4DWSA

Crystal structure of a chitinase from the yersinia entomophaga toxin complex
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
543
structure length
526
Chain Sequence
GAVPTENIPSPILVEDKYTEETYSRPDVNFKEDGSQGNLSYTATRVCAPMYNHYVGDKTKPKLSAYITDWCQYDARLDGGGSKEEERGRGFDLATLMQNPATYDRLIFSFLGICGDIGNSKKVQEVWDGWNAQAPSLGLPQIGKGHIVPLDPYGDLGTARNVGLPPESADTSIESGTFLPYYQQNRAAGLLGGLRELQKAHAMGHKLDLAFSIGGWSLSSYFSALAENPDERRVFVASVVDFFVRFPMFSCVDIDWEYPGGGGDEGNISSDDGENYVLLIKELRSALDSRFGYSNREISIACSGVALKSNIDQLVANGLDNIYLMSYDFFGTIWADYIGHHTNLYSPKDPGEQELFDLSAEAAIDYLHNELGIPMEKIHLGYANYGRSAVGGDLTTRQYTNGPALGTMENGAPEFFDIVNYMDAEHSLSMGKNGFVLMTDTNADADFLFSEAGHFISLDTPRTVQKGEYAAKNKLGGVFSWSGDQDCGLLANAAREGLGYVADETIDMGPLYNPGEIYLSISEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The BC component of ABC toxins is an RHS-repeat-containing protein encapsulation device.
pubmed doi rcsb
source organism Yersinia entomophaga
molecule tags Sugar binding protein
molecule keywords Chi2
total genus 186
structure length 526
sequence length 543
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2012-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dwsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4dwsA02
2VX5A 1DWFM 3D5HA 4E8CA 4BQ4A 4CKQA 3FY1A 1JZ2A 1C90A 5JIPA 3WL0A 4UZSA 3RILA 4DUXA 1JYVA 3VMOA 2JEPA 2D22A 4PUDA 4W5ZA 3SCOA 3N04A 3VKKA 3WMBA 2XHYA 1O6IA 1OD8A 2J62A 2E8YA 2DH2A 1CNVA 1UR2A 3ZJ6A 3TTQA 4ACZB 3I3DA 5A95A 4LGXA 1ISXA 2J7CA 4PMOA 2Y4SA 3BH4A 4GZIA 3BMVA 1W9UA 2WZHA 1E6ZA 1E3ZA 1E40A 1YQ2A 1TVNA 1FP8A 2TAAA 2CITA 4KGLA 4HPHA 5A1AA 2W66A 1NH6A 2XFRA 1L0PA 1ITXA 4OKDA 2NW0A 2BVTA 2YL9A 3ARRA 1UD2A 2XM1A 3W26A 1V3JA 2FGLA 3OG2A 4XV0A 1BHGA 4PBGA 2E3ZA 4GZEA 3IJ7A 3SCWA 1BG9A 3L2MA 1H1NA 3W82A 5A6BD 4ZXOA 1GVIA 3EDEA 2PC8A 1EXPA 4V28A 3MO4A 1HF6A 1OINA 2OSYA 3EDKA 4TUFA 3ZQ9A 4F79A 4UQDA 2PBOA 3EMQA 1UG6A 2HISA 3CPUA 4GQQA 2XYLA 3T08A 3KE0A 5JBDA 2J75A 1R87A 3MV01 3SUTA 1TA3B 2EXOA 1DWHM 4ZE4A 2ZXQA 1HJVA 1BFNA 1E43A 1Z32X 4MPKA 1BGGA 1AQHA 1KQZA 2ZX8A 1JDCA 3CZLA 1WP6A 2WC4A 1EH9A 2X0YA 4WJXA 4V27A 2BXYA 2BFGA 4PYSA 4AZ6A 3PZNA 1E4MM 4U2ZA 5D9PA 4Z2KA 4YHGA 1PJ9A 3CUJA 2CBVA 2J8FA 4P8UA 1JXJA 2F8QA 1PIGA 4UQ9A 1J18A 4YHEA 3GBEA 3TONA 4NSBA 4KGJA 2XVPA 1J0HA 4JKKA 1LG1A 2D3NA 4MDPA 5EBAA 2CHOA 1H2JA 5ABHA 1E4NA 3F5LA 1VFFA 4MB4A 2OWXA 3VNZA 1ZJAA 1E73M 1Q6DA 2W5FA 2YA2A 3W24A 2JIEA 4LXFA 1EO5A 3B9EA 4HMDA 5A6MA 4AMCA 2GVYA 3TP4A 4OBSA 2J79A 2OYKA 2WCAA 2WXDM 3VO0A 4PMUA 4CN4A 1JFXA 2GDVA 1KQYA 3WNMA 3QHOA 1E1EA 2DSUA 2DSKA 4WSJA 2NT0A 4JHOA 3T0AA 1BVZA 4B15A 1CXEA 5AYBA 3ZSSA 6TAAA 4LYPA 2FGZA 4QCFA 1UD4A 2QHAA 4WK9A 2XWDA 5I5RA 1CXFA 4L4OA 3WH7A 1CENA 1AMYA 3FW6A 4OUEA 4AZBA 2WC3A 1MQPA 4ATLA 2PF0A 1VRXA 2ZX6A 4IM4A 4ACYA 4UFKA 4PCSA 1HJWA 4R27A 1HXJA 4RE4A 1H41A 1CPUA 1WZMA 2CESA 1CYGA 1RPKA 3DYOA 2A3AA 2ZIDA 2D20A 2ZUNA 2G3IA 2ZUUA 1B0IA 5A8OA 1IV8A 3WBEA 4B9ZA 3BAWA 2WSPA 3AIQA 1EQPA 3AQUA 5I3DA 2XG9A 4QDMA 4J7RA 1M03A 2DT1A 1W1VA 1E6XM 4W85A 2ZWZA 1O7AA 3WF0A 4PRWA 5C8BB 1VEPA 3AMKA 3L4XA 1UR1A 3VILA 2PWGA 4QP0A 2GJXB 5CGMA 4A3YA 3AIRA 1CDGA 1EDQA 1BG4A 2FHCA 4C7GA 2WKLA 3CBWA 4D71A 3WFZA 1GOMA 2G3JA 5I0DA 3G6LA 3FHAA 1C3FA 1M53A 2YKKA 5KZ6A 3MU7A 3BGAA 2VQUA 2J4GA 5HBFA 3L2LA 2A3CA 1DWAM 5I79A 3VNYA 3AYRA 1TMQA 3L4WA 3WNKA 3WF2A 3UESA 4CCEA 2EPLX 5CQ1A 1JYNA 1KXTA 3W29A 4AD4A 1PEZA 3WNOA 1GUVA 4IISA 1W9XA 3VM5A 2OYMA 1UWUA 2QPUA 3UCQA 2WANA 3ZR5A 1JNDA 4C7DA 1VAHA 4JL2A 1GHRA 4UQAA 4GKLA 4NRRA 2B31A 4HMEA 4ML4A 4HZ7A 2JALA 6CGTA 5HXMA 4HOWA 4BF7A 1MFVA 2WVVA 3DHPA 1VF8A 1FFRA 1W9PA 1A3HA 5IDIA 3ZR6A 1XV8A 3WY1A 2WBKA 3DECA 4P7LA 3FHQA 5EB8A 1GOIA 1V0LA 4UQCA 2YL5A 3OGVA 1SMAA 3AMLA 3DC0A 2F61A 2J7DA 4H2CA 5DMYA 3WDPP 1XD1A 2YDSA 1QVBA 1OD0A 3PHAA 4HA4A 3SURA 4XX6A 1CGUA 1WPCA 4DUVA 1LG2A 3FN9A 2VUYA 3W28A 4DWSA 4U2YA 3W6MA 4MAVA 3MUIA 3WELA 4JKLA 5M5DA 2WSKA 1JAEA 2FDMA 3PZUA 3VGHA 3HU7A 1BVNP 4MB1A 3BCDA 4W89A 1EIBA 3RM9A 2IXUA 3VGEA 1V03A 3AISA 3ARZA 1EDTA 2VZTA 2ZX7A 1WDSA 3RM4A 3WKZA 1W1TA 5FL1A 4PMZA 4XUYA 2VZOA 4MJ4A 3CUHA 1HN1A 2IUZA 1E5JA 2D1ZA 1E70M 4PUEA 1HL9A 5TD4A 2PBGA 3UETA 1HX0A 4URIA 3MMUA 1W3JA 3GZAA 2ZXAA 3OLIA 1C91A 4TX6A 4H8UA 1JG9A 3WQ8A 2EO7A 3VIPA 3F5JA 2WPGA 1UQZA 1D2KA 1W1PA 3PZTA 4OJYA 2VRQA 3CZEA 1LL4A 3KL0A 4BA0A 2BY1A 1JZ4A 4CCCA 7A3HA 1GJWA 1HIZA 1KXQA 1UD5A 1ZL1A 3MUY1 4H7VA 3UG4A 5LA0A 2WHJA 2WMIA 2PWHA 1L8NA 4A4AA 3WUEA 3GXMA 1GVYA 4AD2A 4IUGA 2DIJA 3GXDA 3N13A 3AI0A 3CUFA 3BCFA 4BZYA 4UNIA 5CG0A 4QFUA 4U33A 3CHFA 5D8ZA 3MV11 4PMRA 3PN8A 1XSJA 2VX6A 4HU8A 2YDQA 3BSHA 1QNQA 4JFTA 2X05A 1EO7A 4EE9A 4DWSD 3ARXA 2E9LA 1TE1A 4AZHA 3M07A 2WYSA 3U7BA 1VBUA 2ZOXA 1RH9A 3ARSA 1WZAA 3T0DA 3LMYA 3PZ9A 3SCRA 5EMYA 4AEEA 2Y8KA 4W7VA 4BQ5A 3NUKA 4L4PA 4H8HA 4UOQA 3E1F1 1SR0A 2WHKA 1XHGA 2VZUA 4UR9A 1EQCA 1UA7A 3QOMA 1KCKA 3ZT5A 5A8NA 2JEQA 5GQBA 4CU8A 1BYBA 2XFYA 4TVCA 1JZ5A 1FFQA 1OGGA 2JF7A 1TA3A 1AVAA 1I1WA 1VBRA 3TTYA 5BXSA 4AZCB 3ZJ8A 3VU2A 3ZJKA 3N9KA 2J78A 3KZSA 3W81A 4BQ2A 1J12A 2WZIA 5EFFA 2WCSA 3JUGA 5FIPA 3D3AA 3AZTA 3U5UA 1UR4A 3SIMA 3THCA 1DEDA 5IHRA 1KWGA 3CHCA 2EPOA 1QNSA 1WDQA 2VT0A 4W8AA 1K9EA 1W3HA 3AMGA 4GO8A 2WWDA 1JZ6A 1B30A 1QNPA 1E6SM 3WSUA 1ISZA 2EEXA 2D0GA 1V6XA 3UG5A 5A3HA 2O9OA 1RD6A 3AHTA 3AZRA 3W38A 5E9AA 3WH9A 4K68A 2CEQA 2QMKA 2X2YA 1UR9A 3L4YA 3GNOA 4BCEA 4PN2A 3GNPA 1Y7VA 4GQRA 2J7EA 1NQ6A 4HZ8A 1MQRA 2WNWA 3MUZ1 2GJXA 2JF6A 1VJZA 5IXEA 5HNNA 4PEEA 2V3DA 3L4TA 4KRUA 2CCRA 2EBNA 4PCTA 3TTOA 1ZJBA 4MNMA 3WBAA 2WMHA 3K8KA 1YHTA 2VOTA 3EDFA 3WD1A 5FKYA 4AZ5A 2PWDA 1MW0A 1H0IA 1CXKA 1E6PA 3VDHA 1XRVA 5F7UA 2DGAA 1DWJM 3N17A 4D6IA 5KEZA 3CH9A 3EMZA 8CGTA 2XWEA 1OGSA 3ZJ7A 4FLOA 4MNJA 3I3BA 5A94A 3ARPA 2Z1KA 3CMGA 3RPMA 2GUYA 1R8LA 2J77A 4X0VA 4JFWA 1H3GA 5FL0A 2G41A 1UKOA 1OT1A 1PX3A 1W91A 4MAZA 3S6TA 1B9ZA 3UEQA 3U7VA 3W37A 3KL3A 2C8NA 1WDPA 1GZJA 1V02A 4PMDA 4UFHA 1V02E 4JZ5A 1QI2A 3AHVA 3IJ9A 5E09A 1J0JA 1QI5A 4CD4A 3KEHA 4JL1A 2AOSA 3BAJA 3OZPA 1EOKA 1GOOA 2XTKA 2E40A 1JD9A 1WKYA 4MJ2A 4EKJA 2O9RA 2YBTA 3PZVA 2XJ7A 5ABEA 1GQIA 2CXGA 1H0GA 1SFSA 3FAXA 1XYZA 3SCNA 3RJYA 3I3EA 1C93A 2J7GA 5A8QA 3CZKA 1VEOA 1EOMA 1FP9A 2Y8VA 4D6FA 5E0FA 3EYPA 4Q22A 3POHA 4GIAA 1JYXA 5CXPA 4U31A 4R5EA 4PMQA 4AW7A 3GXIA 1ISYA 1ISVA 1KB3A 4TX8A 1CTNA 1FH9A 1E15A 1QNOA 2VMFA 4M29A 4J3UA 5JH8A 3ZMRA 1R7OA 4QAWA 3FXYA 4U5IA 1JIBA 1OGBA 1X6NA 3O2LA 2J25A 4ZEPA 3VIOA 1MW3A 2D0HA 1E9LA 2Z1SA 2BHYA 4FLSA 1JAKA 1PZ3A 1BPLB 1BLIA 2XSAA 1G0CA 3SUWA 4HP5A 1UR8A 1C7SA 3VIKA 2V5DA 2W61A 3A47A 4DWSC 5I24A 5FOOA 1UD8A 5BXPA 1WAWA 1XD0A 3VD4A 2EPNA 2ZUSA 4W7WA 2OSWA 2UY2A 2V5CA 3ZT7A 1LL6A 1BYAA 4DM2A 1ODZA 2GJRA 2VI0A 5EFDA 4CD7A 1R7AA 3WD4A 3PTMA 4JFUA 1HP4A 1UA3A 3BLPX 1CEOA 4M56A 2CNCA 2W63A 3ARTA 7CGTA 2JIWA 3VD7A 4MNKA 1GQJA 2WCGA 3QHNA 4F8XA 1GOQA 2YIHA 3AHZA 3ZSTA 3K4AA 3NYDA 2BVDA 1UOKA 1E4LA 3W53A 3LPFA 4E8DA 3WDRA 1Q6CA 4S3KA 1C92A 2DT0A 1PBGA 3CLWA 4WKHA 3RCNA 5I6SA 3W27A 1ECEA 2XIIA 4WLCA 3AS0A 3VMNA 4U5KA 1GHSA 1CIUA 1WCGA 2D0FA 4CU7A 1ZBVA 1DWIM 1MW2A 2YL8A 4D6GA 3AYSA 4OOZA 1XYFA 1HVQA 1OBAA 5LA1A 1E56A 3VM7A 1V0NA 1WZLA 4FK9A 1UWQA 4TVDA 4UFIA 3AROA 2BY2A 1ZU8A 1P6WA 1MXDA 4D1JA 3CUIA 1GQKA 1MYRA 4UQBA 4YPJA 3WFLA 3T2PA 1US3A 4IPNB 4P8VA 4UFJA 1ODUA 1OIFA 5CLTA 1VFUA 1VFMA 1QW8A 2ZUVA 1LL7A 2GJPA 3ECQA 3WQWA 3NCOA 4X0NA 1JZ8A 1E5NA 1QHOA 1QNRA 2J8GA 4MADA 5LA2A 3PTKA 1RP9A 5BXRA 1NARA 5A8PA 3AOFA 2RGMA 1J01A 3WQ5A 3VGDA 5CSUA 3MSDA 3SCQA 1NWRA 1VENA 1LJYA 1W1YA 5D9NA 3SUSA 1I75A 4N0RA 2CHNA 3ZIZA 3ARQA 1KGWA 5E70A 4LPCA 1FH7A 1B31A 1KGUA 2J47A 1QW9A 5GPRA 2WHMA 2VJXA 2DSWA 3PTQA 1ZB5A 3VOCA 3BC9A 1G9HA 3CZGA 1U33A 3CHEA 2V38A 2FHFA 1TUXA 1MFUA 2A3HA 1E72M 2VX7A 2BXZA 3QHMA 4U3AA 1HVXA 3GTNA 2GFTA 4Y7EA 1BGAA 4PTMA 3WNPA 4HA1A 1J10A 1E55A 4YN5A 4S3JA 3EDDA 2XVGA 1W3KA 1UD6A 2Y24A 1HKMA 3WEOA 4JAWA 3UR8A 4M81A 4AD3A 1WE5A 1B3YA 2PI6A 2WZEA 2ZXBA 5DFAA 1CGXA 3A4XA 1WZKA 3GXFA 4WSKA 4AZIA 3CTTA 4PMVA 3SCUA 2CERA 2F2HA 5HDRA 1C8XA 1MVYA 1HJQA 1VFOA 4XZBA 4JCLA 5A6BA 1NWTA 3RO8A 4GXPA 5GNYA 1JDAA 4UCFA 1E0XA 1IZKA 4RL3A 3VIIA 4FLQA 2CKRA 1JI1A 2E0PA 1QHZA 1MQQA 3PZOA 4M80A 3W25A 5ABFA 1OB0A 2C0HA 2BY0A 4ATWA 1GW1A 4PTXA 1JI2A 1BQCA 2VTFA 1UZ4A 3DYPA 3ZOAA 2A3EA 4UOZA 1V08A 3MUAA 1UKTA 2OSXA 1G5AA 1QI4A 2WMJA 3VD5A 2W4XA 4AIEA 5M03A 1W32A 3CMJA 4RE2A 5JIWA 1UH4A 4J3SA 4LQ1A 5I23A 5M17A 1EHNA 2WB5A 6A3HA 3APGA 2J7HA 2JFEX 5A6JA 3VTRA 3M46A 4EAMA 5ABFB 4QCEA 1CGVA 1UZ1A 2DSVA 9CGTA 4P7OA 3U5YA 1WDRA 3GH5A 1J0YA 2VX4A 3T2OA 2O9TA 1GPFA 1LLOA 3M6DA 2WMGA 2XSBA 1JD7A 5HPOA 1EHAA 3VPLA 2NSXA 4TTGA 1PIFA 3K1DA 2XFFA 1TCMA 2VL4A 1J0IA 2VR5A 3OGSA 3WH8A 5HOSA 3WMSA 3N15A 1PX4A 2XPKA 3QOKA 5I77A 2VZSA 2O9PA 3MMDA 4FF5A 3RDKA 3GH4A 2ZICA 3K46A 3WL1A 4NF7A 1BAGA 3WEZA 4A3HA 3N12A 2VVSA 2J74A 4Z2JA 1G94A 2WLYA 4QLLA 3N18A 2GK1A 3VX0A 1X1NA 3WDHA 1US2A 4RE3A 2WMIB 1V3KA 1B3XA 2OYLA 1OCQA 1BF2A 4CCDA 5BRQA 4W84A 3J7HA 2VRJA 2ZUTA 1J0KA 5DT7A 1CLXA 1CLVA 2YLAA 3TTSA 3NDYA 3VDCA 2A3BA 1XSIA 1G1YA 2V3GA 3AIEA 3SCTA 1BSIA 2XUCA 3VIGA 3LPGA 4W88A 5A6SA 1KGXA 4JFVA 1UWIA 3OZOA 5A2CA 1DTUA 3CZJA 2E4TA 3ZT6A 1XSKA 3BMWA 4DWSB 3A3HA 2VC9A 3WF4A 4OZOA 1XGZA 4XB3A 3OB8A 4H41A 3WIJA 2VCAA 1KXVA 2XM2A 1CGYA 1HNYA 2WLZA 3BSGA 3ARYA 4J28A 4D6DA 3OLDA 2QF8A 1QPKA 4AWEA 3A4WA 2AMGA 2E9MA 1KBBA 1I1XA 1E0WA 1W2PA 1F4AA 2ZUWA 1WO2A 2WVUA 3B8SA 2OWCA 2DIEA 5GNXA 3MS8A 3VDBA 4PTVA 5GNZA 1U30A 2E8ZA 1XCWA 2X0HA 4Z2GA 3B9AA 4CGTA 1F4HA 4D6EA 1V3MA 1IZJA 1B1YA 3WUFA 4OBRA 2XVLA 4B3LA 1U2YA 1E4IA 3DHUA 1VIWA 3W0KA 5CGTA 4AD0A 4PSPA 3ALFA 1OSEA 1G01A 3AIVA 5BROA 1QOXA 1CBGA 1QHPA 1LF1A 5M3WA 3IANA 2ZX5A 2WKGA 1GOKA 5A6AA 1HL8A 1TR1A 3PZIA 2DEPA 2BY3A 3WH6A 1GORA 3GH7A 3K8MA 1ESWA 1M04A 1W9DM 2PB1A 2EQDA 5CZKA 1D7FA 2VURA 1KXHA 1TZ7A 4PMYA 2V3FA 4JKMA 1ZS2A 1NOUA 3KWXA 1JGIA 1TG7A 2RGLA 3VIFA 4B3KA 3AJ7A 4DM1A 5BRPA 2WVSA 1UD3A 3EDJA 3RIKA 3WF1A 2ZE0A 4TVUA 4GINA 1HKJA 3VMPA 4CVWA 5A8MA 4UFLA 1JZ7A 3AZSA 4CD6A 2XIBA 5JBFA 4CUCA 2VQTA 4J3XA 1UWSA 1SYTA 3EBVA 5FCZA 3L4ZA 4GI9A 5DF0A 4ZENA 5AC5A 1E6NA 1CGWA 4D1IA 1R85A 3PZQA 1K9DA 3VINA 3AIUA 3QR3A 2WK2A 1C8YA 3CO4A 2FH8A 3AIWA 3WQ4A 2W67A 3MKKA 3BAIA 5CPSA 1AQMA 3WDJA 4M8UA 4AD5A 1BYCA 5D9OA 4B9YA 2WW5A 2VNCA 3CGTA 4CD5A 1QBAA 7TAAA 5IHSA 3BAXA 1GJUA 1SMDA 4JHZA 2JE8A 2QV4A 1CZ1A 4ACZA 4CN6A 5IFTA 1E1FA 4AYSA 1CXIA 2O92A 3THDA 4P8WA 1OIMA 3WF3A 3LPOA 1K6AA 1GNXA 2XGIA 2CBUA 4DUWA 4PMNA 3OGRA 2CPUA 2OLHA 3G6MA 1OT2A 4AZ7A 1W3LA 3OLGA 3ARVA 4MDOA 1HT6A 2MANA 4TOQA 1NOWA 2CYGA 5A2BA 1H11A 2BNJA 1GOWA 1AQ0A 4M82A 4PMXA 3VD9A 4AZCA 5I78A 1QBBA 2DSZA 4W8LA 1B3ZA 2UY5A 3WQ6A 1DHKA 5A2AA 4W5UA 1IT0A 2GK1B 5LYRA 3WD2A 1UUQA 3HMCA 5BCAA 1VJSA 2VZVA 3T2QA 3VGGA 3WD3A 2W91A 1CWYA 2G4FA 3OIHA 4P7QA 2ESCA 5BXTA 1JL8A 3U57A 5A6LA 1ZBWA 2CKSA 1PPIA 4W93A 1XC6A 1K9FA 3KL5A 4GI6A 4EANA 3AMDA 1W2VA 4J27A 4WKFA 4AY1A 4KWUA 2PWEA 3TA9A 2CIPA 2IXVA 5ECUA 2AAAA 2VR4A 4IPLA 4CU6A 3SCPA 4GZJA 1E71M 1HKKA 3SUVA 3MMWA 3WNLA 2G8ZA 1Q4NX 1JDDA 1NP0A 1UWTA 3WN6A 4D72A 3OA5A 3CHDA 4V2XA 2CETA 4MNLA 1H09A 3GNRA 2C7FA 4MB3A 2GDUA 4HOZA 3UR7A 1JXKA 4W86A 4J3TA 4AC1X 1LWHA 3VD3A 1WB0A 1GCYA 2Y2WA 1FA2A 3PZMA 3T0BA 2DT2A 3MSGA 4W7UA 1OM0A 4GI8A 3WDIA 3HN3A 4KRTA 3WEMA 2PWFA 4XZWA 1S46A 3DYMA 1TVPA 3M7SA 1KR1A 1HJUA 2W62A 2YA0A 2BHZA 2HVMA 2YLLA 3ALGA 4WF7A 2ZXDA 3VUPA 2QPSA 5BWFA 3EMCA 4HPGA 3K4DA 4D6JA 5C71A 2G3MA 2X1IA 1XH0A 1HJXA 2XVKA 5D9MA 3IK2A 2ZX9A 1ZBKA 3AICA 5C70A 3GDBA 4J3VA 1FHLA 4Z2IA 2VCBA 3WENA 1V6WA 1Q6FA 3K8LA 5DO8A 4OIFA 1JNEA 2FH6A 2WHLA 3MANA 3QGVA 4E4PA 5JBEA 2GSJA 3VGFA 1Q6EA 4J3WA 2WMKA 4D6HA 2BS9A 3NSMA 4KMQA 2D3LA 5AYIA 1UQYA 1BTCA 2UWFA 5E6ZA 1X6LA 1JF6A 4M1RA 1FOBA 3L4UA 4X9YA 4F66A 1JF5A 3SEPA 4D6CA 3BAKA 2WMFA 4CVUA 3N11A 4HOXA 1GQLA 3AHXA 3RJXA 1V3HA 3RM8A 4HU0A 1R86A 3AHYA 1KBKA 3CZ8A 2VRKA 3AIBA 4WKAA 5FD0A 1JZ3A 2BHUA 4FLRA 1E0VA 1A47A 2YJQA 1CXLA 4ZXLA 2VO5A 3CIVA 3LPPA 4LX4A 1HKIA 4ATDA 3GBDA 3IAQA 2DQXA 4UQEA 5DT5A 4HZ6A 3WMCA 4UOJA 5E6YA 2X8RA 5A69A 4BS0A 1NOFA 2Q8XA 1UKSA 5D4YA 2D2OA 1XCXA 4P7RA 3NJ3A 2NT1A 3AXXA 4KH2A 4N42A 2Y5EA 4Z2LA 1TFVA 3OLEA 3VDAA 2DDXA 2DT3A 1V6UA 4W87A 3W6LA 3NSNA 3S2CA 3T09A 1H49A 4PTWA 3SUUA 4F9DA 1M7XA 2ZUMA 1E6RA 1V0MA 4PSRA 1Q6GA 4BQ3A 4JIEA 4TXEA 5CPTA 1M01A 1UR0A 4GO9A 1J0ZA 2CBIA 1UYQA 1NWUA 1NM9A 1DWGM 1B2YA 1V6YA 3O9NA 1BYDA 3UERA 1QI3A 4H8VA 1OWQA 2YBUA 1FH8A 4QLKA 2WC7A 2VVNA 3W4RA 1B90A 4MB5A 5CPQA 1UKPA 1N82A 1CECA 1ZBCA 4UTFA 5BYWA 3WD0A 8A3HA 3WUBA 4M24A 2CBJA 3WDQA 5CJ5A 3BXWA 1ITCA 1MWOA 3B9DA 3VIJA 4MTVA 3OBAA 1EDGA 3CUGA 3BAYA 1D3CA 4CD8A 5JUVA 2EPKX 1UWRA 3AMCA 1MW1A 1PX8A 4QLJA 2BVYA 4AD1A 2W92A 3VVGA 3N1AA 5AC4A 5E0CA 3SCVA 1VB9A 3ZO9A 4NRSA 1CXHA 4Q7NA 4ZE5A 3FNDA 3AFBA 1KCLA 4P8XA 5D8WA 4AXNA 5A6KA 1FHDA 2QMJA 5AY7A 1J9YA 3NIYA 1NWSA 1PZ2A 2EPMX 1B3WA 4UFMA 2ZWYA 3ZM8A 1V0KA 4AISA 2G3NA 4EK7A 3PZGA 2WBGA 1XH2A 3GYCA 3RMEA 1V6VA 1W9VA 1DP0A 1V3IA 5DEZA 2QLYA 3FAWA 1LWJA 2FHBA 1NP2A 3A4AA 1VEMA 4HA3A 2UY3A 3WQVA 4H04A 4AEFA 1UH2A 2WVTA 2D23A 4U3CA 5CSYA 1CGTA 1H4PA 2XGBA 3SCSA 4TTUA 3AS2A 1E6QM 4B16A 5CLWA 3BLKA 2D24A 3AXHA 2V3EA 4HTYA 2YOCA 4NI3A 1KFWA 1JFHA 2J7BA 4Z2HA 3UG3A 3VGBA 1KWKA 3VX1A 1RP8A 4UZUA 1LQ0A 4LYQA 4AIUA 1J11A 1B3VA 4FMVA 5I2UA 1C8QA 1WNOA 2J7FA 3F5KA 2WM0A 3II1A 3TOPA 4E2OA 4OOUA 3NDZA 4P7NA 4ZFMA 2WWCA 3WH5A 1UH3A 3L4VA 1JYWA 5HPCA 3ARWA 2DH3A 3IAPA 1EA9C 2WVVB 1H5VA 1XH1A 3PBGA 4JCMA 1KR0A 3F4VA 2WAGA 4LYRA 3WNNA 2BV9A 4HMCA 3WUGA 4CN1A 2YA1A 1W9BM 5ABGA 2OWWA 4WIWA 3GM8A 2XVNA 1HJSA 1EGZA 1ISWA 1MXGA 1C7TA 1V3LA 4JFSA 3VIHA 4NZCA 1UHVA 3POCA 3IJ8A 2X09A 3NSXA 1K9TA 2UY4A 2YDRA 4F9JA 3ARUA 1UKQA 4W8BA 2E9BA 3VIMA 1E3XA 3AXIA 3O6AA 2EJ1A 3A6OA 1PAMA 4AZGA 4C7FA 3AS1A 1HP5A 3AS3A 2YL6A 2DPEA 5IFPA 1QI0A 1GONA 4GPNA 3HJEA 2VCCA 4AIOA
chains in the Genus database with same CATH superfamily
3N73A 3ABOA 5AC8A 4B5XA 1F8IA 1DWFM 3D5HA 1B4KA 3SZ8A 1RCQA 4BQ4A 4HK6A 5CSRA 3KRUA 4W5ZA 4QX4A 3WMBA 3KOXA 4HPNA 4P5UA 4UMCA 1XLGA 1V93A 3TNOA 4NYUA 1ZAJA 5AZ0A 2DH2A 1CNVA 4A35A 1TX2A 3V36A 1EJTC 2HVOA 4K8HA 5SWUA 1PKYA 4IIGA 4O53A 4PMOA 2Y4SA 2XP9A 3BH4A 4EVZA 1ADDA 2DU2A 2OZTA 4KGLA 4HPHA 5A1AA 2GL5A 4CNPA 4OKDA 2NW0A 4H1ZA 1UD2A 2QF7A 1TJ0A 1V3JA 1VPQA 3LXCA 3TDBA 2N87A 3KS5A 4GZEA 3NFUA 1Y5XA 4KBXA 1F8MA 4LAYA 4O4VA 2UV8G 3MO4A 3VKJA 4L65A 2HWGA 3L65A 5XIMA 3CWNA 2OSYA 3O15A 4C6DA 3ZWSA 1JPIA 4DNHA 2FB3A 3NTPA 1F2JA 3CO8A 3F4DA 2J9ZA 3OW1A 1VD6A 2PBOA 3DH7A 3E0WA 3M41A 3CPUA 1ZQ5A 2XYLA 3WLKX 2V5KA 3T08A 2MUCA 4NNAA 2VFHA 2JK2A 3PJXA 1TV5A 3L5AA 2CWXA 3MP3A 1R87A 3VDGA 3SUTA 1TA3B 2G96A 2A6LA 5C7HA 4R7JA 4IL0A 1E43A 4L4MA 3IK4A 4O19A 3EWWA 2V81A 4C6JA 1SFJA 3DI1A 4ICCX 1R5YA 4HYWA 1FWDC 3CZLA 1LUCA 3RU8X 2QZRA 2X0YA 3MJMA 4AZ6A 5EMMA 4GABA 3P6LA 1FKTA 1E4MM 4U2ZA 3GG1A 4UR7A 2QUMA 4Q8WA 1PJ9A 5FEXA 1J18A 3STEA 1O4UA 1JDEA 3TONA 5CBIA 5C2GA 1ZHAA 4ES4A 4NSBA 4RW3A 2OOGA 3PB2A 1J0HA 3IACA 2XPAA 3GW0A 4YJ5A 2D3NA 3SSJA 2A85A 1VFFA 4ZQNA 2DZTA 3VNZA 1WXZA 2GSHA 4LUIA 3R11A 4R88A 3ID7A 2ISFA 2YA2A 4LXFA 3QN3A 1EC8A 3C0LA 3LSBA 4GHRA 5G1YA 3JYMA 1OG6A 2OYKA 2I5IA 3K13A 3GNDA 5C5YA 2WCAA 2WXDM 3GB6A 5BZAA 2KGJA 1XIFA 1KQYA 4PB4A 4HBKA 3NL6A 4K1GA 4AYGA 1TPDA 1BRLA 2RSEA 2NT0A 3VNLA 4JTRA 1O66A 1UD4A 4UTWA 3UJRA 4IPIA 2XWDA 4EWJA 2LLEA 4H4IA 3BLIA 3N2TA 1AMYA 3BV7A 5LNVA 2PPOA 4NJKA 3FW6A 4O50A 4WD0A 4IM4A 4ZQOA 3S8HA 3FV9A 4X9SA 3W84A 4S2CA 1H41A 1DE6A 1WZMA 3KZPA 1TTQA 4IMEA 4OHQA 2X1SA 2ZUNA 2G3IA 4MM1A 5A8OA 3EOOA 3WBEA 1F3TA 2QCGA 1JCHB 2XG9A 3I4EA 4QDMA 4DO5A 5K9CA 1PUDA 2OX1A 2CFFA 1W1VA 4W85A 4CNTA 4IMFA 3NO3A 2J9XA 3O6DA 2ZWZA 1XLKA 5C8BB 3S9IA 3DGRA 3AMKA 1I0DA 1UR1A 2A2IA 2PWGA 4FP1A 2GJXB 2E5BA 1FKFA 1TREA 3T05A 1P0NA 2G3JA 2FQIA 1BKFA 3GTHA 5LNSA 2QCCA 3R94A 2YKKA 1FWTA 4GIEA 2OODA 1UJPA 3KHJA 1I8JA 1DWAM 3VNYA 1OYCA 4PR4A 4DRPA 1KM6A 4H9TA 1PEZA 3EWXA 2Y7GA 3O5JA 1UWUA 1KNWA 2WANA 3ZR5A 3GU9A 1AL7A 4C7DA 3S46A 5LIXX 4GKLA 2PBCA 3H12A 4AIBA 3CL7A 3W6YA 3S5ZA 2B31A 4HMEA 4HOWA 2E1WA 4C1LA 2W6RA 1VF8A 3DHPA 3NXFA 4YNGA 2QQ6A 2WBKA 3W2UA 2OPJA 1GOIA 1V0LA 4H9ZA 2F61A 4H2CA 3GR8A 1XIDA 3L21A 3LHWA 1JCTA 1VFHA 2WPBA 4GJJA 2PDIA 3G5EA 2PDBA 3OOBA 1R0MA 3MCMA 1YYAA 4DRQA 3HFYA 1L6GA 1KBLA 4DJEA 3HQNA 1ZENA 4U2YA 1CI1A 3L66A 3IVTA 2QGYA 3WELA 3G1DA 3B9NA 2FDMA 2GGGA 3PZUA 1TTIA 5B80A 4A2SA 4LNCA 2QW5A 4OT7A 1G69A 1ZPTA 4C6PA 3RM9A 5FF4A 2IXUA 4CQBA 1V03A 3AISA 2JKAA 1JCLA 4N02A 3QYQA 3VZZA 2Z7KA 3WKZA 4PL1A 1W1TA 2DZPA 2VZOA 4MJ4A 4Y6GA 4QE5A 1HN1A 3F2DA 2IUZA 2D1ZA 4PUEA 4HSNA 3B4UA 1HX0A 3UY7A 1RD5A 1W3JA 3N9SA 4NZ1A 1DIEA 4H8UA 1JG9A 2EO7A 4ERIA 4O8RA 4A8IA 1D2KA 4OJYA 2VRQA 2BP1A 4IFOA 3EX4A 4PH6A 4H9MA 4PUWA 3KBSA 4CCCA 7A3HA 3FVMA 3STFA 1HIZA 5F4SA 1RY0A 1X1ZA 3K4WA 5HWMA 4ZPTR 4YS1A 3KP0A 1TWIA 1L8NA 4M6QA 1IXQA 2NQLA 1GVYA 1MUCA 4IUGA 3ZWTA 3S4TA 3QPEA 3GXDA 1I2QA 4GVHA 5AHIA 2H9AB 3CUFA 4ODOA 2JQXA 4U33A 2UZ9A 3MV11 3E74A 4PMRA 4WDUA 1XSJA 1IZCA 4HSHA 4HU8A 4JFTA 4TX0A 3CXOA 4DWSD 4MVAA 4AZHA 3W7IA 2VEGA 3ARSA 1WXJA 1OFPA 3T0DA 3VKAA 2DZBA 3PZ9A 5EMYA 3HBLA 1BWKA 1PE1A 1IR1A 4W7VA 5T91A 4BQ5A 2VYOA 4GJIA 3ME3A 3EA1A 3N4FA 1IEQA 4UOQA 2NX3A 2WHKA 3IV8A 3EAUA 3M7WA 2VZUA 1EQCA 3ZT5A 2VKZG 2JEQA 4CU8A 4BEQA 1JZ5A 1OFBA 3V35A 2JF7A 1TA3A 3R13A 1I1WA 1VBRA 2WJZA 5D2WA 1JPKA 3KZSA 1EWEA 2NLYA 4EACA 1A5UA 3FKKA 3RU6A 2WCSA 3JUGA 3V5OA 1Z3NA 1NSGA 1M3UA 3D3AA 4UTTA 2OOFA 2V68A 5IHRA 2QULA 2DZAA 3A64A 3CHCA 1LT8A 4TU1A 1WDQA 1G7VA 4ZOEA 2QJMA 4AY7A 3PUOA 3IIPA 3S1XA 4GO8A 4DWDA 2EGZA 1QNPA 5HNUA 1UIOA 2LGOA 1GG1A 1GKPA 2EEXA 2HPIA 1TPVA 2D0GA 5AHMA 1X7IA 3ITYA 1V6XA 2I9EA 2O9OA 1RD6A 4KCVA 3W38A 4AU0A 2I56A 3S42A 5H1WA 2CLMA 1C29A 4G7FA 4K68A 3KUMA 3L4YA 4K36A 2WO5A 4XO6A 4BCEA 4BHYA 3H7UA 3HO8A 3R25A 4Z42C 1Y7VA 1FWBC 3UP8A 1NQ6A 1MQRA 1GEQA 4EXAA 1FDZA 3CS2A 2V3DA 2ZBTA 3A9BA 4NZJA 1JVNA 2DG4A 3AWOA 2EBNA 4GGHA 2DG9A 1Z8AA 1PIIA 1J4HA 2Y1HA 1MZRA 4IUOA 3EDFA 2OX4A 4AZ5A 1S38A 2Z00A 1H0IA 1E6PA 3VDHA 2YCKX 4NKCA 3A13A 3BTNA 2X1TA 1NSJA 3EMZA 1UUMA 3ZJ7A 3I3BA 3RPMA 4M6PA 1R8LA 3O0KA 1HGWA 2E77A 4JFWA 1H3GA 7REQA 1EZ2A 1FCQA 2FB2A 5AN7A 5DLCA 1F7BA 1U83A 1E44A 4DZ3A 4JNYA 3WLPA 1OG0A 4RR4A 3UEQA 4O14A 3U7VA 1Q7MA 1WDPA 4R9OA 1NDVA 1A5OC 5HWNA 1ENUA 2BGNE 4C6FA 4AXKA 4YXGA 4JZ5A 1V02E 2HRWA 4WZHA 1QI2A 3N3MA 1UB3A 3IJ9A 4KWSA 4C6LA 2O55A 2AOSA 1EOKA 1GOOA 3ATYA 5DRCA 1YLVA 2ISVA 1JD9A 1WKYA 3CYJA 1AODA 4EKJA 2YBTA 3BG9A 3TYEA 3GHRA 5D09A 2XJ7A 3KZ7A 3UJEA 4JN8A 4PA8A 3IJQA 5TF0A 3CZKA 1VEOA 4A29A 2Y8VA 1QATA 3EYPA 1KM3A 4JTDA 4GIAA 3UA4A 4L1XA 1JYXA 4U31A 1S2VA 3STGA 3DIPA 3KRZA 1CTNA 3I7RA 4BFAA 1FH9A 4ERAA 4GUGA 1R7OA 1SZFA 3UPWA 1OGBA 3UWQA 3KP1A 4G2PA 2J25A 4TQTA 5AVHA 3TKFA 4ZEPA 5I7GA 3P80A 4YU1A 1PZ3A 2VFEA 1D7KA 4Q4RA 2Y89A 2CC0A 1IEXA 4S3BA 1AA1B 2XH0A 1ZUAX 2E5DA 4DWSC 3TC3A 2HEJA 3BV4A 1WAWA 2GUBA 3VD4A 2EPNA 4W7WA 2UY2A 3UG8A 3P8IA 4DM2A 4GNKB 4JHMA 2GJRA 4HJWA 1SW0A 3LCFA 3ITLA 4WY0F 3KXQA 4EIVA 1HP4A 1CEOA 5I3IA 1WKEA 1KRCC 3PP7A 4GC4A 1PTGA 2JIWA 4GX9A 2YIHA 3LEPA 4DYKA 3NYDA 1EWDA 2BVDA 1BWVA 5IBXC 1Q6CA 5T9BG 2P8CA 3M5XA 3LLFA 3U4FA 3UF9A 4C6OA 1EX1A 1RBLA 4H3DA 1I60A 3PG9A 4FAPA 3IGSA 4XIAA 4NX0A 4MOZA 3R89A 2J9YA 3G1HA 1F73A 1MW2A 2YL8A 3VCNA 4D6GA 3AYSA 3CGNA 2FIQA 1QO2A 1UP3A 4PGLA 1E56A 1V0NA 4FK9A 3IJ6A 3NTYA 2BY2A 1UPPA 5HQMA 3IKGA 4HKPA 3CUIA 4YPJA 3T2PA 1XP3A 3CM4A 4ZFCA 5F2IA 3T4CA 5CLTA 2TMDA 3RLHA 1N2VA 3GK0A 1O5RA 3VA8A 3P0XA 1FXQA 3WQWA 3CV6A 1X8FA 1KRMA 1JZ8A 3MQTA 3RPDA 1QNRA 2WKJA 2VFDA 3PTKA 5BXRA 1OABA 1P48A 3O5LA 3WQ5A 2VWSA 1T8XA 1W1YA 1I75A 4KRZA 2CHNA 3ZIZA 4GISA 5LGXA 3EKGA 3F1QA 4IZGA 4LPCA 2A21A 4WOQA 1YEYA 1OFRA 4BF5A 4RPPA 4UTLA 1P5BA 1G9HA 3S47A 4US6A 7REQB 2PC4A 3QM3A 1QPQA 2JZVA 3NEHA 3C0SA 2PDKA 3S3GA 3PRBA 2FDSA 3PA7A 3CC1A 2C79A 2VGIA 3GVWA 3FSUA 1BGAA 4Y7EA 3WNPA 3JZUA 4I90A 2E68A 1J10A 4HVXA 4GBUA 1E55A 2XVGA 2QCDB 4L56A 1TV2A 4C6MA 1R3VA 3RITA 3L23A 5K7JA 1XBVA 1ROTA 1U1JA 3SBFA 4AD3A 2WZEA 2PI6A 3P81A 5DFAA 2VEPA 1WZKA 1XLLA 4AZIA 1SW3A 2BSLA 1Q6RA 4PMVA 1TR9A 1T41A 3FJ4A 5HDRA 1ZFJA 1XPYA 3GFYA 1VFOA 4XZBA 3S5YA 3VKBA 3EX2A 3R8RA 1XL9A 3G1SA 3RO8A 3HGJA 3GFXA 1FWCC 2I57A 1E0XA 1IZKA 4RL3A 3VOHA 2IQTA 1MNZA 4FLQA 4NJJA 1QHZA 1EYWA 2OO6A 2PF8A 2R24A 4M80A 3UWVA 3NI6A 4PTXA 4GY7A 1BQCA 3RMJA 5DRIA 3UW6A 2A3EA 4UOZA 4XZHA 4ODNA 3LV5A 1ZJIA 2OSXA 2V2DA 3EX1A 3KAOA 2W9MA 3NPWA 2VELA 2W4XA 4AIEA 1W32A 1P7TA 4LUSB 2DVUA 3VOFA 3CMJA 5JIWA 4J3SA 3VE7A 3WLRA 5I23A 4JX6A 5M17A 3M16A 1EHNA 1P4CA 3APGA 3CJPA 2JFEX 4YVVA 3HG5A 5ABFB 9CGTA 3DZ1A 4GI4A 5HW8A 1J0YA 4DQWA 3M6DA 1K4HA 1OY0A 3W7JA 4DZIA 2XN0A 4FNRA 2NSXA 1Z7AA 4AQLA 2XFFA 3ZVHA 2VL4A 2VCDA 4PE8A 1ME8A 3OGSA 2RUSA 3VYLA 3WH8A 4BWLC 5I77A 1WX0A 2VZSA 3MMDA 4LBRA 1NFPA 3KDNA 3CH0A 4HYRA 2ZQUA 3LLXA 4S3AA 3RDKA 2ZICA 4GQ0A 2QR6A 3G8RA 3WL1A 4NF7A 3CNYA 1S5TA 4OFCA 1F05A 1G94A 3W2MA 2I14A 4JPGA 2PDQA 1XFBA 2RUCA 5HULA 4RE3A 2WMIB 3VAVA 4HARA 1V3KA 2IQ0A 3LU2A 2OYLA 3T44A 3UCCA 2DZXA 3TQPA 4UR8A 3FEQA 4W84A 5IOBA 4WR3A 5HWJA 2C1IA 3W1UA 3TTSA 3LK6A 3IIOA 3EWDA 3U0HA 4ZCWA 3EY6A 2XUCA 1EJWC 2Z2UA 1YDNA 5DMNA 4JFVA 4DO4A 3LY0A 1DTUA 1XSKA 5XINA 1HQTA 1YDOA 4HNOA 1SO5A 1NFBA 4M7TA 5DBUA 3W2KA 4ONVA 3OG3A 2P3ZA 1KD0A 1DIOA 4XB3A 4LRTA 4H41A 1FUYA 1XLDA 3WIJA 2F7FA 3BL3A 3V0TA 2VCAA 1MDLA 4B5NA 4IMCA 5CGQA 1M7JA 2WLZA 5I07A 4D6DA 5AB3A 3QVQA 2BVWA 4F0HA 3HPAA 4AWEA 2E9MA 4HGXA 1KBBA 2ACQA 1DJXA 1I1XA 4H9XA 1YBQA 1XLIA 1XLJA 1F4AA 1WO2A 3N6JA 4Z0JA 1OX6A 2OWCA 2Y7FA 5GNXA 4PTVA 2I16A 3K5XA 4QEHA 3W2NA 1U30A 3BZJA 3SI9A 3LTYA 4D6EA 1V3MA 3BCJA 4OBRA 3LUTA 2XVLA 3PNUA 1EFZA 1DXEA 4S23A 3W0KA 5D2VA 4ZA0A 1PYFA 3H4WA 4FX6M 4DUOA 3ALFA 1R2SA 3LERA 1ZSXA 4REQB 4GIRA 3IUHA 5DCDA 1QDSA 3L0GA 3JYJA 2WKGA 5A6AA 3NOEA 3OEXA 2BY3A 3SM0A 3DX5A 2PB1A 2YPIA 5CZKA 3TW9A 2VURA 1DBTA 2HXTA 4S1FA 4PMYA 4ZPVR 2YXXA 1JGIA 5BRPA 3VIFA 4DM1A 5I3GA 3CEUA 1Y8BA 3SY8A 1UD3A 3GDLA 3RIKA 4QT3A 4PB3A 2MF9A 5A8MA 2P10A 2XU2A 4GCAA 3PUGA 4CD6A 3ITOA 4J9JA 3JS3A 2CWNA 1MEWA 3ANVA 1K9DA 3CO4A 1TRDA 2V67A 1UWAA 3BAIA 5CPSA 1VFLA 1AQMA 1BYCA 3L68A 1AD1A 3GTXA 5AOUA 3S1WA 3CGTA 4ZSUA 5DO2A 7TAAA 4OECA 5IHSA 4HHLA 2ZRZA 2WQDA 2QV4A 1CLKA 4DRIA 4CN6A 1OC5A 5IFTA 2ABAA 2ZADA 1ADSA 1OIMA 6ALDA 2I9UA 3ZLHA 4KIEA 4GH3A 4DXXA 2CPUA 3G6MA 3R8GA 2DZWA 2FVMA 4MDOA 2MANA 4HNUA 4N9CA 2IKGA 1NOWA 4OV4A 5A2BA 1A5MC 1H11A 4ALDA 4CQ9A 5I78A 3WLSA 5C0QA 4LAOA 2Y5SA 2HQAA 1IT0A 4JY9A 4ZQPA 3BMBA 1TCDA 5J5DA 3SECA 3L5LA 3WD2A 5D2XA 1Q45A 3DXIA 1OEPA 3HMCA 4NNBA 3T2QA 1LLWA 5C9XA 3O5QA 2G4FA 2HPMA 3RGCA 1TZZA 2DORA 4YVXA 3T8QA 3PAJA 4OBTA 4CQAA 5U4NA 4I9MA 4W93A 2VXNA 1XC6A 1K9FA 2HS6A 3KL5A 5HWBA 1DE5A 1S3TC 4QIBA 2ISSA 1J4RA 2BASA 2PWEA 5ECUA 2YZRA 4C6QA 1M6JA 2YW3A 4IPLA 4YCOA 4DJDC 4J4KA 3GVRA 4LANA 3M64A 4FXSA 4ZMGA 1E1CA 3AALA 3QPZA 4LOCA 3NPXA 1NP0A 1UWTA 2NSOA 3WN6A 4D72A 1TPUA 2CETA 4MNLA 1X39A 4MB3A 4MYXA 1J2BA 3UR7A 4W86A 5D33A 1LWHA 3VD3A 4XAYA 1WB0A 1MEIA 3WLHA 3PZMA 3P5YA 5AHFA 3T0BA 4W7UA 4MSSA 1YRRA 2CLPA 4KRTA 2PWFA 4YVPA 1PBKA 2B7QA 1SO6A 3DYMA 1TVPA 2PTDA 1HJUA 2NVDA 2BHZA 3C8NA 2YLLA 3ALGA 2ZXDA 4TV6A 4Y9OA 4FIQA 1J4IA 2G3MA 2R82A 3WLTA 2X2GA 4L4LA 3AICA 3TWBA 1MZHA 2Z28A 3EB4A 3GTYX 1O94A 1KM2A 1V6WA 4MGGA 1Q6FA 3K8LA 4OIFA 2PMQA 4QITA 2WOQA 3URQA 4F0RA 3E5BA 2GOKA 3VGFA 4J3WA 3WJXA 2WMKA 4D6HA 1UASA 2D3LA 1UQYA 1X6LA 1PV8A 1XLAA 2EKGA 3SEPA 1M7PA 4X22A 3BAKA 4FHAA 2D9FA 4V15A 1XIHA 1GQLA 4QE1A 3EPNA 3W7HA 4O4WA 1PO9A 4H6EA 3HGSA 1KBKA 1FDJA 4WKAA 5I3FA 3MC5A 1E0VA 1YKWA 4JFLA 1CXLA 1O5KA 5I02A 1HKIA 3IAQA 3W1XA 1SU5A 2H3BA 1U5HA 5DT5A 1BWLA 3S9YA 5E6YA 3TYBA 1LT7A 5A69A 1NOFA 4Q8PA 1P6BA 2Q8XA 2FMNA 2ADAA 1XCXA 4P7RA 4DXVA 4YCPA 3NJ3A 2NT1A 3IJDA 1GVFA 4UMAA 3KBVA 4N42A 1NEYA 3OLEA 3LRMA 4ODMA 2DT3A 3W6LA 3M43A 3I7QA 3S2CA 3T09A 3NPUA 1M7XA 2RDWA 5BOFA 4TXEA 1XDJA 4RXFA 5AHEA 3SQLA 2CBIA 3GU0A 3G22A 4ZODA 4Y8FA 3CWOX 1KT0A 4H01A 1B2YA 5JQ9A 3PWGA 3O9NA 3KHDA 1OWQA 1QJWA 4F2BA 1HW6A 4UTMA 5A5WA 2O7SA 4MWAA 1LP6A 2XIOA 2CBJA 4A3UA 2V2HA 5F2GA 8XIAA 2I17A 1IT7A 3O05A 4QNWA 1ICQA 2F38A 3I6TA 3AJXA 3C8FA 4HJFA 2X16A 4JQAA 3AMCA 1DKWA 1MW1A 1WUEA 3LS9A 3FGCB 4I6VA 3TUUA 3N1AA 5AC4A 2DV0A 4XO7A 3TH6A 3M4HA 1CXHA 4Q7NA 3FNDA 4M0XA 3ZZ1A 3W7MA 1FHDA 1JUBA 3GUGA 2QMJA 3L0KA 1NWSA 1V0KA 2WQPA 4AISA 3JR2A 2V5LA 1W9VA 4GYPA 1TPC1 1YE4A 5DEZA 2QLYA 2OKTA 2FZMA 1NP2A 3CGMA 5HUPA 3RCYA 1ICSA 1LTDA 3A4AA 1H7OA 5FJUA 5CG7A 1MXSA 3WQVA 2UY3A 4R7WA 2FTPA 3LLDA 1XYMA 4H04A 3NGFA 3TZNA 4AEFA 1F3XA 2FZ8A 5TNVA 4DT4A 2J8TA 3UCDA 4NXSA 3U2CA 4U3CA 3VFLA 1RCXB 2PDFA 1H62A 4U84A 1H4PA 2XGBA 4TTUA 5DELA 4HNCA 3W7OA 2E6YA 5HJYA 1KFWA 5EMJA 4AHPA 3RK8A 3BW4A 1RP8A 4UUIA 1VBGA 5AYZA 1XR2A 3B03A 1XLBA 3A9IA 4JTIA 3IGUA 3ITXA 3DFYA 1HG3A 1WNOA 2J7FA 4M51A 4X60A 3TOPA 1FWFC 1Z6KA 3NDZA 3EIPA 1PTAA 4QG6A 2IPGA 4PUKA 3L4VA 1JYWA 3USBA 4HZMA 4ZOAA 1XH1A 3PBGA 2TSYA 3T6CA 3F4VA 4ZB0A 3PJTA 3WNNA 2BV9A 2LPVA 4ODRA 4IH3A 3DFNA 3IHZA 3TN3A 4CN1A 5LNWA 1GKRA 3CQ0A 2RDUA 1D3HA 4WHBA 3TJ4A 3W71A 4AC7C 1ZNNA 5LXEA 5HTGA 1DVJA 5HR7A 4GYKA 3NSXA 1K9TA 4M5PA 3LGEA 5HR6A 1KCXA 2QPXA 1F8AB 2GZXA 3W76A 2XGZA 3TCZA 4W8BA 4Z0SA 3B05A 4E5TA 2QCHA 4GH1A 1PAMA 4AZGA 5G5IA 3AS1A 4C7FA 1LBFA 4LC8A 3AS3A 2YL6A 1IX5A 3W7DA 2QCNA 1QI0A 1AJ0A 1A49A 3DCPA 1EDGA 4AIOA 4DH0A 3FY1A 5KSWA 3FX4A 3WLIA 1C90A 5JIPA 4QE4A 3W3OA 3ERPA 3GTFA 4UZSA 4DUXA 1JYVA 4LUTA 2NQJA 3MZNA 2D22A 3MYPA 4PUDA 1PDZA 1SFLA 2FAPA 3MJYA 1H7RA 1O6IA 3BWWA 4AFYA 1UR2A 3ZJ6A 3ELFA 3MBDA 4ACZB 3I3DA 1ZP3A 5A95A 2J7CA 3CT2A 1MMFA 3OYXA 1H1ZA 4GZIA 1OX5A 2VD9A 4AAJA 5CC6A 1TVNA 3QMTA 3WQPA 3E5PA 2W66A 3CQKA 3G0XA 1L0PA 1EPXA 2DFAA 4DJFA 1IXPA 1OK6A 3HPSA 3T0CA 1I2RA 2Y88A 3OG2A 1YNYA 3IEBA 3VC6A 4Q4PA 5GJNA 1DYSA 4PBGA 3W87A 1EPVA 2KI3A 1BG9A 2ZQ0A 3L2MA 1XGEA 4KWWA 5C7VA 1DXFA 3WQGA 2PC8A 1EXPA 4V1XA 3W1AA 5TBOA 1HF6A 3R10A 1W5OA 3EDKA 4TUFA 1HFBA 2M1IA 4K2SA 1EUAA 1SGJA 3TU9A 4ZS6A 3ZLFA 2G0WA 1P6CA 2QYGA 4KCWA 3EB3A 3PAOA 3NQ2A 1NDWA 1E9IA 2HBXA 5LNRA 5BWAA 2J75A 4QRNA 4JIQA 1TJ2A 3MV01 3KBMA 4O1DA 1DWHM 1LBMA 4HA0A 5K9XA 1HJVA 3AWNA 2NV2A 2BG5A 3E0FA 1SM9A 4JYSA 1KQZA 3D6NA 1JDCA 5C9WA 1WDDA 2BXYA 3PPHA 3M6YA 3DFSA 3H55A 3G3DA 5RUBA 4YWIA 1A7XA 2PWVA 5D9PA 4K39A 1X98A 2CBVA 4IIBA 4F4RA 4J2PA 1JXJA 3NQGA 4G7EB 3GVVA 4Q8OA 3MI6A 4UQ9A 1YTEA 3WBYA 5FEPA 3K2GA 5FJIA 3N2XA 4MDPA 5EBAA 1H2JA 5ABHA 3ITTA 5I03A 4GXMA 4IMDA 1Q3NA 3KOFA 1E73M 4S3EA 2KZHA 3GDMA 4D8AA 1EO5A 4ZSTA 3KAGA 3AU6A 1QAPA 4HMDA 2GVYA 4OBSA 6ENLA 3CUXA 2AGTA 3VO0A 4PMUA 3NQVA 1JFXA 1DJIA 2GQAA 4RJEA 1TPWA 3KDOA 3QHOA 3QSRA 2DSKA 1XYAA 4XSLA 1PSCA 4WSJA 1BVZA 4NY2A 2O4QA 4ITZA 3ZSSA 3IGXA 1Y65A 4QCFA 4JTFA 4WK9A 3QFWA 2P1FA 2CZEA 1BRLB 3B7XA 3PS7A 2HE5A 1CXFA 4L4OA 5D03A 3SIZA 2XH7A 1CENA 1PYMA 4K7VA 3IJIA 1MQPA 4ATLA 2PF0A 2ZX6A 3FIGA 2IKJA 3W7CA 1TELA 1HJWA 5HMSA 4R27A 4L1WA 4RE4A 3OZYA 1O68A 2DIKA 1RQBA 2CESA 4ZB5A 1RPKA 2ZIDA 2D20A 4DI9A 2ZUUA 3V0SA 5DMLA 4B9ZA 2AMXA 3AIQA 1EQPA 3OVRA 4LCSA 3W7LA 5MKGA 5I3DA 1B9BA 1NELA 3MSYA 2DT1A 1RPXA 2VR2A 4HCHA 5ENLA 3WF0A 3O5PA 3IIXA 2VDIA 3L4XA 1HKWA 2O0TA 3VILA 4E2VA 2FLIA 2J66A 5CGMA 2WNQA 2XP5A 1EDQA 1CDGA 2FHCA 4MGVA 4D71A 1GOMA 1R38A 5I0DA 3G6LA 3FHAA 3M0XA 1GOXA 3KFTA 1C3FA 1M53A 4Z1CA 4EPKA 3BGAA 3MVIA 2GSEA 4HT3A 3EGJA 3TXZA 5D30A 3PSWA 5I79A 4C6BA 4DPQA 2YB4A 1WBHA 2Q8ZA 1JJKA 1VPXA 3OO2A 3WNKA 3BQ6A 3AAMA 4KW2A 3FYOA 3UESA 3KRBA 5D37A 4CCEA 5C9UA 2V2CA 3PM6A 1JYNA 2ABBA 2RDTA 1GUVA 3LSCA 5C55A 5D05A 2OYMA 3UCQA 3PUDA 4JL2A 3GDKA 1SZNA 2PP0A 2BZNA 3ANYA 1LZOA 1EF2A 4QHRA 6CGTA 5HXMA 3WQDA 4Q8TA 1K8ZA 1MFVA 5IBXA 2ZQVA 2VGBA 1I45A 3WY1A 1P0DA 4DJFC 1RHCA 3NQDA 4NAFB 3V7PA 3EWYA 4UTUA 4O11A 1J8VA 1L2QA 2XN2A 4JQ1A 1TPH1 3IKDA 1FKKA 2CZVA 2XFWA 4IP5A 3WLNA 5DMYA 1V4YA 5J04A 2WNNA 2YDSA 1QVBA 1K3UA 1A80A 4PTNA 4TX9A 4LVDA 5DXXA 8TIMA 3QC0A 4P61A 4E2BA 1Q5MA 1R46A 4RV3A 3SURA 2D2GA 2ZRXA 3WMLA 4DNMA 2ISDA 1T11A 3H26A 3UXLA 4DUVA 4G8TA 4K37A 1DHPA 5CEWA 4DWSA 2GWNA 1YBQB 1HUVA 3OJGA 5M5DA 4E4UA 4L6OA 3KACA 4GGQA 2E28A 4WUIA 1Q6IA 2ACUA 4XUGA 2D73A 1VYPX 1EIBA 1TTJA 4IMGA 2WZMA 3W7PA 3LCXA 3LCWA 1D9EA 2EPHA 4FA3A 1GTHA 2ZVIA 4FZIA 4XBKA 2RUDA 1GJPA 4UIOA 3ARZA 3RM4A 3DHDA 4Y9PA 5FL1A 1EJVC 3TAKA 4JQ2A 3W7EA 1ITQA 4NU7A 4Q8VA 1E5JA 3LGGA 1HL9A 2RJGA 5TD4A 1NAL1 3UETA 3Q58A 3GZAA 2ZXAA 3OLIA 2PDYA 3E96A 1FWRA 1UZDA 3VIPA 2WPGA 1UQZA 2F4EA 3PZTA 3U9IA 3UQBA 1WDWA 4IQJA 3OPSA 1KXQA 3BARA 1UD5A 1ELSA 5LA0A 2WMIA 3CLMA 1EJUC 3R8HA 1NVMA 2RDXA 4A4AA 3GXMA 2XP4A 2PCQA 2DIJA 4J40A 3FS2A 3EOLA 3QV7A 1NDYA 3UNDA 4NASA 1Z9AA 2WJEA 3CHFA 3LCHA 1F76A 4XAPA 3PBUA 5GJMA 2FZDA 1J6OA 4LVFA 1X8CA 1EQ3A 2EG7A 4LSBA 1EO7A 4UC5A 2Y70A 2F6UA 4EE9A 1RBAA 1GVOA 2GQ9A 3U7BA 1VBUA 7ENLA 1WZAA 4RNHA 4ZO7A 1EJXC 4FNQA 1DJHA 1CX9A 2P8BA 3E1F1 3HV8A 4IWWA 4UR9A 1UA7A 1KCKA 3LYEA 2Z27A 1BYBA 1S1RA 3V5CA 1OGGA 3S1UA 2G5WA 3RX3A 5BOEA 3E6EA 4BR1A 3ZJ8A 3VU2A 4Q7BA 2J78A 3DGBA 4AH7A 1Q6UA 1TRIA 5EFFA 5K4ZA 4Y8EA 5FIPA 3SIMA 3G1FA 4H6QA 2EPOA 1QNSA 1W3HA 2WWDA 3C2OA 1AJ2A 1PZ1A 3DBNA 4ADUA 1G67A 1E6SM 1ISZA 3IRDA 3W7NA 4Z1AA 3KAIA 4DROA 2PDHA 3L9CA 3FEMA 5DIVA 2RH9A 1NJJA 3JVAA 3M0ZA 3CT7A 5BMWA 5A3HA 4FSAA 1FBAA 2W3ZA 2UZ5A 3WH9A 1EGVA 2QMKA 2X2YA 3EOEA 3GNOA 5DCBA 3E2VA 4RNFA 1BEUA 2R6OA 1O5QA 2GLKA 3GNPA 5DY2A 1E51A 4IFKA 4HZ8A 2GJXA 2Y0FA 1VHCA 1VJZA 1TV8A 3PNZA 2OZ0A 3IUIA 3VCRA 5C2CA 3L4TA 4KRUA 2PGFA 2Y78A 1O12A 4S2BA 4WDTA 4CQ8A 5HNRA 1F6YA 2WMHA 5HW6A 2YSWA 2EG8A 1V77A 4ZQCA 1TJRA 1DJZA 3WD1A 4OUIA 2Z1VA 1MW0A 1UC5A 3THUA 9XIAA 2YX0A 1XRVA 1UROA 1XUZA 3RCMA 5KEZA 4CEXC 3CH9A 3KLKA 8CGTA 1ZAIA 3FJ6A 3ARPA 3CMGA 4Q3MA 2GUYA 1XPGA 3O7UA 4ORMA 1UKOA 3QF0A 2ZC1A 3S1VA 2ZA1A 3M0JA 4DXKA 1PX3A 1W91A 3ITGA 1UPMB 3S6TA 2PD9A 3KL3A 3HTWA 3TDFA 3A5FA 1GZJA 1FX6A 3AHVA 4QS6A 3R4IA 4P2VA 2J24A 2X42A 3M0IA 1J0JA 4DEFA 2QUNA 1EBGA 4DZAA 2ZKMX 3BAJA 3OZPA 2EHHA 3S5OA 1FCUA 3LNMA 4DIAA 2E67A 2E40A 3LX9A 2O9RA 2BBFA 3BOFA 1L6FA 5ABEA 2CXGA 1H0GA 3CQHA 1SFSA 1B57A 3CASA 2L5HA 1XYZA 2ATMA 3GNXA 3RJYA 2F84A 3H8AA 3PWAA 1C93A 2J7GA 3W9ZA 1UR3M 1R30A 4UTKA 2ZR5A 4G7EA 1FP9A 4RZ4A 3UPMA 1VHNA 5T8GA 4Q6XA 3R0DA 1MUWA 3W1TA 3LXBA 5CPOA 4FIRA 1ISVA 1KB3A 4GD0A 1DJYA 1QNOA 2VMFA 5I98A 4M29A 1FKRA 3H9RB 4QAWA 4LY8A 1PTDA 4QSHA 4YTRA 1JIBA 3TYUA 1X6NA 4FPSA 3LBOA 3SB0A 3GX9A 4NL1A 2D0HA 4O52A 2XINA 2ZZ2A 1BPLB 3DHFA 1G0CA 2EJAA 3H4GA 4KT2A 1UR8A 2C1HA 3V5FA 3NYZA 1C7SA 3Q67A 1F6PA 3QBUA 3P82A 4K8EA 1XD0A 2P3EA 2ZC8A 3BSMA 3QKEA 3THQA 4I5RA 2ZDSA 4CD7A 1F74A 3JXVA 1JDFA 3TEVA 2OCZA 2YCLB 3BLPX 4M56A 3TQVA 2ZA2A 2RFGA 3SFWA 4MZYA 4L64A 3PBWA 4JTEA 1GQJA 3SRHA 4GK8A 3AHZA 3ZSTA 1UOKA 1E4LA 2OFJA 2YYTA 3DKJA 2ZZ4A 4UWMA 4HQVA 1F61A 2DT0A 3RXZA 5HAOA 3CLWA 4WKHA 4WOZA 4ZZ9A 4XAZA 4HIBA 3B97A 1ECEA 4IQEA 4MPQA 3H2FA 3EA3A 2PAJA 2ASHA 4A6GA 3L7RA 3AS0A 3W7RA 4JTHA 1GHSA 1CIUA 1G4SA 1XYFA 1HVQA 5FF0A 3PJWA 1W5PA 3NVTA 1WZLA 2GJNA 3R2GA 4UFIA 3AROA 4JOMA 1YATA 4F0LA 1MXDA 1SO4A 3OQ8A 4UQBA 4CLMA 1PS9A 1A5SA 4IPNB 4PTDA 5CSSA 1QPLA 3NZPA 3B4YA 1QW8A 1JPMA 3UWYA 2GJPA 1ITUA 4O16A 5LGZA 1S5MA 3EKLA 1QHOA 3DDMA 3UQNA 1K7FA 1LDCA 4JXCA 2VEKA 1RP9A 3O5KA 5FSEC 1X96A 1IIHA 3H54A 3MSDA 3SCQA 5CC3A 1VENA 4UCGA 4PBEA 2ETNA 1LQAA 1FKSA 1QXLA 4N0RA 5HJXA 5KZMA 4JTCA 3GC4A 2DVXA 4WXZA 1KGWA 3UYCA 1T6MA 1FH7A 3XISA 1QW9A 2INZA 2VJXA 1ZB5A 3BC9A 5CPNA 2IF4A 3CZGA 5AECA 2QCDA 2QVNA 3CHEA 2OQYA 4MKSA 3APYA 2FHFA 1TUXA 2A3HA 4V1YA 1XLCA 2VX7A 2DQWA 4NG3A 3QHMA 3DEQA 1HVXA 3RLVA 2X0SA 3CTLA 3GTNA 2GFTA 4RZBA 1TTPA 4WRHA 3LHUA 1W3IA 3NNTA 4Q4OA 4DRNA 4GKTA 1HKMA 3EEGA 3LENA 3UR8A 3W85A 4M81A 3WYZA 2PGRA 1WE5A 3NL2A 1CGXA 5FJJA 3A4XA 5B7ZA 2CERA 1C8XA 1MVYA 1T5AA 3TJLA 4GIVA 3PR9A 4JCLA 5A6BA 1NWTA 5DIUA 3W00A 4RDWA 3VZXA 1P0KA 2BOGX 4IQLA 4Q8UA 1ZALA 4XKYB 3RUBL 1SJAA 1MQQA 2ZRYA 2CLEA 3F7JA 5ABFA 1Q6LA 1OB0A 2BY0A 4ATWA 1GW1A 4GFIA 2KX9A 2AL1A 1W3TA 2VTFA 2HROA 3ZOAA 3PANA 1Y5WA 4G1NA 1JPHA 4FEZA 4KFOA 2NX9A 1Q63A 1G5AA 1QI4A 2WMJA 4PCFA 4HPXA 2PPPA 5M03A 1P43A 1O60A 3H2AA 2KE0A 5CC5A 3HURA 2ZA3A 4MLRA 1A4MA 2FKPA 4N9BA 2B4GA 1P7TB 6A3HA 4QJ3B 1W6TA 1XISA 5A6JA 3VTRA 3M46A 4AX6A 4PULA 4QCEA 2CZ5A 1CGVA 4LWWA 3U5YA 1ONXA 5LIYX 1WDRA 4WGXA 3MHGA 2WM1A 1GPFA 3MW7A 2XSBA 3NZQA 3BPWA 2QJIA 3QR1A 1JGMA 2G95A 2QJNA 3JRKA 3WLOA 2A3LA 3KW3A 3WMSA 2NVAA 3QOKA 3NGJA 2PRLA 3KVLA 3GH4A 5JXQA 3K46A 1UMYA 3WEZA 3N12A 4MZ1A 1PINA 3DG6A 4Z2JA 4QIUA 1R3SA 1LOLA 3CV2A 3M0LA 4QLLA 4PBFA 1JVWA 1AD4A 2GK1A 4FX7A 4JTAA 2NX1A 3N29A 1S5VA 3VX0A 3RPTA 3LD5A 4GOAA 4UNKA 1E0UA 2P76A 5LHEA 5KMYA 4M1BA 6TIMA 1BF2A 3QR0A 1WOAA 5BRQA 2ZUTA 3OIXA 1J0KA 5DT7A 1CLVA 2I5QA 3LTPA 3BE7A 1G7UA 1YPFA 2B7NA 3VDCA 1XSIA 3OTRA 3BLOA 3AIEA 1VLIA 4ZQMA 3WO8A 5A6SA 1KGXA 3TLLA 5GPGA 1VJIA 3G3MA 3G1AA 1I2NA 1D8CA 4IL2A 3P84A 5J5RA 3C2RA 4Z1YA 4ODKA 5PTDA 3DERA 1M1BA 2BOFX 3NZGA 1FJDA 4LTSA 1S2CA 4IQCA 3ARYA 4LV4A 3G1YA 4RKAA 2QF8A 1A50A 3A4WA 3SRDA 1I6NA 3M0YA 1XBZA 1Z89A 1PB0A 1Q6HA 1W2PA 4W9PA 3KOWA 4XAKA 2VC5A 1QR7A 3O6CA 4JQ3A 3B8SA 4IJCA 2DIEA 1R3WA 1XYBA 4LAWA 3VDBA 5C9ZA 5GNZA 1POJA 2E8ZA 4CNSA 2X0HA 2WJFA 4LAUA 4CGTA 3EEZA 1IZJA 3FAPA 3RG6A 3H21A 4CQDA 3B0UX 1DIKA 3ONCA 1U2YA 3O16A 1E4IA 5D38A 4CNUA 1J79A 5EY5A 5CGTA 4A21A 4PSPA 4DY1A 1KO0A 1G01A 4Q4MA 5CKSA 5BROA 3UGRA 5M3WA 2ZX5A 1HL8A 4DZHA 1TR1A 3I68A 3UXKA 3WH6A 3GH7A 2EQDA 3N2CA 1D7FA 2ZZ6A 1ZCCA 4O17A 4DJED 1P0EA 3LV6A 3HFTA 4JKMA 1ZS2A 2RGLA 3GIPA 1X1OA 5D02A 4GINA 5LZLA 2HBVA 4UFLA 3AZSA 3EWBX 5JBFA 4J3XA 1SYTA 1GTEA 1G4PA 3L4ZA 4GI9A 5DF0A 1E6NA 1EKOA 1R85A 3PZQA 3QYSA 4GYPC 3W1MA 4C1NA 3VINA 2WK2A 1QO5A 3WQ4A 4WDXA 4AD5A 2NXHA 5D9OA 2YFOA 2MNRA 3GRIA 4JHZA 4ACZA 1K4GA 4XD6A 3W01A 1FKGA 3SAZA 3T78A 4P8WA 3F4NA 3W7QA 4CNNA 4GACA 4DRKA 1GNXA 2XGIA 4C02B 2XPBA 4DUWA 5LIWX 5BNKA 1FCVA 4OE7A 4AZ7A 2H3DA 3LBCA 3O0FA 4R7OA 3NOYA 3FJLA 4JTQA 4TOQA 1OCNA 3IWPA 2CYGA 3SW6A 3TN6A 1FKWA 4DN1A 3E3HA 2BNJA 1AQ0A 3TOYA 3M0HA 3VD9A 4TMBA 4AZCA 4W8LA 4B2DA 1ADOA 2AQWA 1DHKA 3M9YA 4W5UA 1HTIA 3E9AA 4RCXA 1SFTA 4W9TA 2C16A 2GGEA 3UJ2A 2GK1B 2TYSA 2YDAA 5LYRA 4QAIA 3CK5A 1S2TA 1UUQA 1Q13A 5BCAA 2ZVRA 3WH0A 3EXRA 2AL2A 2VZVA 3BJTA 1YMYA 4DJDA 1RA5A 3KTXA 3OIHA 2ESCA 4GYFA 3M5ZA 3U57A 5A6LA 5HUAA 2IW0A 4PB5A 2PV2A 3C2EA 4EANA 3LBMA 4GI6A 4JX4A 1RSCA 3TMLA 3AMDA 5E93A 1UZHA 1UW9A 1M7OA 2IXVA 3GKAA 2GPTA 2Z29A 4H7ZA 2VR4A 2R9RA 5AVNA 3SCPA 3WLQA 1E71M 1OK4A 4I7VA 3MMWA 2Z2BA 3MI3A 2Y5JA 4Q8NA 2G8ZA 1QNVA 3QV8A 1JDDA 5HUOA 3B9OA 4TO8A 3OA5A 4V2XA 1JPDX 3ZS4A 1H09A 2PDXA 3GNRA 2GDUA 2V5BA 4AC1X 3CL8A 2QXWA 3AUJA 3FDGA 3WJSA 3GS6A 2F6XA 3BOXA 1XKJA 1Q8AA 1FA2A 4XKYA 3VCCA 2DT2A 2NUWA 2VFGA 1AZ2A 3P7YA 1OM0A 2J6XA 3WDIA 3HN3A 3G0UA 1YX1A 1VFSA 3M7SA 1PCWA 3DKLA 2VP8A 3O3RA 4JNZA 3ABXA 2EF9A 3GE7A 1ZCNA 1YIXA 4ZB2A 3C2FA 4HPGA 5LNUA 4DRMA 3K4DA 4D6JA 2XVKA 2R14A 2QV5A 5D9MA 2C15A 2C13A 1FWIC 3PWIA 1P5QA 1FHLA 2RUQA 4Z2IA 3QGVA 4ERGA 1B5TA 1GQNA 4R3UA 3GG8A 3GAYA 1Q6EA 1XUUA 4O28A 3W86A 1IQ8A 2BS9A 2DG3A 2UWFA 5E6ZA 1U1UA 2FZBA 4X9YA 1ZCOA 4D6CA 2P50A 3N34A 3A12A 3YPIA 3RJXA 4DAIA 1NU5A 4O57A 1O1HA 1R86A 4QZVB 3AIBA 5FD0A 2HXUA 3LHYA 3IUDA 1A47A 2FZ9A 4X3ZA 2VO5A 3UXDA 3O5IA 4ATDA 1W1IE 2DQXA 1FKDA 2PA6A 2QUVA 1DPMA 4UOJA 4BS0A 4GVIA 1H50A 3GKFA 1D6OA 3QRHA 3BMXA 4H9YA 3AXXA 2OLAA 2CLOA 3B8TA 3RHGA 3LRLA 2BGQA 1TFVA 1KV8A 2DDXA 1V6UA 1NMVA 3M5YA 2HV5A 3SGGA 3W1PA 4IJRA 1IIGA 4LUSA 4GFSA 1E6RA 1V0MA 1Q6GA 4E38A 4PC8A 1M01A 3WLMA 1UYQA 2ZZ7A 1NIUA 1K7XA 4F2TA 1AMKA 3T9PA 1V7AA 1NF0A 1FH8A 4QJ4B 4QLKA 5G2IA 3B8IA 3W4RA 3FVDA 4EXQA 2C18A 3CHVA 1XXXA 2AL2B 4MB5A 3QQ0A 4NAFA 1CECA 1ZBCA 1XCFA 5BYWA 1K70A 7TIMA 4IIDA 5CJ5A 3WDQA 2G3FA 2BX7A 3REQA 4R53A 1MWOA 1GVSA 4N7QA 4DRJA 3VIJA 3OBAA 3FCPA 1HXVA 5DMMA 3P8JA 4AF0A 1EXBA 5CAHA 5CBJA 4CD8A 4HBEA 4LJ3A 4QLJA 5G4HC 4JFMA 6XIMA 6REQB 3UT0A 2PURA 2ZRUA 2W92A 5CH9A 5CBBA 3SCVA 1VB9A 3ZO9A 4DBSA 4AWTA 4ZE5A 3UWEA 1ZY9A 1XI3A 4P8XA 1BQGA 4ASTA 2IMRA 1TUFA 3GHUA 3TZFA 1K7EA 3NIYA 1W1ZA 1PZ2A 4LC6A 4WVXA 3LTSA 3O6YX 2G3NA 4EK7A 4CCZA 3PZGA 1V6VA 1FD9A 1DP0A 4KR0B 4XVDA 1XRTA 2J88A 3BUVA 1QFEA 2FMOA 1WA3A 2D23A 4K3ZA 4NAEB 3D47A 3BVJA 4XSMA 1FRBA 5CSYA 3SRKA 4QSFA 4AB4A 3SCSA 3QTPA 1Q65A 3KBNA 2X30A 3AXHA 2V3EA 3S9ZA 1OZMA 2Q6ZA 3VKDA 3LMZA 2WSRA 3T0TA 2TRSA 3A23A 2B5UB 1H7NA 1JUEA 4FAMA 3N4AA 5BXJA 1B3VA 4QG9A 4C90A 3P60A 2VENA 4NUWA 3II1A 1GG0A 2CLIA 2PV1A 1ML1A 1UH3A 3CV7A 4R33A 3ARWA 1B3OA 1VR6A 3IGHX 5DN1A 2QEZA 3UWWA 1LWIA 2VD8A 3FLUA 4IQ2A 2BB0A 2QUUA 4HMCA 3WUGA 3S5SA 3FA3A 2YA1A 1Z48A 2E5CA 4XKMA 2XVNA 3LOTA 1XINA 3WJYA 5U7SA 5F1VA 4F0SA 3W74A 4UNLA 4TW8A 3H7VA 1L9WA 2P88A 1F3EA 2Y61A 2ATSA 1RUSA 1UKQA 3GIYA 2E9BA 1JUKA 4IQDA 4OV9A 4HK5A 3A6OA 3AXKA 4HTBA 1TYGA 3W1NA 2Q3RA 1VCFA 3S6DA 4W9OA 2M2AA 3HJEA 4AZCB 3GHSA 4XWUA 3QV9A 3C5QA 4K38A 4E8CA 2PTZA 3FOKA 5DBTA 2POTA 3IIZA 3TNBA 3UU0A 3RILA 4A2RA 2JEPA 4QM1A 3LB0A 3LGDA 3N04A 1FKIA 2E8YA 3A24A 4MUZA 3PRAA 4OGZA 2Z4GA 3T40A 3LHZA 4FF7A 2XZ9A 3C52A 1C9HA 3TTQA 1PZ0A 4LGXA 1ISXA 3LN3A 3W02A 1BF6A 3BMVA 3TVAA 2WZHA 3XIMA 1E3ZA 1E40A 2TAAA 3F4WA 1RLDA 2QDDA 2CITA 2FJKA 3E0LA 1SPQA 3RRAA 1NH6A 2XFRA 2Z7GA 4E3TA 1ITXA 4KWVA 2BVTA 1M5WA 3ARRA 3UZJA 3R58A 3NRKA 2PSNA 1KTCA 3GNNA 3VNMA 2HDJA 3FYYA 4XG1A 4XV0A 1BHGA 2E3ZA 3IJ7A 2BODX 1S2WA 3W82A 4XQ6A 2DP3A 5A6BD 4ZXOA 1IHIA 1ECQA 4V28A 3TROA 7PTDA 3W83A 3ZQ9A 4ZVJA 1JCYA 1YW5A 2MLXA 4IFKB 4DB7A 2CU0A 3BG3A 3EMQA 4KWOA 3C86A 3KCLA 3WBXA 1LOSA 2HISA 3U2OA 2XN1A 6REQA 3LXAA 4I7UA 4MJMA 3ES7A 2ODOA 3SGUA 3RFWA 4ZL1A 5JBDA 1LROA 1TPB1 1FQ0A 2OU4A 2ZXQA 4AMAA 1BFNA 1DTNA 3W07A 4MPKA 1RK5A 1AQHA 4WY0B 4YTTA 3H2OA 1OC7A 1WP6A 2WC4A 1XIBA 4WJXA 2BFGA 1AH4A 3HG4A 4PYSA 3N25A 1T99A 3PZNA 4Z2KA 1GYLA 3BJFA 5JH1A 3PB0A 3GWQA 3CUJA 3WBWA 5HA7A 1AH0A 1REQA 4P8UA 3CEPA 2Q01A 1QMLA 5C54A 3WJZA 1A5KC 2DZUA 4YHEA 3MHFA 4B91A 5E9XA 4A3QA 1XYLA 2XVPA 1LG1A 2HS8A 5REQA 1E4NA 3F5LA 3L67A 4MB4A 2OWXA 1ZJAA 3DESA 2W5FA 1BXNA 3AO0A 2DW7A 1JNSA 3P14A 3DUGA 5A6MA 1KFLA 4AMCA 3I10A 4FS9A 3TP4A 3S5NA 4L5ZA 2J79A 2A0NA 4DBUA 1EJ7L 2PLCA 4CN4A 5C6MA 5IRPA 1EP2A 1IR2A 2LKNA 3WNMA 1F6KA 4QT2A 3NQ6A 3KRSA 3T0AA 1A5NC 3W2LA 2TPSA 4JEJA 4O1CA 4RZ6A 2FGZA 4NZ4A 1J4EA 4GUJA 5LIKX 2E09A 3DOPA 3TAOA 3B06A 4UXDA 5K2ZA 3IARA 3HMJG 3IS4A 1H5YA 3TWAA 2WC3A 1VRXA 4ACYA 4UFKA 1ZRQA 4JIPA 2PDUA 1BD0A 1CPUA 3UI4A 3KCOA 3DYOA 2A3AA 1B0IA 4MSPA 1AW5A 3IRSA 3PSVA 4K8GA 2WSPA 3TSBA 4HB7A 5FAJA 1G6CA 3PC0A 4L80A 3DFTA 5I00A 1YXDA 4JIRA 3T4WA 3VI2A 2EG6A 3GLCA 3W72A 2ONEA 1BG4A 2REQB 1TQJA 2JBMA 3W1QA 1A4LA 1HL2A 1EP3A 3G2GA 5DITA 3WFZA 4GA8A 4I6KA 4XBSA 3HJZA 1SVDA 5F2MA 2VWTA 2QIIA 1HO1A 3A21A 1J2WA 4JBRA 5KZ6A 3QY7A 3MU7A 2VQUA 4YYCA 2J4GA 2DUXA 3BDKA 3EXTA 4S3DA 2HSAA 3AYRA 4PFHA 4WX2A 2QCMA 3JZEA 3BLEA 2XZ7A 4IISA 2Y7DA 1KBIA 2QPUA 4PFMA 2ZTJA 1VAHA 4UQAA 1GHRA 5G2HA 3P74A 4FN2A 4NRRA 1DOSA 1FWSA 4J1OA 4ML4A 3SN1A 3LI1A 2JALA 4BF7A 5J6EA 2HTMA 1QW7A 1XQKA 1A3HA 1W9PA 2WVVA 5IDIA 3ZR6A 2X7WA 3TR9A 2DUZA 1A0DA 3O1NA 3FHQA 4P7LA 5EB8A 4UQCA 3OGVA 2OT1A 1Q7ZA 3AMLA 3DC0A 3CAQA 4FNTA 4XZ9A 4LH8A 3WDPP 1XD1A 4IT6A 7XIMA 2R94A 3PHAA 3R6IA 1Q2RA 3WZ0E 4HA4A 2AKZA 1CGUA 2BXVA 1LG2A 1TX0A 3W28A 4QQ3A 2HE8A 4O0KA 2WSKA 1BVWA 3UI6A 3VGHA 1TJPA 3HU7A 1YE6A 2I7GA 1R3TA 1FY6A 3JU2A 1GT8A 4XBJA 1O5XA 4W89A 2J6VA 3XINA 5EBUA 3QY8A 5CZSA 1EDTA 3TFXA 2QJJA 2ZX7A 3PJUA 4LS0A 1L1PA 4AVOA 4XUYA 1A5AA 5REQB 3CUHA 3GZ3A 4GLEA 2ZQSA 1E70M 3B8DA 4O13A 3S2NA 4URIA 3LQGA 4IPXA 3P62A 3BJSA 3WQ8A 3TQ0A 3CAKA 3R1ZA 1WUFA 2H6RA 2FPVA 2FJUB 3DFHA 5DY3A 5I06A 4BA0A 3QZAA 3T55A 3U2ZA 2PTWA 3T1GA 4XIMA 1I4NA 2QS8A 2QKFA 3MUY1 3UG4A 2YXOA 3UWZA 2WJDA 1JCMP 3O07A 1HZYA 1RZMA 3WX7A 1XF0A 4AD2A 3H24A 1E9ZB 4TW6A 4LVAA 1KFKA 2IKIA 1OZQA 3BCFA 4INFA 4BZYA 5CG0A 1JRBA 1OC6A 1JCXA 2OKOA 4XAFA 3BLFA 3PY2A 4BF8A 2RKXA 4XZLX 3QJAA 1TCOC 3GDTA 2TODA 4OWGA 1M65A 2X05A 3F2CA 3ARXA 2E9LA 4LAMA 4HHMA 2Y85A 2ZOXA 3URAA 1XQLA 3UZZA 3TK7A 3SCRA 1SSDA 4ZGYA 3GUWA 4AEEA 2FPTA 2Y8KA 4JTJA 3VNIA 5LHFA 3NUKA 1PKNA 4H8HA 1GPWA 3BG5A 5HT1A 2ZFAA 4BI5A 3ZLGA 1THFD 5AC7A 2HVNA 2NUXA 1W1A1 4MWAC 1SO3A 1FFQA 4A8RA 5GJPA 2Q09A 1QUMA 4J3ZA 4EOUA 2IPWA 1T40A 2C14A 1Z69A 3ZJKA 3N9KA 4G2DA 1J12A 3SGZA 2WZIA 3NQ7A 2DUAA 1RAKA 2MLZA 2PPGA 4JS3A 4XAGA 4LALA 5FA5A 3U5UA 1LUCB 1V5XA 1UR4A 3S83A 3THCA 1DEDA 4WGHA 5HW7A 4KFPA 4U28A 4I8DA 4IX2A 4W8AA 1A5CA 1K9EA 3PFMA 3QGAC 1AUSL 3FYPA 3B04A 1B30A 2Q02A 3WSUA 6XIAA 3TLQA 3AUOA 3EXSA 1D7IA 1QK2A 4AWSA 4ZO8A 1V8EA 2VEMA 3MKVA 2CEQA 1UR9A 1PDYA 4QJ5B 2FTYA 3DAQA 3LCLA 4UBPC 3WQEA 4N9EA 1KW1A 3E0VA 1OFAA 4DRHA 2J7EA 2OEJA 1V51A 2WNWA 5DX7A 4YL2A 4PEEA 2PRHA 1DV7A 1RQEA 3TTOA 3QQWA 3HF3A 3WBAA 4AF0B 3K8KA 2J27A 2PRMA 2PN0A 2VOTA 4PUMA 2PWDA 3TCSA 3M1ZA 3APTA 4K7YA 5F7UA 4JFJA 3W75A 2FZNA 1OX4B 4FI4A 2XWEA 1OGSA 1BSLA 3RYSA 2GVLA 1PKMA 2KR7A 2PDCA 5A8GA 2J77A 4X0VA 3TJXA 5FL0A 3GAKA 3HPFA 4I7WA 2G41A 1J5TA 3TCEA 2V82A 5E5CA 2A79A 4MAZA 3W37A 4TMCA 2WZTA 4L61A 1V02A 4UFHA 1VIZA 1UOZA 3T42A 2PPNA 2ZR4A 4AG0A 4N19A 1QI5A 1IE7C 4ICMA 3H53A 4WSHA 3KEHA 1J5SA 3H2NA 3QPYA 3TIMA 3IPWA 2RURA 3LRKA 3GC2A 2XTKA 2WSYA 2PDGA 3C2VA 3SN0A 4IIFA 2YR1A 2PU0A 2PS2A 3FAXA 2H8XA 3UVAA 3SCNA 3NO5A 3I3EA 3TJIA 4LAXA 2Y63A 5A8QA 4RDVA 4GUIA 5E0FA 3TW6A 3D0CA 3URBA 3GSMA 4R5EA 2Q71A 1UC4A 3GXIA 4U86A 4MG4A 4KQNA 1ISYA 3PTDA 4TX8A 3GD6A 1E15A 3R12A 3KABA 5HQLA 1H63A 5JH8A 3EWCA 4KCUA 1EF3A 1XM3A 1OFQA 3G8EA 2CW6A 3FXYA 1YW1A 4RE0A 3TYCA 3MBFA 5G2WA 2R1PA 1QOQA 1W8SA 4NT0A 2Z1SA 2BTMA 2BHYA 4FLSA 3BGJA 1JAKA 4IPJA 1BLIA 2XSAA 1KC7A 4HP5A 5FEZA 1A3XA 3VIKA 3BLLA 4D8ZA 2O4MA 3REQB 5BU6A 3QLLA 5I24A 3SDOA 2E6AA 3VNK