4JFLA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 6-({(1s,5r)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-2-oxo-3,9-diazabicyclo[3.3.1]non-9-yl}sulfonyl)-1,3-benzothiazol-2(3h)-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jflA00
1P5QA 4QIBA 3JYMA 4DZ2A 2RURA 3UF8A 3TC5A 1NMWA 1Q6IA 2LPVA 3IHZA 4J4NA 4LAYA 2F2DA 3GPKA 4U85A 4DRMA 1T11A 3UI5A 2ZQTA 1D7HA 4ODMA 5HW8A 1QPFA 2VCDA 4ODPA 2M1IA 4ODOA 4MGVA 4QT2A 5GPGA 5HKGA 5HWCA 3O5EA 2ZR6A 2XP3A 4TX0A 4DRKA 3UQBA 4IQ2A 1J4RA 3MDYB 4JFIA 5HTGA 4GIVA 2F21A 1FKFA 1FKBA 3KAIA 1FKRA 4NNRA 4QT3A 3VAWA 1JNSA 1D7IA 1FKKA 1QPLA 4DRPA 1B6CA 2RUDA 4IPXA 4ODRA 2KO7A 2VN1A 4MSPA 3PRBA 4TYOA 3UQAA 1HXVA 2DG9A 4JFLA 3O5JA 4LAVA 2N87A 4R0XA 1ROUA 2LJ4A 3O5FA 3TCZA 2DG3A 4BF8A 2OFNA 4DRNA 2RUCA 4DH0A 3LUOA 1FJDA 4LAXA 3FAPA 1KT1A 2D9FA 4G2PA 3O5GA 4W9PA 2XP6A 1N1AA 5DIUA 2RSEA 2MLZA 2XPAA 5BXJA 3ODKA 2LKNA 1FKTA 1FKLA 1KT0A 2KFWA 3EY6A 1NMVA 4FN2A 2MLXA 1NSGA 1EYMA 2DG4A 1Q1CA 4DROA 3KZ7A 3KAHA 2FKEA 1FKHA 1BL4A 2MLYA 1FKJA 2M2AA 2ZQVA 4DT4A 3CGMA 3KCEA 2L2SA 3O5DA 3RGCA 2Y78A 4TW8A 4W9QA 3IKGA 3IK8A 1R9HA 5HT1A 1Q6UA 3I6CA 1FD9A 4ITZA 4JYSA 4G50A 4ODLA 3O5PA 5DIVA 3TDBA 5HW6A 2F4EA 3O5QA 3JXVA 2XP8A 1Y0OA 1J6YA 2KR7A 4J4OA 2MPHA 1JNTA 2XP4A 4GGQA 4U86A 3KAFA 3OOBA 3RFWA 4JFJA 4DRHA 2XP9A 4DRJA 3O5LA 1Q6HA 1PBKA 1J4HA 1PINA 3O5MA 4TW6A 3O5OA 2KE0A 1FKIA 2MNTA 1J4IA 1F40A 5D75A 2Q5AA 2KGJA 2UZ5A 1BKFA 2FAPA 1TCOC 2PBCA 3O5KA 4TNSA 1C9HA 2PPOA 2ZQSA 4DZ3A 2ZQUA 4DRQA 2MF9A 2RUQA 4ODKA 4DRIA 1U79A 4JFKA 2XP5A 4ODNA 3NRKA 1F8AB 2PPPA 1D7JA 1A7XA 5HWBA 2M08A 1M5YA 2IF4A 3NI6A 2ZR4A 4U84A 5J6EA 3KABA 3B7XA 3KACA 4O2TA 2PPNA 4DIPA 1D6OA 1YATA 1ZK6A 2XP7A 5HUAA 4N19A 4LAWA 2K8IA 3O5RA 3UI4A 5I98A 1FKDA 2ITKA 1YW5A 3KAGA 1EQ3A 3UQIA 1L1PA 3KADA 1W26A 2PV3A 3O5IA 3NTPA 5HW7A 1JVWA 1QZ2A 2AWGA 2RQSA 2LGOA 2PV1A 3PRDA 4C02B 2JZVA 3JYJA 2XPBA 1ROTA 3PA7A 2KI3A 3WH0A 1FAPA 2PV2A 3H9RB 4IQCA 3UI6A 5B8IC 3IKDA 3CGNA 1FKGA 1ZCNA 1FKSA 4JFMA 4FAPA 4ODQA 4TW7A 2ZR5A 5DITA 4W9OA
chains in the Genus database with same CATH superfamily
1HKKA 4DZ2A 1W1YA 2WK2A 2LPVA 4U85A 4DRMA 3B8SA 3UI5A 3RMEA 4TX0A 4JFIA 5HTGA 4GIVA 1FKBA 2G41A 4QT3A 3VAWA 1QPLA 4DRPA 1W9UA 1B6CA 4IT4A 2KO7A 1GPFA 3B9DA 4MPKA 1HKIA 4MSPA 4TYOA 4UDMA 3O5JA 2N87A 1ROUA 2LJ4A 1W9VA 1KT1A 4G2PA 5DIUA 3AS2A 2MLZA 3WL1A 1NMVA 1EYMA 4ML4A 3KZ7A 4XAKA 2WLYA 4S3KA 3KAHA 1O6IA 1FKHA 1JNEA 2M2AA 3O5DA 3AQUA 3IKGA 3IK8A 4Z2IA 4ITZA 4JYSA 3O5PA 3O5QA 1Y0OA 2KR7A 5DF0A 3CHDA 1JNTA 3KAFA 1EIBA 4DWSA 3B9AA 2DT0A 4MNMA 3O5MA 2KE0A 2MNTA 5DITA 4TNSA 1TCOC 2PBCA 3O5KA 2ZQSA 4P8VA 1H0GA 4DRQA 2MF9A 2XP5A 4ODNA 3NRKA 1ZU8A 2PPPA 3ARPA 3B7XA 1LL7A 3KACA 1D6OA 4LAWA 3UI4A 5I98A 4MAVA 1FKDA 1E9LA 2ITKA 1GRJA 2LGOA 2PV1A 4C02B 2JZVA 1EHNA 4MNJA 2IUZA 3WH0A 2PV2A 3H9RB 3PR9A 1FKGA 1FKSA 2A3AA 2ZR5A 1P5QA 4ZPTR 5DO2A 3ARTA 2P4VA 1ITXA 3IHZA 3GPKA 2YBUA 2ZQTA 3QOKA 4MNKA 1LL6A 3ALFA 2VCDA 4ODPA 4ODOA 4MGVA 4WIWA 4DRKA 3UQBA 4HARA 1LL4A 3ARUA 3WD0A 3AROA 1FKRA 4WK9A 2RUDA 1LG2A 4NZCA 3RM4A 1HXVA 3ARQA 4JFLA 4LAVA 4BF8A 2G8ZA 3O5FA 1EQ3A 2OFNA 3OA5A 1W1PA 4Q22A 3FAPA 2D9FA 2XP6A 1N1AA 3RM9A 1FKLA 1KT0A 1H0IA 3EY6A 2MLXA 2DG4A 1Q1CA 1WB0A 1GOIA 4QZVB 3B9EA 4DT4A 3CGMA 2A3CA 2L2SA 4Q7NA 1EDQA 3GTYX 4W9QA 2FDMA 3BXWA 5GQBA 1LQ0A 3ARVA 4G50A 2DT2A 2F4EA 1E6NA 4Z2GA 1E44A 1NH6A 4P8WA 4GGQA 4S3JA 4WKAA 2WM0A 1Q6HA 1SYTA 1PBKA 1J4HA 5JH8A 3CHEA 4HBEA 1HJWA 4W5UA 4NSBA 5DEZA 1SR0A 4PTMA 4DWSB 1FKIA 4WKFA 1J4IA 2UZ5A 4R5EA 2FAPA 2O92A 4DZ3A 2ZQUA 3CZ8A 2DSZA 2ETNA 4DRIA 3CH9A 1HKMA 1F8AB 1ZBWA 3G6LA 1D7JA 2M08A 3NI6A 2ZR4A 1HJXA 2PPNA 1E15A 1YATA 3WIJA 3O5RA 2DT3A 3KAGA 3W4RA 1LJYA 3FY1A 5HW7A 2RQSA 3PRDA 1ROTA 3PA7A 2AOSA 3BMBA 5B8IC 4Z2HA 3AS3A 4FAPA 4TW7A 4QIBA 3UF8A 2EULA 4J4NA 1IX5A 1D7HA 3ARSA 5HW8A 1WAWA 2M1IA 1UR9A 5GPGA 1NWUA 5HWCA 3O5EA 4IQ2A 4LGXA 1W9PA 2F21A 1FKFA 3KAIA 1WNOA 4NNRA 1JNSA 1D7IA 1E6ZA 4IPXA 2VN1A 3UQAA 2A3EA 4Z2LA 2DG9A 1XRVA 3TCZA 5GPRA 2DG3A 1X6LA 2B5UB 4DH0A 3LUOA 1FJDA 4LAXA 3WD3A 4MNLA 3O5GA 2PN0A 2LKNA 2PI6A 1FKTA 4MTVA 4DROA 2DSUA 4Z2KA 1BL4A 4L3NA 2Y78A 2WLZA 4ZPVR 1TFVA 5HT1A 1Q6UA 1OGGA 3I6CA 1K9TA 1FD9A 5DIVA 3TDBA 1J6YA 1NWSA 4J4OA 1W1VA 2XP4A 3WQVA 4U86A 1NWTA 3OOBA 3RFWA 2DSWA 4JFJA 4IT6A 4DRJA 1PINA 1JNDA 2B31A 2ESCA 1F40A 1HKJA 5D75A 3ARZA 3CHFA 1BKFA 1FFRA 3PRAA 4JFKA 3ARXA 5HWBA 4ZS6A 1E6RA 1M5YA 5J6EA 3ARWA 3FXYA 4DIPA 4O2TA 1RD6A 1ZK6A 2XP7A 4WJXA 4N19A 2K8IA 3AS0A 3EIPA 1ZL1A 1JVWA 1QZ2A 3ALGA 3JYJA 2XPBA 2OLHA 2KI3A 3UI6A 1UR8A 4ZPWR 1JCHB 3CGNA 4JFMA 4ODQA 1LG1A 1GUVA 4W9OA 3JYMA 2RURA 3TC5A 3WD4A 1NMWA 1Q6IA 4KQZA 4LAYA 2F2DA 1T11A 4ODMA 1QPFA 4QT2A 5HKGA 2ZR6A 2XP3A 1J4RA 2DT1A 4DWSC 3MDYB 1ZBCA 4L72B 1FKKA 3CHCA 2QF8A 4ODRA 2A3BA 3PRBA 3WQWA 4R0XA 4DRNA 2RUCA 3WD2A 4W9PA 1KFWA 2RSEA 5BXJA 2XPAA 3ODKA 2KFWA 2F23A 4FN2A 3WD1A 1NSGA 1FFQA 3RM8A 4P8UA 2FKEA 2MLYA 1FKJA 3WKZA 2ZQVA 3KCEA 3RGCA 1NWRA 4TW8A 1R9HA 4URIA 4ODLA 5HW6A 3JXVA 2XP8A 1CTNA 2DSVA 2MPHA 1W1TA 2O9OA 4DRHA 3AS1A 2XP9A 3O5LA 1XHGA 4HBOA 4TW6A 3O5OA 1VF8A 1E6PA 2Q5AA 2KGJA 4Z2JA 1C9HA 2PPOA 3ARRA 3G6MA 1OWQA 1D2KA 4KR0B 4AY1A 2RUQA 4ODKA 1U79A 1HJVA 1A7XA 2IF4A 4U84A 3KABA 4P8XA 4DWSD 1OGBA 3ARYA 5HUAA 1ZB5A 3WL0A 5HBFA 1YW5A 3UQIA 1L1PA 1ZBKA 3KADA 1W26A 2PV3A 3O5IA 3NTPA 2AWGA 3GU0A 4WKHA 1FAPA 4IQCA 2YBTA 1ZBVA 3IKDA 1X6NA 1ZCNA 2DPEA
chains in the Genus database with same CATH topology
1HKKA 4DZ2A 1W1YA 2WK2A 2LPVA 4U85A 4DRMA 3B8SA 3UI5A 3RMEA 4TX0A 4JFIA 5HTGA 4GIVA 1FKBA 2G41A 4QT3A 3VAWA 1QPLA 4DRPA 1W9UA 1B6CA 4IT4A 2KO7A 1GPFA 3B9DA 4MPKA 1HKIA 4MSPA 4TYOA 3O5JA 2N87A 1ROUA 2LJ4A 1W9VA 1KT1A 4G2PA 5DIUA 3AS2A 2MLZA 3WL1A 1NMVA 1EYMA 4ML4A 3KZ7A 4XAKA 2WLYA 4S3KA 3KAHA 1O6IA 1FKHA 1JNEA 2M2AA 3O5DA 3AQUA 3IKGA 3IK8A 4Z2IA 4ITZA 4JYSA 3O5PA 3O5QA 1Y0OA 2KR7A 5DF0A 3CHDA 1JNTA 3KAFA 1EIBA 4DWSA 3B9AA 2DT0A 4MNMA 3O5MA 2KE0A 2MNTA 5DITA 4TNSA 1TCOC 2PBCA 3O5KA 2ZQSA 4P8VA 1H0GA 4DRQA 2MF9A 2XP5A 4ODNA 3NRKA 1ZU8A 2PPPA 3ARPA 3B7XA 1LL7A 3KACA 1D6OA 4LAWA 3UI4A 5I98A 4MAVA 1FKDA 1E9LA 2ITKA 2LGOA 2PV1A 4C02B 2JZVA 1EHNA 4MNJA 2IUZA 3WH0A 2PV2A 3H9RB 3PR9A 1FKGA 1FKSA 2A3AA 2ZR5A 1P5QA 4ZPTR 5DO2A 3ARTA 1ITXA 3IHZA 3GPKA 2YBUA 2ZQTA 3QOKA 4MNKA 1LL6A 3ALFA 2VCDA 4ODPA 4ODOA 4MGVA 4WIWA 4DRKA 3UQBA 4HARA 1LL4A 3ARUA 3WD0A 3AROA 1FKRA 4WK9A 2RUDA 1LG2A 4NZCA 3RM4A 1HXVA 3ARQA 4JFLA 4LAVA 4BF8A 2G8ZA 3O5FA 1EQ3A 2OFNA 3OA5A 1W1PA 4Q22A 3FAPA 2D9FA 2XP6A 1N1AA 3RM9A 1FKLA 1KT0A 1H0IA 3EY6A 2MLXA 2DG4A 1Q1CA 1WB0A 1GOIA 4QZVB 3B9EA 4DT4A 3CGMA 2A3CA 2L2SA 4Q7NA 1EDQA 4W9QA 2FDMA 3BXWA 5GQBA 1LQ0A 3ARVA 4G50A 2DT2A 2F4EA 1E6NA 4Z2GA 1NH6A 4P8WA 4GGQA 4S3JA 4WKAA 2WM0A 1Q6HA 1SYTA 1PBKA 1J4HA 5JH8A 3CHEA 4HBEA 1HJWA 4W5UA 4NSBA 5DEZA 1SR0A 4PTMA 4DWSB 1FKIA 4WKFA 1J4IA 2UZ5A 4R5EA 2FAPA 2O92A 4DZ3A 2ZQUA 3CZ8A 2DSZA 4DRIA 3CH9A 1HKMA 1F8AB 1ZBWA 3G6LA 1D7JA 2M08A 3NI6A 2ZR4A 1HJXA 2PPNA 1E15A 1YATA 3WIJA 3O5RA 2DT3A 3KAGA 3W4RA 1LJYA 3FY1A 5HW7A 2RQSA 3PRDA 1ROTA 3PA7A 2AOSA 5B8IC 4Z2HA 3AS3A 4FAPA 4TW7A 4QIBA 3UF8A 4J4NA 1IX5A 1D7HA 3ARSA 5HW8A 1WAWA 2M1IA 1UR9A 5GPGA 1NWUA 5HWCA 3O5EA 4IQ2A 4LGXA 1W9PA 2F21A 1FKFA 3KAIA 1WNOA 4NNRA 1JNSA 1D7IA 1E6ZA 4IPXA 2VN1A 3UQAA 2A3EA 4Z2LA 2DG9A 1XRVA 3TCZA 5GPRA 2DG3A 1X6LA 4DH0A 3LUOA 1FJDA 4LAXA 3WD3A 4MNLA 3O5GA 2LKNA 2PI6A 1FKTA 4MTVA 4DROA 2DSUA 4Z2KA 1BL4A 4L3NA 2Y78A 2WLZA 4ZPVR 1TFVA 5HT1A 1Q6UA 1OGGA 3I6CA 1K9TA 1FD9A 5DIVA 3TDBA 1J6YA 1NWSA 4J4OA 1W1VA 2XP4A 3WQVA 4U86A 1NWTA 3OOBA 3RFWA 2DSWA 4JFJA 4IT6A 4DRJA 1PINA 1JNDA 2B31A 2ESCA 1F40A 1HKJA 5D75A 3ARZA 3CHFA 1BKFA 1FFRA 3PRAA 4JFKA 3ARXA 5HWBA 4ZS6A 1E6RA 1M5YA 5J6EA 3ARWA 3FXYA 4DIPA 4O2TA 1RD6A 1ZK6A 2XP7A 4WJXA 4N19A 2K8IA 3AS0A 1ZL1A 1JVWA 1QZ2A 3ALGA 3JYJA 2XPBA 2OLHA 2KI3A 3UI6A 1UR8A 4ZPWR 3CGNA 4JFMA 4ODQA 1LG1A 1GUVA 4W9OA 3JYMA 2RURA 3TC5A 3WD4A 1NMWA 1Q6IA 4KQZA 4LAYA 2F2DA 1T11A 4ODMA 1QPFA 4QT2A 5HKGA 2ZR6A 2XP3A 1J4RA 2DT1A 4DWSC 3MDYB 1ZBCA 4L72B 1FKKA 3CHCA 2QF8A 4ODRA 2A3BA 3PRBA 3WQWA 4R0XA 4DRNA 2RUCA 3WD2A 4W9PA 1KFWA 2RSEA 5BXJA 2XPAA 3ODKA 2KFWA 4FN2A 3WD1A 1NSGA 1FFQA 3RM8A 4P8UA 2FKEA 2MLYA 1FKJA 3WKZA 2ZQVA 3KCEA 3RGCA 1NWRA 4TW8A 1R9HA 4URIA 4ODLA 5HW6A 3JXVA 2XP8A 1CTNA 2DSVA 2MPHA 1W1TA 2O9OA 4DRHA 3AS1A 2XP9A 3O5LA 1XHGA 4HBOA 4TW6A 3O5OA 1VF8A 1E6PA 2Q5AA 2KGJA 4Z2JA 1C9HA 2PPOA 3ARRA 3G6MA 1OWQA 1D2KA 4KR0B 4AY1A 2RUQA 4ODKA 1U79A 1HJVA 1A7XA 2IF4A 4U84A 3KABA 4P8XA 4DWSD 1OGBA 3ARYA 5HUAA 1ZB5A 3WL0A 5HBFA 1YW5A 3UQIA 1L1PA 1ZBKA 3KADA 1W26A 2PV3A 3O5IA 3NTPA 2AWGA 4WKHA 1FAPA 4IQCA 2YBTA 1ZBVA 3IKDA 1X6NA 1ZCNA 2DPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P5Q A;  4QIB A;  3JYM A;  4DZ2 A;  2RUR A;  3UF8 A;  3TC5 A;  1NMW A;  1Q6I A;  2LPV A;  3IHZ A;  4J4N A;  4LAY A;  2F2D A;  3GPK A;  4U85 A;  4DRM A;  1T11 A;  3UI5 A;  2ZQT A;  1D7H A;  4ODM A;  5HW8 A;  1QPF A;  2VCD A;  4ODP A;  2M1I A;  4ODO A;  4MGV A;  4QT2 A;  5GPG A;  5HKG A;  5HWC A;  3O5E A;  2ZR6 A;  2XP3 A;  4TX0 A;  4DRK A;  3UQB A;  4IQ2 A;  1J4R A;  3MDY B;  4JFI A;  5HTG A;  4GIV A;  2F21 A;  1FKF A;  1FKB A;  3KAI A;  1FKR A;  4NNR A;  4QT3 A;  3VAW A;  1JNS A;  1D7I A;  1FKK A;  1QPL A;  4DRP A;  1B6C A;  2RUD A;  4IPX A;  4ODR A;  2KO7 A;  2VN1 A;  4MSP A;  3PRB A;  4TYO A;  3UQA A;  1HXV A;  2DG9 A;  4JFL A;  3O5J A;  4LAV A;  2N87 A;  4R0X A;  1ROU A;  2LJ4 A;  3O5F A;  3TCZ A;  2DG3 A;  4BF8 A;  2OFN A;  4DRN A;  2RUC A;  4DH0 A;  3LUO A;  1FJD A;  4LAX A;  3FAP A;  1KT1 A;  2D9F A;  4G2P A;  3O5G A;  4W9P A;  2XP6 A;  1N1A A;  5DIU A;  2RSE A;  2MLZ A;  2XPA A;  5BXJ A;  3ODK A;  2LKN A;  1FKT A;  1FKL A;  1KT0 A;  2KFW A;  3EY6 A;  1NMV A;  4FN2 A;  2MLX A;  1NSG A;  1EYM A;  2DG4 A;  1Q1C A;  4DRO A;  3KZ7 A;  3KAH A;  2FKE A;  1FKH A;  1BL4 A;  2MLY A;  1FKJ A;  2M2A A;  2ZQV A;  4DT4 A;  3CGM A;  3KCE A;  2L2S A;  3O5D A;  3RGC A;  2Y78 A;  4TW8 A;  4W9Q A;  3IKG A;  3IK8 A;  1R9H A;  5HT1 A;  1Q6U A;  3I6C A;  1FD9 A;  4ITZ A;  4JYS A;  4G50 A;  4ODL A;  3O5P A;  5DIV A;  3TDB A;  5HW6 A;  2F4E A;  3O5Q A;  3JXV A;  2XP8 A;  1Y0O A;  1J6Y A;  2KR7 A;  4J4O A;  2MPH A;  1JNT A;  2XP4 A;  4GGQ A;  4U86 A;  3KAF A;  3OOB A;  3RFW A;  4JFJ A;  4DRH A;  2XP9 A;  4DRJ A;  3O5L A;  1Q6H A;  1PBK A;  1J4H A;  1PIN A;  3O5M A;  4TW6 A;  3O5O A;  2KE0 A;  1FKI A;  2MNT A;  1J4I A;  1F40 A;  5D75 A;  2Q5A A;  2KGJ A;  2UZ5 A;  1BKF A;  2FAP A;  1TCO C;  2PBC A;  3O5K A;  4TNS A;  1C9H A;  2PPO A;  2ZQS A;  4DZ3 A;  2ZQU A;  4DRQ A;  2MF9 A;  2RUQ A;  4ODK A;  4DRI A;  1U79 A;  4JFK A;  2XP5 A;  4ODN A;  3NRK A;  1F8A B;  2PPP A;  1D7J A;  1A7X A;  5HWB A;  2M08 A;  1M5Y A;  2IF4 A;  3NI6 A;  2ZR4 A;  4U84 A;  5J6E A;  3KAB A;  3B7X A;  3KAC A;  4O2T A;  2PPN A;  4DIP A;  1D6O A;  1YAT A;  1ZK6 A;  2XP7 A;  5HUA A;  4N19 A;  4LAW A;  2K8I A;  3O5R A;  3UI4 A;  5I98 A;  1FKD A;  2ITK A;  1YW5 A;  3KAG A;  1EQ3 A;  3UQI A;  1L1P A;  3KAD A;  1W26 A;  2PV3 A;  3O5I A;  3NTP A;  5HW7 A;  1JVW A;  1QZ2 A;  2AWG A;  2RQS A;  2LGO A;  2PV1 A;  3PRD A;  4C02 B;  2JZV A;  3JYJ A;  2XPB A;  1ROT A;  3PA7 A;  2KI3 A;  3WH0 A;  1FAP A;  2PV2 A;  3H9R B;  4IQC A;  3UI6 A;  5B8I C;  3IKD A;  3CGN A;  1FKG A;  1ZCN A;  1FKS A;  4JFM A;  4FAP A;  4ODQ A;  4TW7 A;  2ZR5 A;  5DIT A;  4W9O A; 
#chains in the Genus database with same CATH topology
 1HKK A;  4DZ2 A;  1W1Y A;  2WK2 A;  2LPV A;  4U85 A;  4DRM A;  3B8S A;  3UI5 A;  3RME A;  4TX0 A;  4JFI A;  5HTG A;  4GIV A;  1FKB A;  2G41 A;  4QT3 A;  3VAW A;  1QPL A;  4DRP A;  1W9U A;  1B6C A;  4IT4 A;  2KO7 A;  1GPF A;  3B9D A;  4MPK A;  1HKI A;  4MSP A;  4TYO A;  4UDM A;  3O5J A;  2N87 A;  1ROU A;  2LJ4 A;  1W9V A;  1KT1 A;  4G2P A;  5DIU A;  3AS2 A;  2MLZ A;  3WL1 A;  1NMV A;  1EYM A;  4ML4 A;  3KZ7 A;  4XAK A;  2WLY A;  4S3K A;  3KAH A;  1O6I A;  1FKH A;  1JNE A;  2M2A A;  3O5D A;  3AQU A;  3IKG A;  3IK8 A;  4Z2I A;  4ITZ A;  4JYS A;  3O5P A;  3O5Q A;  1Y0O A;  2KR7 A;  5DF0 A;  3CHD A;  1JNT A;  3KAF A;  1EIB A;  4DWS A;  3B9A A;  2DT0 A;  4MNM A;  3O5M A;  2KE0 A;  2MNT A;  5DIT A;  4TNS A;  1TCO C;  2PBC A;  3O5K A;  2ZQS A;  4P8V A;  1H0G A;  4DRQ A;  2MF9 A;  2XP5 A;  4ODN A;  3NRK A;  1ZU8 A;  2PPP A;  3ARP A;  3B7X A;  1LL7 A;  3KAC A;  1D6O A;  4LAW A;  3UI4 A;  5I98 A;  4MAV A;  1FKD A;  1E9L A;  2ITK A;  1GRJ A;  2LGO A;  2PV1 A;  4C02 B;  2JZV A;  1EHN A;  4MNJ A;  2IUZ A;  3WH0 A;  2PV2 A;  3H9R B;  3PR9 A;  1FKG A;  1FKS A;  2A3A A;  2ZR5 A;  1P5Q A;  4ZPT R;  5DO2 A;  3ART A;  2P4V A;  1ITX A;  3IHZ A;  3GPK A;  2YBU A;  2ZQT A;  3QOK A;  4MNK A;  1LL6 A;  3ALF A;  2VCD A;  4ODP A;  4ODO A;  4MGV A;  4WIW A;  4DRK A;  3UQB A;  4HAR A;  1LL4 A;  3ARU A;  3WD0 A;  3ARO A;  1FKR A;  4WK9 A;  2RUD A;  1LG2 A;  4NZC A;  3RM4 A;  1HXV A;  3ARQ A;  4JFL A;  4LAV A;  4BF8 A;  2G8Z A;  3O5F A;  1EQ3 A;  2OFN A;  3OA5 A;  1W1P A;  4Q22 A;  3FAP A;  2D9F A;  2XP6 A;  1N1A A;  3RM9 A;  1FKL A;  1KT0 A;  1H0I A;  3EY6 A;  2MLX A;  2DG4 A;  1Q1C A;  1WB0 A;  1GOI A;  4QZV B;  3B9E A;  4DT4 A;  3CGM A;  2A3C A;  2L2S A;  4Q7N A;  1EDQ A;  3GTY X;  4W9Q A;  2FDM A;  3BXW A;  5GQB A;  1LQ0 A;  3ARV A;  4G50 A;  2DT2 A;  2F4E A;  1E6N A;  4Z2G A;  1E44 A;  1NH6 A;  4P8W A;  4GGQ A;  4S3J A;  4WKA A;  2WM0 A;  1Q6H A;  1SYT A;  1PBK A;  1J4H A;  5JH8 A;  3CHE A;  4HBE A;  1HJW A;  4W5U A;  4NSB A;  5DEZ A;  1SR0 A;  4PTM A;  4DWS B;  1FKI A;  4WKF A;  1J4I A;  2UZ5 A;  4R5E A;  2FAP A;  2O92 A;  4DZ3 A;  2ZQU A;  3CZ8 A;  2DSZ A;  2ETN A;  4DRI A;  3CH9 A;  1HKM A;  1F8A B;  1ZBW A;  3G6L A;  1D7J A;  2M08 A;  3NI6 A;  2ZR4 A;  1HJX A;  2PPN A;  1E15 A;  1YAT A;  3WIJ A;  3O5R A;  2DT3 A;  3KAG A;  3W4R A;  1LJY A;  3FY1 A;  5HW7 A;  2RQS A;  3PRD A;  1ROT A;  3PA7 A;  2AOS A;  3BMB A;  5B8I C;  4Z2H A;  3AS3 A;  4FAP A;  4TW7 A;  4QIB A;  3UF8 A;  2EUL A;  4J4N A;  1IX5 A;  1D7H A;  3ARS A;  5HW8 A;  1WAW A;  2M1I A;  1UR9 A;  5GPG A;  1NWU A;  5HWC A;  3O5E A;  4IQ2 A;  4LGX A;  1W9P A;  2F21 A;  1FKF A;  3KAI A;  1WNO A;  4NNR A;  1JNS A;  1D7I A;  1E6Z A;  4IPX A;  2VN1 A;  3UQA A;  2A3E A;  4Z2L A;  2DG9 A;  1XRV A;  3TCZ A;  5GPR A;  2DG3 A;  1X6L A;  2B5U B;  4DH0 A;  3LUO A;  1FJD A;  4LAX A;  3WD3 A;  4MNL A;  3O5G A;  2PN0 A;  2LKN A;  2PI6 A;  1FKT A;  4MTV A;  4DRO A;  2DSU A;  4Z2K A;  1BL4 A;  4L3N A;  2Y78 A;  2WLZ A;  4ZPV R;  1TFV A;  5HT1 A;  1Q6U A;  1OGG A;  3I6C A;  1K9T A;  1FD9 A;  5DIV A;  3TDB A;  1J6Y A;  1NWS A;  4J4O A;  1W1V A;  2XP4 A;  3WQV A;  4U86 A;  1NWT A;  3OOB A;  3RFW A;  2DSW A;  4JFJ A;  4IT6 A;  4DRJ A;  1PIN A;  1JND A;  2B31 A;  2ESC A;  1F40 A;  1HKJ A;  5D75 A;  3ARZ A;  3CHF A;  1BKF A;  1FFR A;  3PRA A;  4JFK A;  3ARX A;  5HWB A;  4ZS6 A;  1E6R A;  1M5Y A;  5J6E A;  3ARW A;  3FXY A;  4DIP A;  4O2T A;  1RD6 A;  1ZK6 A;  2XP7 A;  4WJX A;  4N19 A;  2K8I A;  3AS0 A;  3EIP A;  1ZL1 A;  1JVW A;  1QZ2 A;  3ALG A;  3JYJ A;  2XPB A;  2OLH A;  2KI3 A;  3UI6 A;  1UR8 A;  4ZPW R;  1JCH B;  3CGN A;  4JFM A;  4ODQ A;  1LG1 A;  1GUV A;  4W9O A;  3JYM A;  2RUR A;  3TC5 A;  3WD4 A;  1NMW A;  1Q6I A;  4KQZ A;  4LAY A;  2F2D A;  1T11 A;  4ODM A;  1QPF A;  4QT2 A;  5HKG A;  2ZR6 A;  2XP3 A;  1J4R A;  2DT1 A;  4DWS C;  3MDY B;  1ZBC A;  4L72 B;  1FKK A;  3CHC A;  2QF8 A;  4ODR A;  2A3B A;  3PRB A;  3WQW A;  4R0X A;  4DRN A;  2RUC A;  3WD2 A;  4W9P A;  1KFW A;  2RSE A;  5BXJ A;  2XPA A;  3ODK A;  2KFW A;  2F23 A;  4FN2 A;  3WD1 A;  1NSG A;  1FFQ A;  3RM8 A;  4P8U A;  2FKE A;  2MLY A;  1FKJ A;  3WKZ A;  2ZQV A;  3KCE A;  3RGC A;  1NWR A;  4TW8 A;  1R9H A;  4URI A;  4ODL A;  5HW6 A;  3JXV A;  2XP8 A;  1CTN A;  2DSV A;  2MPH A;  1W1T A;  2O9O A;  4DRH A;  3AS1 A;  2XP9 A;  3O5L A;  1XHG A;  4HBO A;  4TW6 A;  3O5O A;  1VF8 A;  1E6P A;  2Q5A A;  2KGJ A;  4Z2J A;  1C9H A;  2PPO A;  3ARR A;  3G6M A;  1OWQ A;  1D2K A;  4KR0 B;  4AY1 A;  2RUQ A;  4ODK A;  1U79 A;  1HJV A;  1A7X A;  2IF4 A;  4U84 A;  3KAB A;  4P8X A;  4DWS D;  1OGB A;  3ARY A;  5HUA A;  1ZB5 A;  3WL0 A;  5HBF A;  1YW5 A;  3UQI A;  1L1P A;  1ZBK A;  3KAD A;  1W26 A;  2PV3 A;  3O5I A;  3NTP A;  2AWG A;  3GU0 A;  4WKH A;  1FAP A;  4IQC A;  2YBT A;  1ZBV A;  3IKD A;  1X6N A;  1ZCN A;  2DPE A; 
#chains in the Genus database with same CATH homology
 1HKK A;  4DZ2 A;  1W1Y A;  2WK2 A;  2LPV A;  4U85 A;  4DRM A;  3B8S A;  3UI5 A;  3RME A;  4TX0 A;  4JFI A;  5HTG A;  4GIV A;  1FKB A;  2G41 A;  4QT3 A;  3VAW A;  1QPL A;  4DRP A;  1W9U A;  1B6C A;  4IT4 A;  2KO7 A;  1GPF A;  3B9D A;  4MPK A;  1HKI A;  4MSP A;  4TYO A;  3O5J A;  2N87 A;  1ROU A;  2LJ4 A;  1W9V A;  1KT1 A;  4G2P A;  5DIU A;  3AS2 A;  2MLZ A;  3WL1 A;  1NMV A;  1EYM A;  4ML4 A;  3KZ7 A;  4XAK A;  2WLY A;  4S3K A;  3KAH A;  1O6I A;  1FKH A;  1JNE A;  2M2A A;  3O5D A;  3AQU A;  3IKG A;  3IK8 A;  4Z2I A;  4ITZ A;  4JYS A;  3O5P A;  3O5Q A;  1Y0O A;  2KR7 A;  5DF0 A;  3CHD A;  1JNT A;  3KAF A;  1EIB A;  4DWS A;  3B9A A;  2DT0 A;  4MNM A;  3O5M A;  2KE0 A;  2MNT A;  5DIT A;  4TNS A;  1TCO C;  2PBC A;  3O5K A;  2ZQS A;  4P8V A;  1H0G A;  4DRQ A;  2MF9 A;  2XP5 A;  4ODN A;  3NRK A;  1ZU8 A;  2PPP A;  3ARP A;  3B7X A;  1LL7 A;  3KAC A;  1D6O A;  4LAW A;  3UI4 A;  5I98 A;  4MAV A;  1FKD A;  1E9L A;  2ITK A;  2LGO A;  2PV1 A;  4C02 B;  2JZV A;  1EHN A;  4MNJ A;  2IUZ A;  3WH0 A;  2PV2 A;  3H9R B;  3PR9 A;  1FKG A;  1FKS A;  2A3A A;  2ZR5 A;  1P5Q A;  4ZPT R;  5DO2 A;  3ART A;  1ITX A;  3IHZ A;  3GPK A;  2YBU A;  2ZQT A;  3QOK A;  4MNK A;  1LL6 A;  3ALF A;  2VCD A;  4ODP A;  4ODO A;  4MGV A;  4WIW A;  4DRK A;  3UQB A;  4HAR A;  1LL4 A;  3ARU A;  3WD0 A;  3ARO A;  1FKR A;  4WK9 A;  2RUD A;  1LG2 A;  4NZC A;  3RM4 A;  1HXV A;  3ARQ A;  4JFL A;  4LAV A;  4BF8 A;  2G8Z A;  3O5F A;  1EQ3 A;  2OFN A;  3OA5 A;  1W1P A;  4Q22 A;  3FAP A;  2D9F A;  2XP6 A;  1N1A A;  3RM9 A;  1FKL A;  1KT0 A;  1H0I A;  3EY6 A;  2MLX A;  2DG4 A;  1Q1C A;  1WB0 A;  1GOI A;  4QZV B;  3B9E A;  4DT4 A;  3CGM A;  2A3C A;  2L2S A;  4Q7N A;  1EDQ A;  4W9Q A;  2FDM A;  3BXW A;  5GQB A;  1LQ0 A;  3ARV A;  4G50 A;  2DT2 A;  2F4E A;  1E6N A;  4Z2G A;  1NH6 A;  4P8W A;  4GGQ A;  4S3J A;  4WKA A;  2WM0 A;  1Q6H A;  1SYT A;  1PBK A;  1J4H A;  5JH8 A;  3CHE A;  4HBE A;  1HJW A;  4W5U A;  4NSB A;  5DEZ A;  1SR0 A;  4PTM A;  4DWS B;  1FKI A;  4WKF A;  1J4I A;  2UZ5 A;  4R5E A;  2FAP A;  2O92 A;  4DZ3 A;  2ZQU A;  3CZ8 A;  2DSZ A;  4DRI A;  3CH9 A;  1HKM A;  1F8A B;  1ZBW A;  3G6L A;  1D7J A;  2M08 A;  3NI6 A;  2ZR4 A;  1HJX A;  2PPN A;  1E15 A;  1YAT A;  3WIJ A;  3O5R A;  2DT3 A;  3KAG A;  3W4R A;  1LJY A;  3FY1 A;  5HW7 A;  2RQS A;  3PRD A;  1ROT A;  3PA7 A;  2AOS A;  5B8I C;  4Z2H A;  3AS3 A;  4FAP A;  4TW7 A;  4QIB A;  3UF8 A;  4J4N A;  1IX5 A;  1D7H A;  3ARS A;  5HW8 A;  1WAW A;  2M1I A;  1UR9 A;  5GPG A;  1NWU A;  5HWC A;  3O5E A;  4IQ2 A;  4LGX A;  1W9P A;  2F21 A;  1FKF A;  3KAI A;  1WNO A;  4NNR A;  1JNS A;  1D7I A;  1E6Z A;  4IPX A;  2VN1 A;  3UQA A;  2A3E A;  4Z2L A;  2DG9 A;  1XRV A;  3TCZ A;  5GPR A;  2DG3 A;  1X6L A;  4DH0 A;  3LUO A;  1FJD A;  4LAX A;  3WD3 A;  4MNL A;  3O5G A;  2LKN A;  2PI6 A;  1FKT A;  4MTV A;  4DRO A;  2DSU A;  4Z2K A;  1BL4 A;  4L3N A;  2Y78 A;  2WLZ A;  4ZPV R;  1TFV A;  5HT1 A;  1Q6U A;  1OGG A;  3I6C A;  1K9T A;  1FD9 A;  5DIV A;  3TDB A;  1J6Y A;  1NWS A;  4J4O A;  1W1V A;  2XP4 A;  3WQV A;  4U86 A;  1NWT A;  3OOB A;  3RFW A;  2DSW A;  4JFJ A;  4IT6 A;  4DRJ A;  1PIN A;  1JND A;  2B31 A;  2ESC A;  1F40 A;  1HKJ A;  5D75 A;  3ARZ A;  3CHF A;  1BKF A;  1FFR A;  3PRA A;  4JFK A;  3ARX A;  5HWB A;  4ZS6 A;  1E6R A;  1M5Y A;  5J6E A;  3ARW A;  3FXY A;  4DIP A;  4O2T A;  1RD6 A;  1ZK6 A;  2XP7 A;  4WJX A;  4N19 A;  2K8I A;  3AS0 A;  1ZL1 A;  1JVW A;  1QZ2 A;  3ALG A;  3JYJ A;  2XPB A;  2OLH A;  2KI3 A;  3UI6 A;  1UR8 A;  4ZPW R;  3CGN A;  4JFM A;  4ODQ A;  1LG1 A;  1GUV A;  4W9O A;  3JYM A;  2RUR A;  3TC5 A;  3WD4 A;  1NMW A;  1Q6I A;  4KQZ A;  4LAY A;  2F2D A;  1T11 A;  4ODM A;  1QPF A;  4QT2 A;  5HKG A;  2ZR6 A;  2XP3 A;  1J4R A;  2DT1 A;  4DWS C;  3MDY B;  1ZBC A;  4L72 B;  1FKK A;  3CHC A;  2QF8 A;  4ODR A;  2A3B A;  3PRB A;  3WQW A;  4R0X A;  4DRN A;  2RUC A;  3WD2 A;  4W9P A;  1KFW A;  2RSE A;  5BXJ A;  2XPA A;  3ODK A;  2KFW A;  4FN2 A;  3WD1 A;  1NSG A;  1FFQ A;  3RM8 A;  4P8U A;  2FKE A;  2MLY A;  1FKJ A;  3WKZ A;  2ZQV A;  3KCE A;  3RGC A;  1NWR A;  4TW8 A;  1R9H A;  4URI A;  4ODL A;  5HW6 A;  3JXV A;  2XP8 A;  1CTN A;  2DSV A;  2MPH A;  1W1T A;  2O9O A;  4DRH A;  3AS1 A;  2XP9 A;  3O5L A;  1XHG A;  4HBO A;  4TW6 A;  3O5O A;  1VF8 A;  1E6P A;  2Q5A A;  2KGJ A;  4Z2J A;  1C9H A;  2PPO A;  3ARR A;  3G6M A;  1OWQ A;  1D2K A;  4KR0 B;  4AY1 A;  2RUQ A;  4ODK A;  1U79 A;  1HJV A;  1A7X A;  2IF4 A;  4U84 A;  3KAB A;  4P8X A;  4DWS D;  1OGB A;  3ARY A;  5HUA A;  1ZB5 A;  3WL0 A;  5HBF A;  1YW5 A;  3UQI A;  1L1P A;  1ZBK A;  3KAD A;  1W26 A;  2PV3 A;  3O5I A;  3NTP A;  2AWG A;  4WKH A;  1FAP A;  4IQC A;  2YBT A;  1ZBV A;  3IKD A;  1X6N A;  1ZCN A;  2DPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...