 4AXNA 3PANA 3O6YX 3SDOA 2AQVA 3EWUA 1EX5A 2ZZ1A 3S47A 2AKMA 2ATSA 1KKRA 5I06A 1XIMA 3T1GA 5EMLA 1KQZA 3WQPA 3W7RA 2DZWA 4M81A 5FJJA 2RKXA 1FDYA 4L4MA 1QO5A 2JF7A 4QNWA 5C9ZA 1K8YA 1PIFA 1C92A 2D2GA 3VPLA 3O8AA 1XFCA 1Y5XA 2IQDA 5I6SA 2FDSA 3FEMA 4GGQA 1VFUA 4CD5A 5JIWA 1TO3A 3S42A 1PAMA 2PDIA 1W8SA 1LTDA 4QJ5B 3B8WA 1H0GA 2QNEA 3AYVA 3GYCA 1E44A 1ZJBA 4CNTA 2XN2A 1J2BA 3SFWA 4HCLA 5HNRA 2DQXA 2X7VA 1QJWA 1EUAA 1RSCA 1O5RA 3VKJA 4KMQA 1XC6A 1J4EA 3EB2A 1FCUA 4FNQA 3M46A 1N55A 2HV5A 4MNLA 1ZJIA 2G3JA 1JPIA 4WJ8A 2I5QA 4NU7A 3NJ3A 1Q6IA 5LA1A 1LRQA 1X7IA 3TEVA 2WMFA 3BL3A 3MP3A 3LCFA 3LY0A 3OO2A 4NNCA 3N25A 2BVWA 6TIMA 4DJEA 1IR2A 5IFTA 3IIXA 4IFRA 4C7DA 3ABRA 3DYOA 4FOUA 1OYCA 4LCQA 2VWTA 3UG3A 3PBGA 1XF0A 4LUYA 1VFMA 5TIMA 1GCYA 4QITA 2YA0A 2WKLA 5DBUA 3QC3A 1UP2A 3MP5A 2I9EA 2NSXA 4EACA 5EBUA 1QVBA 1B1YA 3IJ7A 2V82A 3IGSA 4A35A 4DT4A 3KAGA 3DYMA 3PK7A 4MHBA 1GTHA 3TUUA 3WLSA 1KQYA 4O12A 3VOCA 8XIAA 2PD5A 1AJ0A 3VK5A 1TX0A 5EGRA 1V3KA 3R8RA 2ZRWA 4OVXA 4QM1A 2DZXA 2BS9A 1A5AA 3MV11 2VX4A 3H26A 4E2VA 1L6YA 4PUNA 4G56A 4LT9A 5HWNA 2PLKA 4E2BA 4UFIA 3KZ7A 3MU7A 3NL6A 1OFBA 2BGSA 2FMOA 3UZJA 1B5TA 5C54A 4NZ3A 3E5PA 4CD4A 4F3HA 2BB0A 4DUWA 1V5XA 1A5OC 1ICSA 2GSJA 3PAJA 3LPGA 1V6YA 4GVIA 4RE3A 4UMBA 1FKGA 3SCNA 1FWGC 2ATMA 4JR5A 4J2PA 1E6RA 1KO0A 3NL3A 2WV8A 4FIRA 1B90A 3ZVHB 3VDBA 1HKJA 1RBAA 5EA9A 3ID7A 5LNSA 3N34A 1OT2A 3GUWA 4LS1A 3GDTA 1HFBA 3UXIA 4W8BA 1P7TB 3U2CA 2O7SA 2VFGA 3RJYA 3BOXA 1MXGA 1W54A 1ZUAX 3KAIA 3JUGA 4GX8A 2OZ8A 1M53A 5C2GA 1R30A 5D9NA 1K02A 3TYCA 3V3WA 3TW7A 3TONA 1F74A 4CQDA 5I78A 4BKNA 3W1NA 2XP3A 3L4TA 3B8VA 4WSHA 3NQFA 1DVJA 3M47A 3GWQA 1JDFA 2GDQA 4RNJA 4MSPA 3ARSA 3QGAC 4OT7A 3U3HA 1R86A 4MWAB 1LLOA 5CZSA 2FVMA 3UNTA 4F2BA 2A3HA 2Z7GA 3MZNA 3E5BA 2PWGA 3BE7A 2PDLA 1DBTA 4JL2A 3EKGA 4LBSA 1V7YA 2ZX5A 4W93A 3KHDA 1XKYA 1Z32X 1W3IA 3QHMA 1BWKA 2CCRA 3NXFA 3RPTA 4JD4A 1NVMA 3LHTA 3WBXA 1L6SA 1UUMA 3NUKA 4HGXA 1J0HA 3IK4A 3VUPA 5A6AA 3VUSA 4XD4A 4G8TA 1IGSA 5L6UA 3RDKA 4MMWA 2VZSA 1IWBA 3B06A 4X2RA 3W7KA 2NUXA 4INFA 4DWSC 2PDMA 4AYSA 1S2UA 3PJUA 2KGJA 4NIRA 1Z69A 3BZJA 1C9DA 4XUGA 2DUXA 4PFMA 4ZGYA 2J9ZA 1KLYA 1S5MA 2WVVA 4MZ1A 1IWAA 4C6BA 2J77A 2PDGA 2KX9A 2X0YA 1F6KA 3W81A 2WMKA 4UR9A 2ZIDA 1P43A 1UC4A 1GJPA 3PTQA 1TR9A 4Y96A 1R3QA 4HU3A 1OFAA 2Z2AA 4ZENA 4IL0A 5CG0A 4FALA 1MRQA 2CPUA 2FKEA 3ES7A 3KTCA 5E6ZA 4CD8A 5I7GA 3LLFA 1XSKA 3SQSA 1JRBA 4JY8A 3TCZA 4W8LA 4LRTA 3U57A 1U5VA 2E1DA 4TU1A 4LAKA 4LUTB 5HUPA 3E3HA 2R1PA 3I6TA 3DCPA 3CUGA 1B54A 5DLCA 4JYDA 4CQBA 1IXNA 3I7SA 5CBBA 2VZUA 4DZHA 4GC4A 4ZO7A 1SR9A 2V67A 5AC7A 4NRSA 3AYSA 3KL5A 1Q63A 1T8QA 3CL6A 1GWJA 2OZTA 2G50A 5BU6A 2HEJA 4FO4A 2QS8A 3NPXA 2Z1BA 1BVWA 2ZUVA 3WSUA 5JU6A 4K68A 3ABZA 3GDKA 5DMLA 3GFYA 4GYJA 4DAFA 1PIIA 4I6KA 3QBUA 3SIZA 4DRIA 1L0PA 5KZMA 3JRKA 4TW7A 1EA0A 1EKOA 3LGEA 4QR6A 1V6VA 3TYBA 2WB5A 4EPKA 1GVRA 2GQ9A 4AY1A 4C6KA 3OVPA 3VO0A 1PKNA 2J7HA 1G0CA 2Z2UA 5H2ZA 1TA3B 3AYRA 3KDNA 2DDXA 2QJIA 1JR1A 4MUZA 4MNMA 3ITLA 2WHKA 3ZJ6A 2N87A 4AQLA 4H7ZA 2KZHA 2GUUA 3M6YA 1A80A 4HQVA 3TYAA 3CUJA 2J7BA 4O2TA 3TYDA 1GW9A 3NQDA 3TSDA 3CU2A 4B3KA 1KRCC 4MLRA 4IIBA 4JTTA 3UCDA 1UD3A 4ORMA 3EZ4A 3WJSA 4Q4PA 3H9RB 4ODOA 3THQA 1F07A 3TWBA 2FKPA 2FB2A 1GTEA 3PULA 5MKGB 3APYA 3GVQA 4IP7A 4PEKA 2E77A 2QUMA 2YGYA 1W5PA 2PWUA 1POJA 1J4IA 4L6OA 4FXSA 4F66A 1LUCB 1KGXA 4I3GA 3CGMA 4WKFA 2XGBA 2OPJA 4LB4A 4WY0B 4YWIA 3EX1A 5DMYA 3NPWA 1MXSA 1J4RA 3LCWA 3G3DA 3A9IA 4GYFA 2NZLA 2W6RA 1HQTA 1EPXA 3N2CA 1BTCA 1GKPA 3L5LA 1Q1CA 2O9OA 3SUTA 1XJBA 3ZVIA 2YW4A 3WDHA 1PVNA 3CGTA 3E74A 3OA5A 3GDBA 1FWHC 1AW2A 7TIMA 3GFXA 2BXZA 1Q2RA 3OYXA 3H12A 4Z1YA 2YA2A 4Q6XA 2YL6A 3R25A 3EGJA 1KXTA 3V75A 4ENLA 3ALGA 3B0UX 2ZDRA 4QT2A 4ZQOA 3OP2A 4WJEA 1IZKA 5J6EA 3EWWA 4UTUA 3D3AA 1HVXA 4PH6A 4AEFA 1XRSA 2BTMA 3KBMA 3S1GA 2QDHA 5A6TC 2CLEA 3PUGA 1FDZA 3S5ZA 4C7GA 1EO5A 1JCNA 1QI4A 1TJ2A 1HGWA 4TV6A 1PDYA 1TZ7A 4KS0A 3GIQA 1P0KA 2JQXA 3GNDA 1EYWA 3M07A 4CCZA 1UW9A 4MB4A 6REQB 1JGMA 3EPOA 4A3HA 1MEWA 4J3UA 1L6FA 1FDJA 3QW3A 3K30A 3BJTA 3GH5A 5H6HA 1WP6A 2I16A 3NQMA 2GJNA 3GD6A 3THUA 2EBNA 1S1RA 2GVJA 3HFTA 1HL9A 4JIHA 1NWUA 1AUSL 4PRTA 4LYQA 4KQZA 1NAL1 2J9YA 1U83A 3DC0A 3AIEA 4LSBA 2ETNA 1EYMA 4Q8QA 1JYXA 4G7EA 4QDPA 1DIDA 3LCIA 3MWCA 4D6FA 2EQDA 1VENA 1NDVA 2YXOA 1OX6A 3OGRA 3BLLA 3FYYA 4BEUA 2OR2A 1OG0A 2PTZA 1E0WA 3EDEA 1JAKA 4FHAA 4UTWA 4X22A 1DOSA 4IIEA 2WKJA 4Y8FA 3NXLA 1P6BA 3E49A 4UXDA 3BTNA 3ARXA 3WH9A 3KLLA 3TXVA 4O57A 5DX7A 1TPDA 3MBDA 4IMDA 4A6GA 2Z28A 2J75A 1PXGA 3DYPA 1U79A 3N9KA 3UESA 3ZZ1A 4UBPC 4IUOA 3BUVA 3MO7A 3P3BA 3MV01 2RDXA 2B7OA 3BOLA 4UMCA 4Q8VA 4IL2A 3EWYA 4UQBA 5IM51 3TC3A 1DIKA 2PSNA 1L2QA 3TFCA 2RH9A 2WC7A 4RDVA 3VINA 5A6MA 1T5AA 4Q8WA 2OWCA 3IJDA 2VRQA 2GVEA 4I7VA 4MY8A 2WSPA 3KOZA 2D3NA 4C1KA 3SI9A 3W7EA 1UD2A 3O5GA 1XGZA 4S38A 3WNMA 5F2IA 5C55A 3WMLA 2FVKA 3GG8A 4JFTA 3C2YA 1VJIA 1W9BM 4NNRA 1XYAA 4JFMA 2P3EA 2YCKX 2QCGA 2YCLA 1TWZA 4LUIA 1P0DA 1GVYA 4MUPA 3B8TA 1XIHA 4IX0A 1N2VA 2CLLA 3BLIA 3C3UA 3FYPA 3L65A 3OG2A 2NVDA 4QS5A 1Q13A 4MNKA 2QJMA 4UUIA 1RLDA 1PKYA 2AMGA 2OLSA 4B2DA 4NL1A 1J6PA 3IJQA 2EAWA 5LGZA 3F4DA 3T4WA 3U2EA 1LORA 5CGQA 4D6HA 1WDPA 2FJUB 5I3KA 1H09A 3BJSA 3WDIA 3AMCA 3MPGA 1XYMA 1MXDA 3AIWA 1FY6A 5MF5A 4YTQA 3VU2A 3DHUA 2R94A 1U30A 4O8AA 5AHFA 2Z2BA 3STFA 5A8GA 2PPOA 2HK1A 1HN1A 4DZIA 1XG3A 3FY1A 4UOQA 5KETA 1EJ7L 2CLHA 3AZTA 4DZ5A 4H3DA 2Y7GA 1CENA 1Q4NX 3M7SA 1SW7A 5A1AA 7TAAA 1ME8A 3SUSA 1X6NA 1BFNA 3DDMA 5HPCA 4LC6A 3PTMA 3ZR5A 2DUZA 2M1IA 2X2YA 1XLBA 2E6FA 3UXDA 4YXGA 3RN6A 1MUMA 4ONVA 3AXIA 2NQ5A 1O60A 3VD5A 3BANA 1TSIA 1JCJA 2RGMA 1TUXA 2B7QA 3UWZA 4XAGA 4QT3A 2C91A 1NIUA 1MYRA 4A3QA 4WXYA 4ADSA 1D3CA 3JYJA 3LUOA 3W84A 3AS0A 5JUVA 1ZBWA 2Z6JA 4D6GA 2RUSA 2GUBA 1MW2A 4DO7A 3CQKA 4PTMA 1J12A 1OADA 1X96A 1KM6A 2H3DA 3KP0A 1NDWA 1JYWA 3GSMA 3LN3A 1W3KA 3N4EA 2CLFA 5CSYA 1NY1A 2QPXA 1WQ5A 3IANA 2YW3A 4POCA 4O8RA 3BW4A 3WL1A 2V6AA 2O55A 2ZR6A 3TV8A 3PZNA 2E40A 2X8RA 3SJ3A 3B05A 5GVJA 4D9PA 4R33A 4BF5A 4BWLA 4GVHA 3ZM8A 3EOLA 1HTIA 3ISIX 2YDRA 4C6JA 3FK4A 1T0OA 1JL8A 3OG3A 4AEEA 2ITKA 1A0CA 1YHTA 1K77A 1R9HA 1QCWA 3RMEA 4AG0A 2Q09A 4N9DA 2UZ9A 2NUYA 3SY8A 3BK0A 2VNCA 5JMUA 5FOOA 3CHEA 4K1WA 2PC8A 4ADTA 4ODLA 1C8VA 4OECA 5F4WA 3VFLA 1ADSA 3FW6A 3TYUA 5HR6A 4XZHA 3GDMA 1V3MA 2XPKA 4H9VA 3EB4A 1HKVA 1YBQB 4FNTA 1C3FA 3T42A 1C91A 1S5NA 4RUBA 2D73A 3A3HA 5BRQA 5D9PA 1D7IA 2FQIA 4GYPA 3W83A 4E4FA 2G5WA 2HE8A 4J7RA 3N2TA 3CZGA 4J2MA 3GNPA 5HQMA 4M56A 5AHIA 3MSRA 5BMWA 1QPLA 2ISDA 3T6CA 3BSMA 4JDYA 3Q94A 1EZWA 2HWGA 3E1F1 4IFKA 1ZU8A 3PC0A 1XQKA 1O1HA 3BV7A 3B9DA 1X8FA 5FF7A 5KINA 1ZCNA 2QPUA 3MDWA 1E9LA 1EB3A 4QG6A 4K7VA 3EWDA 2DSZA 1G9HA 2PV1A 1TV4A 2ABBA 1CLXA 5DELA 1HP4A 3TP4A 4O14A 1PZ2A 4XKMA 4Y90A 4ZQRA 4GZ7A 3QHOA 1F3TA 1WNOA 3DGBA 4D1IA 4CUCA 1W8GA 4H1ZA 3IVUA 4DM2A 4H6RA 2QF8A 2VCAA 5XINA 4HA0A 1SGJA 4E3VA 1KCXA 2A7RA 3T7VA 4AIUA 2XUCA 5E0CA 2DVXA 2C1GA 5A8MA 1J5TA 1OFEA 1YNQA 1FFRA 2J74A 3USZA 4B3LA 1NP0A 3DHFA 4H2CA 1TREA 1EWEA 4C6PA 4C6EA 4ZE5A 3UQBA 1REQB 1SUXA 2C7FA 1DKWA 3EOOA 3LI1A 2ZR4A 2PU0A 1Z41A 4IMFA 2J7CA 4EP8C 2FPYA 2V8ZA 4JTKA 3AS3A 3SCUA 1QRQA 5I3IA 3KRZA 1TPC1 5E09A 3M0VA 2WNNA 3POCA 4A3RA 2IW0A 2VT0A 3K13A 3LZ5A 4NJJA 4IWWA 3B3DA 2BVTA 2D23A 2VDGA 3D0CA 4A3UA 2ZXBA 3NSXA 1XLCA 2YXGA 3ZSTA 3BSHA 2VOMA 3U4AA 5D37A 4V1YA 3KVMA 4C6DA 3E2QA 1M04A 4HHPA 3E9AA 1GVQA 1X8CA 1O4UA 4ZPWR 4UQDA 4TNSA 2DW6A 3VYLA 3UWEA 3WBWA 3W71A 1QI3A 4WCJA 3GPKA 4XTDA 3TXZA 2YYTA 3DFTA 4HN4A 3KOFA 4GVGA 3HU7A 3NO3A 2PURA 4GIEA 4F2UA 2R14A 1WDRA 3A3XA 4PUUA 5DIVA 1UROA 2FFCA 3CT7A 2P53A 1US0A 2MANA 4GUGA 2X41A 3EOEA 3NGJA 2IPGA 4DWSB 1YDOA 2RUCA 1OT1A 4GINA 3WBEA 3TJ4A 1BGGA 1HUVA 3NYZA 2Z1SA 4AWEA 2I9UA 4U5KA 3MCOA 1I9CB 4XIMA 1E0XA 4A8RA 4BHYA 2J88A 2ZZ3A 2A85A 1AA1B 3EX2A 1OVDA 1BPLB 3P80A 4JQAA 1NMWA 3NQVA 1JZ8A 4Y9OA 1I8JA 3C8NA 4QE4A 3CUFA 4GACA 3MJYA 1MMFA 4UOJA 4ZMGA 2G97A 1EJUC 1H1ZA 4AD3A 3HIJA 4PUKA 1F2JA 1PL9A 4QG8A 2CBJA 2PAJA 3W3OA 1DXIA 3WZ0E 2PLMA 2CW6A 4IQJA 2PD9A 4EAMA 4AYGA 1D2KA 3H23A 5JQ9A 5I77A 5FEPA 2PA6A 4UTTA 3NSMA 4JS3A 4DBDA 2ZVRA 4UNKA 3SY1A 3HGJA 4HD5A 4GZEA 1HJWA 1H49A 3DECA 4RV3A 1Q66A 2QCNA 3UD6A 1E6ZA 2OT0A 2OODA 1KCZA 5ECVA 5CGMA 3PN8A 4TVUA 4FLRA 4QSHA 4V28A 5HWCA 4KIEA 7XIMA 1IEXA 1XV8A 3VAWA 2OZ3A 1THFD 4GGBA 4GXPA 4GIVA 4X3ZA 4E38A 2ZRVA 4B5WA 3W75A 3PAOA 3KBWA 3VCNA 1FKFA 4OUEA 2MF9A 2PGRA 2EULA 1S5WA 4MLJA 1E1CB 3PPGA 3MCMA 1CW2A 3ZVHA 3TJLA 1O68A 3G0UA 4NAEB 4PMXA 3W0KA 3PG9A 3W70A 4LVFA 5GJNA 1P7TA 4K8GA 2E28A 4MJ2A 1PKMA 1VBHA 1DE6A 4S3DA 2E3ZA 2PCEA 3SCWA 3T2OA 1LOLA 2F21A 3SCOA 4C1LA 3RAOA 2ZUSA 2E6DA 3M0KA 4NHVA 2O92A 1SPQA 3ITGA 3HJZA 3TQ0A 4LAMA 1QOXA 3UR2A 2ZA3A 1JUKA 5HK4A 1UD8A 5T26A 2J78A 3OGSA 2XH0A 3WY1A 2OLAA 3TJXA 3LTPA 3K2GA 1K8CA 1SMDA 1QNSA 3S83A 3PJWA 5G4EA 1MW0A 3JVAA 4LVBA 4GNVA 1EF2A 2ZWZA 1H7RA 4MWAA 1N8WA 1W0MA 5AN7A 1CGTA 4JFSA 4ITZA 2RJGA 1GYLA 2OSXA 3C3NA 3KW3A 3GZ3A 3GU1A 3UP8A 1O12A 3M0IA 2CETA 1V77A 4JQ2A 1ONXA 3HGOA 1RY0A 5J5RA 4ML4A 3NQAA 3A4XA 1KCLA 1EXPA 2DT0A 1K4GA 2Z29A 3T8QA 4ZB2A 3C5QA 5PTDA 1XD1A 2BFGA 5F2MA 4TV5A 3N11A 1M01A 4NSBA 1E1EA 1VCVA 1H3GA 2FH8A 3HPFA 4RE0A 3GG7A 3V1PA 5C8BB 2CU0A 5DANA 3VDHA 2RURA 3OVGA 2JIEA 1TG7A 3E38A 2K8IA 1LL7A 2I7GA 2PDCA 3WQDA 3CZLA 1IEIA 2OZ0A 3ELFA 2L2SA 3WUFA 4CVUA 1DJWA 2OYLA 4PBGA 2ZQUA 3D5HA 4BJHA 1YXDA 4DH0A 1KBBA 3L2LA 2P8CA 3LHYA 1K6WA 4B91A 3PZMA 3PBYA 4K8EA 2P4VA 2H8XA 1QPQA 4PSPA 3T44A 3GVGA 4EPBC 3FAWA 1PB0A 1QW9A 2XN1A 1WAUA 4JTJA 4WKAA 3EKZA 3LXCA 5HW7A 4S39A 3VIIA 3CHVA 4B5SA 4GCXA 3N9RA 4AHQA 4LUTA 4A8IA 1Q8JA 2DIKA 1C9WA 2Y8VA 4FNPA 2ONEA 1XIGA 3RLVA 1Q6GA 2Q3OA 5DMMA 4YIWA 1VIWA 2TSYA 3PWIA 1LRNA 5HPOA 1KGUA 3BPWA 4XZLX 1AH4A 3GG1A 2WLYA 4EXBA 2D0FA 4KEMA 2EG8A 4QTGA 5E0FA 2TAAA 5FJTA 1JFXA 1F6PA 2M2AA 1JCXA 2IMRA 5HNNA 5D2WA 4EF9A 4PGLA 4WIWA 4W4QA 3WIJA 3LZ3A 1DXEA 3C61A 3CM4A 2VZOA 5JXQA 2XVGA 2JK2A 2PTWA 1TV8A 3K1GA 2C13A 1T11A 1NTHA 3ZMRA 4KIRA 4NNAA 4GPNA 4Z1DA 3G1VA 3WUBA 1HF6A 2E9LA 2HPIA 4FS9A 4PA8A 1FKIA 3W7OA 4DJFC 1TB3A 2B7NA 4TMCA 1E43A 4RZ4A 5AKQA 2YL9A 3UG4A 2XP4A 3KS5A 3BMXA 3KUMA 5EL1A 3W6YA 1M03A 3FGCB 3S9ZA 1WUEA 3FJ6A 3M4HA 1WV2A 1XRFA 4L6HA 3IK2A 4EAYA 2V9DA 3NI6A 1HXJA 3M0YA 3MTWA 1XH1A 4NRRA 1TA3A 1ZBCA 1YYAA 3WJYA 5A6LA 4WK9A 2GGHA 3WD2A 5FJIA 3URAA 4QEEA 3VIGA 3CZEA 1YE6A 3G8RA 9CGTA 2BY0A 3OOBA 5AHMA 2NVAA 4M6PA 5I00A 4IHCA 4WR3A 1W5QA 4KPLA 1OFRA 4IPLA 4S3EA 2UZ5A 2Q71A 1G67A 1R3VA 5B7ZA 1J0YA 1F3EA 2CESA 4HNVA 4NT0A 3QLDA 4GIRA 1BKHA 3PPFA 1DE5A 1WOBA 3ARTA 1UZHA 4GQBA 3WMSA 1DPMA 1YKWA 1O66A 3UQNA 4GVFA 2PZ0A 5RUBA 5EB8A 5MKGA 2PFHA 1J6OA 3PS7A 3RU8X 3EOSA 1CZ1A 2VGGA 1VJZA 4W8AA 4YTRA 2P0OA 4IGNA 1M7JA 1QWKA 2EKCA 3W23A 1LUCA 4KWVA 4LAZA 2QJHA 4WY0A 4KCWA 4Z2LA 3TA6A 5DN1A 1CEOA 3NAVA 1K9TA 4OBTA 4S23A 5HT1A 1WBJA 1A5BA 4RZ5A 5AHEA 3BC9A 4CLMA 2GQ3A 1N82A 4D8AA 4A8LA 3L66A 3BARA 4DLMA 4W86A 1VHNA 1E72M 3AIBA 2EKGA 2ASHA 3UY7A 4YS1A 1EGMA 4C60A 2B31A 2XJ7A 1XIEA 4JN7A 5C2XA 3P93A 4CD7A 4UQCA 3VD4A 1BF2A 4PCTA 2ZUTA 2W91A 1IEVA 3THDA 4E2DA 1BTMA 4DWSD 1KB3A 3P5ZA 1TR1A 3CPUA 2C14A 4UWMA 3VX1A 3M7WA 3Q2DA 5DY2A 4XAZA 1TIMA 5KZEA 4RE4A 1K4HA 4P7RA 1E9YB 1RK5A 3UZYA 1LLZA 3RCYA 3PBWA 1TTIA 4CQ8A 4KFPA 3MDUA 1FAPA 4U85A 2CEQA 3UI5A 3WD0A 3GTNA 4LW7A 6REQA 1CNVA 4DRQA 4N19A 2QULA 3OBEA 3S5OA 4FA3A 1UB3A 4XISA 3UA3A 4Q8PA 5CXPA 3CLMA 2VFIA 3PZGA 4XAPA 4UB9A 1J18A 3DX5A 1BVZA 3V7PA 5DBTA 4AC7C 3CZKA 3WL0A 2Y5EA 5HJXA 3H70A 2QCEA 4PTVA 5C71A 5C5YA 1W1YA 3I7QA 5LA2A 4RKAA 4C1NB 5GNXA 5T91A 5LNUA 3SZ8A 3WQGA 1U5HA 3OIHA 1D7FA 1RJRA 2C3ZA 5TBOA 1R3WA 3P84A 1Q85A 2PDUA 5LHEA 2Z1WA 1FKDA 4K39A 4C6CA 1UWSA 3WUEA 4P7NA 1IIHA 3G8EA 3WFZA 1EDTA 4AWTA 4K6AA 3T2PA 1YNPA 3HM7A 3LHVA 4HOZA 4M80A 3T0TA 2VFFA 3STPA 4MB3A 4D1JA 3DKJA 3ORWA 3R8GA 4E4UA 3FXGA 1DXFA 1A3XA 3WF0A 3NPVA 3BXWA 4Z42C 4BWLC 3GU2A 4AZGA 3IIOA 3KHJA 3H7RA 3AHXA 4NZ5A 4WQ6A 1LRTA 3PZQA 4M1BA 3H55A 3GAKA 3S4TA 2JKAA 1ZPTA 4JFVA 4MY1A 2QDDA 3B9AA 3VMOA 5EMKA 5HBFA 4BS0A 5FF2A 1DQUA 3SCPA 3UEQA 3WNKA 1H1YA 1MDRA 3RK8A 1UJQA 3LK6A 5E0KA 1U1HA 3U48A 4LALA 1J11A 5AY7A 3QPEA 5C0QA 3QVQA 1V08A 2XDFA 3QZAA 4ZVJA 1UWAA 4AD5A 3JZUA 1PYFA 2E25A 2POZA 3K8MA 5AZ1A 1N8FA 2YL8A 2EJ1A 2E5BA 1U33A 3VNJA 4U31A 4KKXA 5CSSA 5HUAA 3A9BA 4LV9A 4Q33A 4LPCA 4W88A 3CH9A 3HOJA 4GYPC 2PDHA 5FIPA 1G94A 4IIGA 3JXVA 5FL0A 3V5OA 1JUBA 4N4QA 2YR1A 1OZQA 3N6JA 4ZXOA 3OLDA 4N9EA 3VIPA 5ABHA 1UHVA 4JTFA 1UIOA 2A5HA 3WBYA 4TX6A 3K5XA 4GYKA 4XWUA 2BXVA 1A50A 4YVXA 5CSUA 1T6MA 1H41A 1IR1A 4J3WA 2ACSA 2Z6IA 4AD0A 5CLWA 2OCZA 3F4VA 2WHLA 1L6WA 1S39A 3PTDA 4MZ8A 4PB3A 2DG9A 2D2OA 3LBOA 1Z44A 4N6FA 3GM8A 4LAYA 4CNUA 5G1MA 3TN3A 3EIPA 1ADDA 4IMEA 4WEVX 4C6LA 3UXAA 2PDFA 5A2AA 3UGVA 4L7ZA 4OE7A 2ZXDA 3W2UA 4XBSA 1UKTA 3W72A 4DF0A 4AF0B 1AZ2A 1BWVA 3WFLA 3NQ6A 1LOQA 3AHYA 2FZ8A 1W3LA 3DFHA 5LXEA 3FAXA 3F5LA 1TVLA 3JU2A 4UTKA 1BWLA 2GOUA 2QKFA 2QXWA 1BEUA 4S3BA 4Z2HA 4P7OA 2GYIA 3AIQA 4PTNA 4UR8A 3DFNA 1Z7AA 1ONRA 1TWSA 3GTIA 4CQCA 3E0IA 1NWRA 1XI3A 2VCBA 5E6YA 1M7PA 3O5DA 2V3GA 3NQEA 1ZHAA 1B2YA 1W1B1 4WUIA 4UFJA 4XZIA 5I3HA 1VF8A 4FR1A 4MYAA 4KWSA 4IZGA 1GQNA 2CBUA 1KD0A 3E96A 3UFYA 1XGEA 3AISA 3O06A 1KFCA 4D6EA 2ZYFA 1SJBA 4I90A 3AUJA 2PRMA 3RCMA 4EE9A 1GVFA 1KKOA 3H4XA 3QYQA 4R3UA 2ZZ4A 3WKZA 3EMCA 2V68A 1L9WA 3A4JA 3FHAA 1SVDA 3F03K 1ZZMA 1Q4WA 5A2CA 3IKDA 2HCVA 4LY4A 2Z27A 1AODA 4HNNA 1C9HA 1IE7C 5A8OA 3TOYA 3WD4A 2HXTA 3QPZA 1HGYA 2VI0A 3EA2A 3TC6A 1UOKA 1XFBA 5F4XA 3WELA 3KZSA 2NSOA 3ONBA 3W88A 1XX1A 3K4WA 1TE1A 5IRPA 1QNVA 1BKSA 3GR7A 1UMLA 1GOWA 1YBQA 2RFGA 3LOTA 4JQ4A 4C6QA 4JTDA 2MLXA 4HBKA 3MSYA 1XIIA 1RLCL 4QIBA 2AQWA 1J96A 2VURA 4UZSA 1TMLA 2QUVA 3WD3A 4JQ1A 5AOUA 4JFIA 4O16A 1M68A 3NPUA 3O5MA 3R2GA 4U10A 4KWWA 2WO5A 2PDNA 3VX0A 1T99A 3LM3A 3ARZA 3NDOA 1AQMA 2Q6ZA 2WZTA 5DO2A 4PCFA 1XW8A 2KAUC 1F5ZA 3HJEA 3P8IA 2YLAA 4OWGA 1HJSA 1LLWA 4MSSA 4DXVA 1ENUA 1QK0A 1TCOC 1SO3A 1FWJC 1VBJA 2OEKA 2PF0A 3PR2A 4MTVA 3IPWA 2WZMA 5M1TA 1TZZA 1VYPX 3CTTA 4QHRA 3WJZA 1K3UA 5D09A 5C9UA 1ZRQA 6XIAA 4HPGA 5I3JA 3CYVA 3O05A 3W53A 3MYPA 2BZNA 2F4EA 3WUGA 1FKXA 2HSAA 1UQYA 1AG1O 3W24A 4E8DA 4ZCWA 4GC3A 3PR9A 1VP5A 1XISA 2OX4A 3FKKA 2BODX 2QJJA 1ODUA 1REQA 2XU2A 1O5XA 4FK9A 4YL2A 4IP5A 4GY7A 4MF4A 2NT0A 3CIXA 3ARYA 2FFIA 3CZ8A 5GNZA 4EXAA 4IPXA 2DW7A 4JFLA 1E9ZB 1MRAA 5AYXA 3C2FA 2PP0A 1R2TA 2XYLA 3R79A 3B9EA 5B8IC 1W9UA 4E8CA 3AU2A 1EYEA 4F9DA 1VCGA 2DV0A 1BSIA 4AX6A 1BQGA 1EL3A 1XIBA 2WBKA 5BXPA 3MMWA 3P60A 2CKSA 3HGRA 1I4NA 3M41A 3PWGA 1CTNA 2QDGA 4EF8A 3CB3A 4AZ5A 2Q3RA 1NF7A 3DI0A 3L2IA 2C79A 4B5NA 2ISFA 3W29A 1LBLA 3FS2A 3TMLA 4DAIA 1OGGA 4C02B 5G1TA 4EPDC 1HXVA 2IQ0A 5K9DA 3JYMA 4QISA 4A2RA 4XD3A 1A4MA 1DWIM 3AJXA 1OCNA 3TU9A 1TFVA 2R24A 1YXCA 2WW5A 4KT2A 3GHUA 3RIKA 3W85A 4FMVA 1ZBKA 3DIPA 3LMZA 4PMUA 2A3LA 3P61A 4JHOA 2DIEA 4AMAA 2ZUMA 4R9OA 4FAPA 2FVLA 3D6NA 4NVTA 4KFNA 2VKZG 4HIBA 1KC7A 4DWSA 5AVHA 2NV2A 4S3KA 1IHIA 3HQPA 4RNHA 1IZCA 4FX8A 4IQCA 3TOPA 1IEQA 5BYWA 1UUOA 1DIOA 4OBSA 1JULA 5HULA 4JDBA 5HMSA 1ISZA 5FJRA 2J7FA 3BZGA 4QLJA 3P6LA 3HPZA 4P7LA 4J40A 2VGIA 1E0TA 1LG2A 3DI1A 2Z0IA 2QCDB 1TPH1 4IT1A 3PRBA 2PDPA 4JCLA 1JZ2A 3QGKC 2ACQA 3DH7A 3ITVA 4O1DA 4YNGA 4WJXA 5J8LA 4Q8UA 2ZTKA 3UJRA 2OFNA 1OK6A 4B4FA 1YTDA 5C70A 1KFEA 3VGHA 1BD0A 4OFCA 1R46A 4BZYA 3WH5A 2A7PA 2ZE0A 3ABXA 2Y2WA 1Y5VA 1VFSA 3MSDA 2Y5JA 4OUIA 3TH6A 2A3CA 2J79A 2PODA 3QR3A 2INFA 4CU6A 2ZX6A 2OKTA 3W7CA 3QFWA 5K4XA 4FPSA 4IJBA 2XVKA 3LHUA 1XCXA 4YLWA 2UY2A 1TPEA 2DVTA 1GZJA 1IWPA 1A5CA 3SADA 3A13A 5HDRA 2NQ9A 4UTHA 3P0WA 3UJEA 3VM5A 3ARUA 3I3EA 2Q8XA 4ZXLA 1JCHB 3WQEA 1OC5A 1NDYA 5F1UA 4IJCA 4ODKA 3QQWA 2XSXA 4M3PA 1BKFA 3GDLA 2ISVA 2W61A 2YCEA 1GQKA 4HBOA 3JR2A 4DVOA 4U3AA 1MNSA 1YQ2A 1R6WA 1EQPA 1XDMA 3RX3A 3PB2A 4WF7A 1AJ2A 1E1CA 4IUGA 3QQ0A 2ZDSA 2R6OA 4GXMA 1MI3A 2FTWA 3HQNA 1XM3A 3S2CA 1QUMA 2XG9A 4UQEA 3UF8A 1QW8A 3BGJA 4XUYA 1FA2A 4NAEA 1PKLA 4ZFMA 1XR2A 5IBXA 1U1UA 4P61A 1ZAJA 3OZMA 1CXKA 2EG6A 2V5BA 3DG6A 2HVMA 3U2ZA 3N04A 5A8QA 4W9PA 1KTNA 4U4MA 2C8NA 3UU0A 5GQBA 1VYSX 3V18A 3GNOA 4GFIA 2HJPA 2F38A 2ZRZA 3WLQA 5IOBA 3MWAA 1PTAA 4NI3A 1MQQA 1VPYA 2ZUUA 4OHQA 3GU9A 2B7PA 4S1FA 4X0NA 1HW6A 2ZC8A 5CCZA 2E67A 4HYWA 1S38A 3LPPA 3GXIA 3UCQA 2F6XA 2ZUWA 4S3FA 1RALA 3O5JA 2ESCA 1A0DA 1FWWA 3APTA 3QMTA 1AW1A 2GLKA 1AJZA 5FESA 4PTXA 2QCMA 1QPOA 5H1WA 3WO8A 3QF0A 4JZ5A 2UY3A 4GBUA 2QYGA 3F5JA 1K7XA 2J7EA 3EPNA 2YXXA 3HPAA 1OD8A 2OEMA 3LCLA 3SN0A 2Y63A 1XUZA 3R1ZA 4LY8A 3T9PA 1WXZA 3DBPA 2HNHA 3UWQA 4O54A 3KDOA 4DEFA 1W9XA 3I6CA 3QV6A 1WDQA 4CCCA 2DT2A 3ZJKA 3QTPA 4BI5A 3WFAA 4JTRA 4KRUA 1A47A 3PA7A 1H11A 3VNLA 1F7BA 3NM3A 1B3OA 1FRBA 4JKKA 4V1XA 5HR7A 4JEQA 1VCFA 1V02E 4EXQA 1X1OA 1KBLA 2QIWA 2IUZA 3O5PA 2YDAA 3MHUA 4KGLA 2OQHA 4ODRA 1IYXA 1H51A 4IP4A 2QJNA 1YDNA 5AYZA 4CU8A 1XWYA 3V5FA 2F84A 3HGSA 4URIA 1LQ2A 1NOWA 3PSWA 3LCGA 4NXKA 4AMCA 1S2WA 4AFYA 4FSAA 3O3RA 3LNPA 4HJWA 1AFSA 3UR8A 5FJUA 3GTHA 4TUFA 4LWWA 5BOOA 2Y85A 1RY8A 1QPKA 4AZ6A 4Z2KA 1OEPA 3ZLFA 3TNBA 2F8QA 1H7PA 1X98A 3L4YA 4CNPA 4DYKA 1J93A 2WWDA 1UQZA 4IGSA 1FQ0A 4Z2GA 1B9BA 4ZO9A 3CMGA 8TIMA 4GA8A 4FOJA 4H00A 1E3XA 3CAQA 5FF4A 4OBRA 4KESA 3GC2A 3MMUA 2BHZA 4Z17A 2DZVA 4BI7A 1IIGA 4Z1AA 1JJKA 3VIKA 4GRSA 4GKLA 3PBMA 1G7UA 3W7JA 3NVTA 4JCMA 4D71A 3G2GA 2VX5A 1Q8AA 2VFDA 1FCBA 2E8ZA 3BLFA 1QDSA 3WNLA 3WNOA 1QTWA 4X0VA 3SGGA 2VP8A 2VC9A 3W25A 3W37A 4BQ5A 1NH6A 2ZA2A 1WZAA 4F0KA 3FGCA 2CFFA 3AHVA 4C7FA 1S5VA 3HFYA 3RITA 2BGQA 3EBVA 3ITOA 8A3HA 3MDYB 2GK1B 3FVMA 1XC4A 4XO7A 4OTKA 1FKJA 1TJRA 4KW2A 3TJIA 4WLCA 4AUBA 1IF2A 5AHLA 4PUJA 4YTTA 4QSFA 4V15A 1EP3A 5BU9A 4KFOA 3IACA 2YB1A 8XIMA 1RPXA 3PZUA 2VDIA 5JH2A 4FX7A 1TCMA 2XFYA 1DJNA 4BA0A 4JTSA 3R58A 4LF1A 2OOFA 3AC0A 1JD7A 1SSGA 1SYTA 3N73A 1SFLA 3P82A 4AISA 3BICA 2Y78A 4L9XA 3L0KA 3IJIA 4AZBA 4N7QA 2CZEA 4ERGA 4RPQA 3B03A 3H4WA 3S1UA 1YX1A 4DXKA 4G50A 2VUNA 3EPMA 1NFGA 2XFRA 1YPXA 3KCOA 1LOSA 2EPOA 1OABA 4M6UA 3KCJA 2QJGA 4LS2A 3N9SA 1P6CA 1AQ0A 1SQ7A 2XSAA 3GKFA 4XQ6A 4A3YA 2DZAA 4QRNA 4PMQA 4JOMA 2C16A 3T0AA 1EJTC 9XIAA 3EWBX 3W1RA 3WDRA 3VE7A 4HCDA 4Q7BA 2XISA 4ZSUA 4QLLA 1OF6A 2PDXA 3CL8A 4KERA 3N13A 2PZNA 1R87A 4QXIA 5FJOA 3WMCA 3RRXA 2OO0A 2HVNA 3EMQA 1T41A 5LIKX 3CHDA 4GNJA 2DIJA 2DH3A 1FFQA 4KF1A 1DWGM 4EKJA 5D02A 4QS6A 3CWNA 2X05A 1NF0A 4UIOA 4U86A 3LRMA 3ITYA 1JNTA 1YIXA 1WZMA 2VFHA 3W1UA 4UFLA 2Q8ZA 3TYEA 1QHZA 1IT0A 4OQVA 3CYJA 1DWHM 3AXMA 4H6EA 4ZSTA 2GJXB 1ZS2A 1G4TA 4XBKA 1CPUA 2YDSA 4L4OA 1UWTA 1FD9A 1UJPA 4W7WA 4B15A 2OKOA 2XIOA 2VDHA 1Q5MA 3W2LA 3W87A 3VKAA 2XFWA 1PX4A 1CYGA 2INZA 1GVEA 4JNYA 2J8TA 1GOIA 5BWFA 3LENA 3SW6A 4V2XA 1KNWA 3LUTA 3TR9A 3LTSA 4DO5A 2BASA 1CDGA 4C1NA 3C52A 2BOEX 1XLGA 4IXHA 2ZX8A 4S3JA 4UZUA 3GC5A 4Q8OA 3VOHA 2KO7A 1YDYA 4NJGA 4O1BA 4EPEC 2FJKA 4O52A 3USBA 1E3ZA 1YE4A 4AZIA 4OZOA 5IDZA 1J0KA 4GWEA 4A4AA 1RPKA 4DWDA 3EEZA 2KR7A 3EXTA 4LEFA 4BF9A 1OYBA 3A5FA 4PN2A 3LA4A 4FF5A 1POKA 4DJFD 2NXHA 5BZAA 1G4SA 4N02A 4U5IA 2PPGA 2CKRA 3WH8A 1CGXA 4QP0A 3NZPA 3SCVA 1A5UA 4TX0A 2J27A 4UDMA 4NX5A 4I5RA 1KT0A 3OYZA 1RR2A 2LGOA 1GG1A 1PJ9A 4HSNA 1WB0A 2QCFA 1SMAA 3MMDA 3ZT6A 1VFFA 4HNLA 1Z89A 2HBVA 2ICSA 5HINA 3VKCA 4XX6A 4NX0A 2XH2A 2PRHA 1KV5A 4S2BA 2A79A 3E0FA 2DSKA 1PPIA 3E12A 2H90A 4IQDA 4J4OA 1LWJA 1DTUA 1GRJA 2VC7A 1OB0A 1W17A 2Y7FA 5G4HC 5A5WA 3FNDA 4PC8A 4X9SA 2OGYA 3F5KA 3WYZA 1RP8A 2Y8KA 4PYSA 4ZTYA 3I7RA 5I3GA 3AYTA 2W9MA 2BDQA 3QLLA 4GGHA 3H2OA 3W1QA 1IGWA 4C6NA 2VHLA 4LVDA 4QFUA 5ECUA 4H8NA 2NLYA 3MJMA 5M2FX 3QTGA 4F9JA 3GXFA 4YHEA 3UJ2A 4ODQA 3F2DA 3V35A 2CWXA 4PMZA 3N2OA 4DI9A 4F40A 2ON3A 4PTWA 3QY8A 2CZ5A 4XVDA 2OELA 2YL5A 4JX6A 2GQAA 4W5UA 1L2UA 4MPKA 4IG2B 3GX9A 1ITXA 2IXUA 4EANA 1GPWA 2DZTA 4G7FA 3EDKA 4BF8A 1EJXC 2BVYA 3CO8A 2Y7EA 3ZT5A 3IARA 5I98A 2P10A 4UR7A 4BK9A 5AC6A 3U5UA 3W7NA 4C6MA 2VWSA 4O1FA 4JPGA 4ZE4A 5LA0A 2ZTJA 2V63A 1RXOB 3LBMA 4Y9AA 1P48A 3GS6A 2NW0A 1OQFA 1F8AB 3IVSA 2WAGA 4AF0A 4IQEA 3PY2A 1W1TA 1RUSA 3IK8A 5C2CA 4I5XA 3EA1A 3GK0A 3C86A 1V0MA 4AZHA 1P0NA 2J8GA 4PMVA 3TFXA 3QR0A 3R4IA 4Q4QA 4PCPA 2EGZA 2O9TA 4RW3A 4NP7A 1B4EA 4EIVA 3E0VA 2ZFAA 2R9RA 2G3MA 2FMNA 1UUQA 1UKQA 3PFRA 3UQAA 1AMYA 4ZFCA 2E09A 4J3XA 5CC6A 2VR4A 1HZYA 2AGKA 3IAQA 3ZR4A 5D2TA 5KZDA 5LIUX 4ROPA 5EFFA 1GZ1A 1OD0A 3VMNA 2PU1A 1KBKA 4RDZA 2PLJA 1EJVC 4G6CA 1X38A 5A94A 2FDMA 2F6UA 1V6XA 4XZWA 4K8HA 4CGTA 2KE0A 2PB1A 4REQB 4AHPA 4QZVB 3W7IA 4ROQA 3G1DA 1DTNA 4WY0F 1JVWA 1ZY9A 1NQ6A 4W89A 1TWWA 1E6NA 5EFDA 4K1GA 4XG1A 3AMGA 1HO1A 4JGDA 5I02A 2BX7A 2UY5A 3E2SA 4HPJA 3OLEA 2FTYA 1NQKA 5I24A 4GIAA 2OGJA 1CX9A 3L4WA 4IT6A 4HKPA 3G6LA 2NWRA 2BBFA 1DQXA 4HK5A 4OGZA 1CXFA 4AIEA 4AWSA 3GIPA 3UETA 1GYMA 1BRLB 2DT3A 3UG5A 1BSLA 3M9YA 3F4CA 2W4XA 1D7KA 4EK7A 5HNTA 2FZMA 1C7TA 5FKYA 3WCZA 3U6WA 3DZ1A 2L5HA 2PE4A 4LRSA 5E9AA 1TVPA 1OX4B 2PWHA 4ILSA 4KCVA 3GLCA 1C29A 5HKGA 3HURA 3AWOA 2VUYA 2DG4A 4Z1CA 4I9MA 3NRKA 3H2MA 3BJFA 2XIJA 1UKOA 1MEIA 3S1VA 1G4EA 2UBPC 5EBAA 4UMAA 3M5YA 2QF7A 1RQBA 3VA8A 1FVPA 4UQAA 2NLIA 1MEHA 1ZCCA 1E4LA 1RA0A 3ITXA 3VIOA 1U22A 4KGJA 4IH3A 3LXAA 5HOSA 3O9NA 1M65A 4XB3A 3ZO9A 3BGAA 4GZJA 3ZJ8A 2OX1A 2E6AA 3KADA 1H7NA 4GLEA 2ZICA 2FGLA 2OYMA 2DORA 3WLRA 4QQUA 2CWNA 4PZVA 3UF9A 4PB5A 4ZODA 1Q7QA 1OM0A 2WVUA 3L68A 4R88A 1H62A 3TMQA 1SJAA 1VS1A 4ZB0A 4XZBA 2J62A 4MNJA 1LL6A 1XPYA 2ZADA 3M0MA 4Q6JA 5T9BG 1EC8A 1GYNA 1Q6EA 3NQGA 5H91A 1BVNP 3TROA 3ZWSA 1NWTA 1W5MA 3CEPA 1JQXA 2DGAA 2C19A 4XTIA 2C6QA 2TYSA 3PSVA 3QV8A 2ANUA 2ZBTA 2X0SA 2NVCA 2PWFA 2UWFA 4DN1A 3MQTA 3BCDA 3UZWA 4Z08A 5DT7A 4Q8MA 1W1ZA 1VIZA 3B8DA 1IEWA 5K9CA 1LCOA 5U7SA 3MKVA 3KRUA 3S2MA 1LF1A 1S2CA 3GHSA 3DFSA 5IBXC 1SFSA 4BCEA 3IIVA 1PZ3A 1GG0A 1HIZA 2V2HA 4JFKA 1KTCA 1O5KA 3GXNA 1DORA 3CAKA 1CB7B 1JZ7A 3EA3A 1TWIA 1CIUA 1R47A 3V36A 3WMBA 4DBWA 1P6WA 1W32A 5CC5A 4DRMA 3TSBA 1KTBA 1RHCA 3AI0A 1EUNA 2YLLA 3R5EA 3VNDA 3L4XA 3W73A 3B8IA 3TTYA 3GR4A 3NZGA 5HMFA 3TKFA 1XSIA 4PL2A 1RBOB 1O1ZA 4LB3A 2C1IA 4G1NA 1UR1A 3R11A 4XZNX 2WMGA 4X2PA 4ICNA 1V6UA 3BDKA 4QJ1A 4OU1A 1XINA 1EDGA 3KE0A 4H9TA 1GOXA 1QPNA 2EJAA 4O13A 3VGBA 5G2IA 1F4AA 1D7JA 1GORA 4D2JA 3TSMA 1B6CA 4TQTA 3RUBL 4IT4A 3GBDA 3MHGA 2VVSA 4W5ZA 4C90A 1JXJA 3SCSA 4JTHA 3AUOA 1JZ6A 1K6AA 1I2NA 3VGGA 2IKJA 5C7VA 1JDDA 1V6WA 3IGUA 2WPGA 2YPIA 5CAHA 4O19A 1XIJA 2QCDA 3ES8A 1R2RA 4HARA 3SN1A 3NYDA 3RM4A 3GFZA 3NTPA 2AAMA 1OC6A 3CZJA 3REQB 5D9OA 3TK7A 2VCCA 3LQGA 2PDYA 4MJZA 3L7RA 3MCNA 3M0XA 4WOZA 5I79A 3W7MA 4B90A 4EOUA 4I5UA 3AALA 5AC4A 3WLNA 3T4CA 2WWCA 4US6A 3PP7A 3WQCA 1EJRC 4NUWA 2ZQVA 3SRFA 2KI3A 3SCQA 4ZQCA 7ODCA 2GWNA 1CT5A 1R2SA 4UFMA 3UJFA 1PV8A 6ENLA 3M44A 2ZX9A 3H7VA 1SZRA 4L5ZA 4AB4A 4A22A 3VOJA 4DB7A 3GW0A 4NASA 2QUUA 4NQ1A 1R3RA 4WOQA 3W1XA 1BG4A 3A4WA 4DJED 1P5BA 2PDJA 3SN4A 4G5DA 4J4KA 3HG5A 1R9ZA 3TVAA 3QH2A 4JIQA 4R7WA 4GNKB 4WGXA 3T40A 4M8UA 4JBRA 3TDFA 3JZEA 1KFWA 3VVGA 2W92A 1ROUA 3A22A 4L56A 4DJFA 4Y7EA 4C91A 4V33A 2E9MA 4GJJA 3OODA 3L4VA 1JF5A 2WC4A 3C56A 3ECQA 4XAKA 1XG4A 2WMIB 5I3DA 3S1XA 1V03A 2CLIA 1PS9A 1FKSA 3OIXA 5D03A 1CECA 4CNOA 2HPMA 1JAEA 4FZIA 4E6MA 2H9AB 1E55A 2GDVA 3I10A 5BOFA 2CHRA 3BOFA 2G0WA 1XPGA 1WYIA 2XM2A 4DBEA 5C7HA 4UTIA 3P14A 3W7DA 1Q6HA 1PZ1A 4RL3A 4P8WA 1ISWA 1JFHA 4AXKA 4IOTA 2JBMA 1I0DA 1WZKA 4M5PA 4GI8A 1G6CA 1H60A 3CJPA 5EMMA 1YADA 3KOWA 1V8EA 3STGA 1PTGA 2CLMA 1C7SA 2OG9A 2Z24A 1RD6A 4J35A 1V4YA 2WJDA 5LIXX 4ZOAA 1GKQA 1FH9A 2Y24A 4UTJA 3EWZA 2I57A 5BWAA 2Y88A 3GAYA 4CEUC 2NXGA 3KFTA 2Y62A 2P50A 4ATWA 1W3HA 4B92A 2GDUA 3TQKA 3H7UA 1FWFC 2DFAA 3BAYA 1NWSA 1DHPA 1QI5A 2DG3A 4NZCA 5CBIA 4RW5A 5DO8A 3V0SA 2AWGA 4Q32A 4DO4A 1N8IA 3O7UA 3C0QA 1KGWA 3SBFA 1V3HA 3NL5A 2WCGA 2P5NA 4KWOA 2D24A 1TRIA 4KRZA 4Q4RA 3W07A 1XICA 2WXDM 1B4KA 2J9XA 7REQB 3NQ7A 1TMHA 2P3ZA 5HJLA 4DPPA 4FEZA 4JFUA 2XP7A 2WJZA 2VQUA 5LGXA 4QCEA 4A29A 3MY9A 2RUQA 3VIJA 2Y1HA 5LXXA 1CB2A 2NWSA 4MB1A 2WK2A 2OLHA 3QV7A 3SQLA 3A64A 1PZ0A 5HWBA 3BLEA 2FZ9A 4WDXA 3O0KA 3PZOA 1J6YA 1MZRA 1V51A 4IMGA 2ZA1A 5DF0A 2ACUA 1A3WA 1NEYA 4PB4A 3LMYA 5LSMA 3VOIA 3CBWA 1SU5A 1WDSA 3FA3A 5D38A 4PUWA 1OBAA 2FLIA 3I65A 3WNPA 1UR0A 2REQB 3IJ9A 1KRBC 3CL7A 3VGEA 5IFPA 2ZRXA 1XLHA 4YCPA 1H7XA 1HNYA 2GGGA 4ZQPA 3GTXA 4RR4A 4M1RA 5HNUA 5BXJA 3CC1A 1ZGDA 2HQAA 3G1AA 5CZTA 3SM0A 3QKEA 1ONEA 2PDBA 3W2JA 5TAOA 1CGYA 2CLPA 4ZO6A 3S2LA 4L4LA 1XL9A 3HQ1A 4QLKA 4Q4OA 2DJXA 4S3CA 3W1TA 3MMTA 1RK6A 1W9DM 4MG4A 5I09A 3VIHA 1WKEA 2FHCA 3KP1A 4PSRA 1H2JA 1WDWA 2AL2B 1B3VA 4MWAE 3W9ZA 6TAAA 4WDTA 4AZ7A 4LH8A 3BWWA 1Y65A 2V38A 2PV3A 4QX4A 1TMQA 1MO0A 4CN4A 4JIEA 1SFJA 2J47A 3VC5A 2QAPA 3POHA 1H61A 3T08A 2X1RA 3ZYZA 3OGVA 2XPAA 2XINA 4AD1A 1FHUA 1HJQA 1JPMA 3VD9A 3CUXA 1SFTA 4DNHA 2QCCA 4DELA 3I3DA 4GUIA 3WLPA 1TVNA 2GK1A 3FDGA 2BLEA 2F2HA 4J9JA 3ATYA 3FA5A 4ZTXA 2FHFA 4LTSA 2OQYA 3N4FA 2LKNA 1FWEC 4PE8A 4PMYA 1EDQA 1RBLA 1ZENA 4DRNA 2V3EA 1VAHA 3UR5A 3R7MA 4YPJA 4CN6A 4JEJA 2GZXA 3WQOA 3RFAA 3R89A 4I6VA 1RCXB 2XTKA 3GH7A 1DL3A 4M51A 3IV3A 2JGQA 3KS6A 4O17A 2VEKA 4HNTA 1NMVA 1DWJM 1W1IE 1L6GA 1J0IA 3KAHA 4LAWA 1QPRA 1VEMA 5KSWA 5GPGA 2PDKA 1TIWA 5F1VA 4UFKA 4IPNB 1ZP3A 3WQ6A 4BQ2A 4MPQA 3WX7A 4QEHA 2NQZA 3FSTA 1WO2A 4D8LA 3LSBA 1RZMA 2XM1A 3IUIA 4GO8A 2AKZA 5JH8A 2PDWA 2FZNA 3QW4B 4CN1A 4EVZA 3FCPA 3VNMA 1F9CA 4JTUA 3WLJA 3JW7A 4L72B 1E6SM 2QHAA 3KBJA 4B3ZA 2OFJA 2QV4A 4LV4A 3HN3A 2R82A 3XINA 2WPBA 3VTRA 4HA4A 1PINA 2LLEA 2J24A 3Q65A 1M6JA 3OOQA 4QQ3A 4Q7IA 3TTOA 3DUGA 5BW6A 1JPDX 3VKBA 4AWUA 3F7JA 3JS3A 1G7VA 1OJXA 2J6VA 5GPRA 3WH7A 3M0HA 3KZPA 1MNZA 1NFPA 1OHLA 4GUJA 1MSSA 1W3TA 1AK5A 2RHGA 3BCJA 3KL0A 3VE9A 3RX2A 3FLUA 2W3ZA 4P5UA 1F8IA 1RCQA 3KWSA 3B97A 3RJXA 4HTBA 1W6TA 1EQ3A 2X16A 1JCTA 4DZ2A 3DEQA 4ZA0A 1TV3A 4PBEA 4ALDA 1ROTA 3QY6A 4FXJA 3KVJA 4NYUA 4IIHA 4B5XA 3MUXA 4R53A 1NDZA 2RDTA 2BY1A 2CHOA 3G1SA 1HJUA 3KVLA 1X1NA 3MKKA 2QR6A 4JYEA 2VL4A 4H4IA 2NQLA 3F2CA 3F2BA 4JNMA 1SZEA 5AYBA 3FXYA 1WAWA 3W01A 5M17A 3PZTA 3GHRA 3PNZA 3UXKA 1J4HA 3WD1A 4HB7A 1Q6QA 1WUFA 5DXXA 4KRTA 1FCQA 3C0SA 1EBHA 3BG3A 4FXFA 4LYRA 3K4DA 2GJXA 4DRSA 1F3WA 3N17A 3W1LA 1WXJA 2A4AA 4Y9NA 5JBEA 5B7YA 2FGZA 1YW1A 1EEXA 3RO6A 2PS2A 3QQ1A 2QUTA 1Q6LA 3FN9A 3HMJG 2O0TA 4HYRA 3ATZA 1VEOA 3RLGA 3N4AA 3SRHA 4HNOA 4JY9A 1ISXA 5F4SA 1U5JA 2EF9A 1JZ5A 1A5KC 3PZIA 2V5KA 3CV1A 3QN3A 4GI9A 1IXQA 1W5NA 3GHTA 5DMNA 1QNOA 4HSOA 3GU0A 4FF7A 1D8CA 2BGNE 4ZL1A 4PRWA 1Q7MA 4IFOA 2V0TA 4GJIA 3G0XA 3H2AA 1S46A 2OWXA 3IAPA 1UD4A 1UBPC 4H01A 3R13A 4LXFA 1SO5A 1FP9A 3QZEA 5CLTA 3KCEA 5REQB 3R0UA 4K2SA 5D4YA 2VC5A 1B3ZA 4W87A 3B0XA 1ZJAA 1H7WA 4FIQA 3PPHA 2ZRUA 2O4MA 3P5YA 4DUOA 1MW1A 5JVLA 2WLZA 4F0RA 1PSCA 3UXLA 3MANA 3QPYA 3C0LA 3GZAA