4JFLA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 6-({(1s,5r)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-2-oxo-3,9-diazabicyclo[3.3.1]non-9-yl}sulfonyl)-1,3-benzothiazol-2(3h)-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
molecule tags Isomerase
source organism Homo sapiens
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jflA00
1QZ2A 3UQBA 1B6CA 1M5YA 3NI6A 1FKFA 4GGQA 4O2TA 1D7HA 2ZQUA 3UQAA 2ZQTA 1EQ3A 4TW6A 2VCDA 2F4EA 3KABA 1EYMA 5B8IC 3O5DA 1NMWA 4ODNA 3KAFA 1P5QA 4DIPA 3O5GA 2XP8A 2L2SA 4U85A 4DRPA 2JZVA 4TW7A 1FKHA 1ZCNA 5BXJA 4MSPA 2KO7A 2M1IA 2MLYA 3KAHA 3KAGA 2DG9A 3O5KA 4LAWA 3TDBA 3UI5A 5HW8A 4TW8A 4JFKA 4QT3A 1FJDA 3IK8A 1C9HA 2KFWA 1FKGA 4DRIA 4U86A 5HW7A 2LPVA 3VAWA 2RUCA 1F8AB 3JYMA 4DRNA 4DH0A 3O5FA 2ZQSA 3KACA 4DRJA 3ODKA 1QPLA 3IKDA 2ZQVA 3O5OA 3O5JA 4ITZA 4ODMA 4DZ3A 2ITKA 5J6EA 1R9HA 1D7JA 1KT1A 1L1PA 4G50A 4W9QA 4MGVA 3KZ7A 4DZ2A 1D7IA 2FKEA 1HXVA 1JVWA 2N87A 4TYOA 4R0XA 4JFMA 5DITA 1FKBA 2XPBA 3PA7A 2XP5A 2PPNA 2XP9A 2XP3A 1FAPA 1BKFA 5DIVA 4LAYA 2MPHA 3O5IA 2IF4A 4N19A 1FKJA 2M08A 1PINA 2MNTA 1NMVA 2XP7A 3KCEA 2OFNA 4G2PA 4BF8A 1U79A 2ZR6A 4IQCA 4U84A 4DRKA 1KT0A 5DIUA 3NRKA 3MDYB 3WH0A 3PRBA 5I98A 4LAXA 5HWBA 4GIVA 2ZR5A 3O5MA 3UI4A 2XPAA 4IQ2A 1FKLA 3FAPA 3O5QA 1FKRA 1FKIA 2AWGA 5HKGA 2RURA 4ODLA 1J4RA 2ZR4A 3O5LA 2MLXA 4TX0A 1F40A 1FKTA 2VN1A 3IKGA 4LAVA 2FAPA 2K8IA 1Q6IA 1W26A 2XP4A 3TC5A 4DROA 1N1AA 5HWCA 3LUOA 5HUAA 1PBKA 2Y78A 1TCOC 2PBCA 1NSGA 4ODKA 1Q1CA 2DG3A 3CGMA 4J4NA 5HT1A 1Y0OA 2PV1A 4W9OA 3TCZA 3UQIA 4J4OA 4W9PA 4JFLA 4DRQA 4ODQA 3RGCA 2PV3A 3H9RB 2RQSA 4DRMA 2MF9A 4NNRA 1Q6UA 1ROUA 2LJ4A 3NTPA 4JFIA 3JYJA 2PPPA 1J6YA 3B7XA 2F2DA 3IHZA 1J4IA 1T11A 2KR7A 2M2AA 1J4HA 5GPGA 3UF8A 4C02B 4DT4A 1ZK6A 4ODOA 3PRDA 1YW5A 1QPFA 1FKSA 3I6CA 3KAIA 2Q5AA 4DRHA 1FKKA 3GPKA 1BL4A 4FAPA 2LGOA 2KI3A 2KGJA 4JFJA 5HW6A 2LKNA 2MLZA 1FD9A 3EY6A 1FKDA 3OOBA 2PPOA 2KE0A 4IPXA 1YATA 2XP6A 2RUQA 3JXVA 1Q6HA 2UZ5A 3CGNA 2F21A 2DG4A 2RUDA 3RFWA 4JYSA 1ROTA 4ODRA 2PV2A 4QT2A 4TNSA 1JNTA 5D75A 4ODPA 2D9FA 1D6OA 3O5RA 2RSEA 4FN2A 1A7XA 4QIBA 3KADA 3UI6A 3O5EA 3O5PA 5HTGA 1JNSA
chains in the Genus database with same CATH superfamily
1H0GA 4GGQA 3CHCA 3B8SA 1HJVA 4TW6A 1X6NA 4R5EA 1EYMA 1LL4A 3O5DA 4NZCA 4AY1A 1NMWA 2WK2A 4UDMA 3B9AA 4TW7A 1ZCNA 5BXJA 3PRAA 2G41A 5DF0A 3CHFA 3TDBA 3KAHA 1WB0A 2DG9A 4TW8A 1FJDA 2KFWA 4LGXA 2LPVA 3RM8A 3O5FA 1QPLA 4DZ3A 4ZPTR 3FY1A 1XHGA 4DWSD 1JVWA 2IUZA 1GOIA 1WNOA 3OA5A 3KCEA 4P8WA 4WKAA 1H0IA 2OFNA 3WQWA 2ZR6A 4IQCA 5DIUA 3NRKA 3MDYB 3WH0A 3W4RA 2YBTA 1GRJA 3WL0A 2ZR5A 3FAPA 1J4RA 2MLXA 4TX0A 4Z2GA 1F40A 4WJXA 1SR0A 4DROA 5HWCA 2WM0A 5HUAA 1PBKA 2Y78A 2PBCA 4J4NA 2F23A 1HKJA 3TCZA 3WD0A 4W9PA 3FXYA 5GQBA 1NWSA 1Q6UA 3JYJA 4WIWA 1CTNA 2KR7A 1J4HA 1UR9A 3KAIA 1LG1A 1LL6A 2PI6A 4JFJA 2LKNA 1LQ0A 4QZVB 4IPXA 1OGBA 1YATA 1Q6HA 3CH9A 2F21A 4JYSA 1ZL1A 4TNSA 2D9FA 4ZS6A 4HARA 1E6ZA 3O5PA 2ESCA 1FKFA 1D7HA 3UQAA 3ARUA 1GPFA 4KR0B 1SYTA 2DPEA 3KAFA 1P5QA 1FFQA 2ETNA 4MSPA 2KO7A 4LAWA 3G6LA 4JFKA 4QT3A 1FKGA 4DRIA 1W1VA 3VAWA 2RUCA 1F8AB 1E6NA 2ZQSA 5J6EA 4ITZA 1D7JA 4IT6A 3CHDA 1D7IA 2G8ZA 1HXVA 4TYOA 4R0XA 1XRVA 1FKBA 2XPBA 2XP9A 2XP3A 3GU0A 2MPHA 4N19A 2IF4A 4URIA 1JNDA 2MNTA 3ARXA 1NMVA 1NWTA 3WD4A 4BF8A 1W9UA 4NSBA 3WL1A 5JH8A 2DT1A 3PRBA 5HWBA 3O5MA 3UI4A 4IQ2A 1FKLA 1FKIA 1IX5A 3IKGA 2XP4A 1Q6IA 3AQUA 1ZU8A 4ODKA 4DWSA 1Q1CA 3BMBA 3CGMA 1Y0OA 4W9OA 3UQIA 4J4OA 4Z2KA 4JFLA 3AS3A 4MNJA 2RQSA 1E15A 4NNRA 2LJ4A 1ROUA 2PPPA 1J6YA 3B7XA 4HBEA 2F2DA 4C02B 2OLHA 4DT4A 1EIBA 1ZK6A 4MNKA 3PRDA 1YW5A 3I6CA 1LL7A 1ITXA 3GPKA 1BL4A 4FAPA 2LGOA 2KI3A 3PR9A 4L72B 1FD9A 3EY6A 1LJYA 3WD2A 4Z2JA 1OWQA 2UZ5A 1LG2A 2RUDA 1TFVA 4ODRA 1E9LA 3ARWA 3UI6A 1JCHB 3KADA 3O5EA 1QZ2A 2DSVA 1B6CA 3UQBA 2DSUA 4O2TA 4MNMA 1O6IA 1WAWA 2ZQTA 1EQ3A 2VCDA 1NWUA 1ZBWA 4PTMA 4ODNA 4S3KA 4P8XA 1HKMA 2L2SA 4U85A 2JZVA 3EIPA 1E6PA 1FKHA 1JNEA 4ML4A 2MLYA 2PN0A 4U86A 4Q7NA 4DRNA 2DT3A 4DH0A 3RM4A 4DRPA 3ODKA 3O5JA 1L1PA 4G50A 3AS1A 4W9QA 4MGVA 5DO2A 3KZ7A 2FKEA 2N87A 4HBOA 4JFMA 5DITA 3PA7A 2PPNA 1D2KA 1FAPA 5DIVA 1NH6A 4LAYA 3ARQA 3O5IA 4MPKA 3RMEA 2XP7A 2M08A 4U84A 3AS2A 3WKZA 1KT0A 1W1YA 4Z2HA 4LAXA 4GIVA 4MNLA 5HKGA 3ARRA 2WLZA 2RURA 4ODLA 4DWSB 2A3EA 4LAVA 2FAPA 1W26A 3TC5A 5HBFA 1N1AA 3AS0A 3ALFA 3LUOA 1NSGA 4W5UA 1W9PA 2O9OA 2PV1A 2AOSA 4DRQA 4ODQA 3ALGA 2O92A 1HKKA 2A3CA 4P8UA 3NTPA 4DWSC 4JFIA 1J4IA 2M2AA 3UF8A 2DT2A 4ODOA 1FKSA 4L3NA 2Q5AA 1FKKA 1RD6A 2QF8A 2KGJA 3CHEA 3G6MA 2B31A 5HW6A 1ZBCA 2MLZA 3RM9A 4Z2LA 2PPOA 1W1PA 2XP6A 2RUQA 2DG4A 3RFWA 4MAVA 1ROTA 4XAKA 1W1TA 1D6OA 4FN2A 4QIBA 2YBUA 1M5YA 3NI6A 2ZQUA 1FFRA 4WKHA 2F4EA 2A3BA 3KABA 5B8IC 4DIPA 3O5GA 2XP8A 4ZPWR 4ZPVR 3WQVA 4S3JA 1VF8A 3ARPA 2M1IA 3O5KA 3KAGA 1ZB5A 3UI5A 5HW8A 5GPRA 1GUVA 3WD3A 3IK8A 1C9HA 3QOKA 5HW7A 4P8VA 3JYMA 4DRJA 3KACA 2FDMA 3IKDA 4ODMA 2ZQVA 3O5OA 2ITKA 1R9HA 1KT1A 4Z2IA 4WK9A 4DZ2A 3ARZA 2A3AA 2XP5A 1W9VA 1BKFA 2EULA 4KQZA 2DSZA 1FKJA 1PINA 2P4VA 2DSWA 1HKIA 4Q22A 4G2PA 1U79A 2B5UB 4IT4A 1ZBVA 4WKFA 4DRKA 3ARYA 5I98A 1HJXA 1NWRA 2XPAA 3O5QA 1FKRA 2AWGA 3B9DA 2ZR4A 3O5LA 3ARSA 1HJWA 2WLYA 1FKTA 2VN1A 2K8IA 3WIJA 2DT0A 1TCOC 3ARVA 2DG3A 5HT1A 4MTVA 3CZ8A 3ARTA 3RGCA 1UR8A 2PV3A 3H9RB 4DRMA 2MF9A 3B9EA 1KFWA 1OGGA 3IHZA 1T11A 5GPGA 1E44A 1QPFA 3AROA 4DRHA 1EHNA 3BXWA 3GTYX 1FKDA 3OOBA 1ZBKA 1X6LA 2KE0A 1K9TA 3JXVA 3CGNA 5D75A 1E6RA 2PV2A 4QT2A 1JNTA 4ODPA 3O5RA 2RSEA 1JNSA 1A7XA 3WD1A 5HTGA 5DEZA 1EDQA
chains in the Genus database with same CATH topology
1H0GA 4GGQA 3CHCA 3B8SA 1HJVA 4TW6A 1X6NA 4R5EA 1EYMA 1LL4A 3O5DA 4NZCA 4AY1A 1NMWA 2WK2A 3B9AA 4TW7A 1ZCNA 5BXJA 3PRAA 2G41A 5DF0A 3CHFA 3TDBA 3KAHA 1WB0A 2DG9A 4TW8A 1FJDA 2KFWA 4LGXA 2LPVA 3RM8A 3O5FA 1QPLA 4DZ3A 4ZPTR 3FY1A 1XHGA 4DWSD 1JVWA 2IUZA 1GOIA 1WNOA 3OA5A 3KCEA 4P8WA 4WKAA 1H0IA 2OFNA 3WQWA 2ZR6A 4IQCA 5DIUA 3NRKA 3MDYB 3WH0A 3W4RA 2YBTA 3WL0A 2ZR5A 3FAPA 1J4RA 2MLXA 4TX0A 4Z2GA 1F40A 4WJXA 1SR0A 4DROA 5HWCA 2WM0A 5HUAA 1PBKA 2Y78A 2PBCA 4J4NA 1HKJA 3TCZA 3WD0A 4W9PA 3FXYA 5GQBA 1NWSA 1Q6UA 3JYJA 4WIWA 1CTNA 2KR7A 1J4HA 1UR9A 3KAIA 1LG1A 1LL6A 2PI6A 4JFJA 2LKNA 1LQ0A 4QZVB 4IPXA 1OGBA 1YATA 1Q6HA 3CH9A 2F21A 4JYSA 1ZL1A 4TNSA 2D9FA 4ZS6A 4HARA 1E6ZA 3O5PA 2ESCA 1FKFA 1D7HA 3UQAA 3ARUA 1GPFA 4KR0B 1SYTA 2DPEA 3KAFA 1P5QA 1FFQA 4MSPA 2KO7A 4LAWA 3G6LA 4JFKA 4QT3A 1FKGA 4DRIA 1W1VA 3VAWA 2RUCA 1F8AB 1E6NA 2ZQSA 5J6EA 4ITZA 1D7JA 4IT6A 3CHDA 1D7IA 2G8ZA 1HXVA 4TYOA 4R0XA 1XRVA 1FKBA 2XPBA 2XP9A 2XP3A 2MPHA 4N19A 2IF4A 4URIA 1JNDA 2MNTA 1NMVA 3ARXA 1NWTA 3WD4A 4BF8A 1W9UA 4NSBA 3WL1A 5JH8A 2DT1A 3PRBA 5HWBA 3O5MA 3UI4A 4IQ2A 1FKLA 1FKIA 1IX5A 3IKGA 2XP4A 1Q6IA 3AQUA 1ZU8A 4ODKA 4DWSA 1Q1CA 3CGMA 1Y0OA 4W9OA 3UQIA 4J4OA 4Z2KA 4JFLA 3AS3A 4MNJA 2RQSA 1E15A 4NNRA 2LJ4A 1ROUA 2PPPA 1J6YA 3B7XA 4HBEA 2F2DA 4C02B 2OLHA 4DT4A 1EIBA 1ZK6A 4MNKA 3PRDA 1YW5A 3I6CA 1LL7A 1ITXA 3GPKA 1BL4A 4FAPA 2LGOA 2KI3A 3PR9A 4L72B 1FD9A 3EY6A 1LJYA 3WD2A 4Z2JA 1OWQA 2UZ5A 1LG2A 2RUDA 1TFVA 4ODRA 1E9LA 3ARWA 3UI6A 3KADA 3O5EA 1QZ2A 2DSVA 1B6CA 3UQBA 2DSUA 4O2TA 4MNMA 1O6IA 1WAWA 2ZQTA 1EQ3A 2VCDA 1NWUA 1ZBWA 4PTMA 4ODNA 4S3KA 4P8XA 1HKMA 2L2SA 4U85A 2JZVA 1E6PA 1FKHA 1JNEA 4ML4A 2MLYA 4U86A 4Q7NA 4DRNA 2DT3A 4DH0A 3RM4A 4DRPA 3ODKA 3O5JA 1L1PA 4G50A 3AS1A 4W9QA 4MGVA 5DO2A 3KZ7A 2FKEA 2N87A 4HBOA 4JFMA 5DITA 3PA7A 2PPNA 1D2KA 1FAPA 5DIVA 1NH6A 4LAYA 3ARQA 3O5IA 4MPKA 3RMEA 2XP7A 2M08A 4U84A 3AS2A 3WKZA 1KT0A 1W1YA 4Z2HA 4LAXA 4GIVA 4MNLA 5HKGA 3ARRA 2WLZA 2RURA 4ODLA 4DWSB 2A3EA 4LAVA 2FAPA 1W26A 3TC5A 5HBFA 1N1AA 3AS0A 3ALFA 3LUOA 1NSGA 4W5UA 1W9PA 2O9OA 2PV1A 2AOSA 4DRQA 4ODQA 3ALGA 2O92A 1HKKA 2A3CA 4P8UA 3NTPA 4DWSC 4JFIA 1J4IA 2M2AA 3UF8A 2DT2A 4ODOA 1FKSA 4L3NA 2Q5AA 1FKKA 1RD6A 2QF8A 2KGJA 3CHEA 3G6MA 2B31A 5HW6A 1ZBCA 2MLZA 3RM9A 4Z2LA 2PPOA 1W1PA 2XP6A 2RUQA 2DG4A 3RFWA 4MAVA 1ROTA 4XAKA 1W1TA 1D6OA 4FN2A 4QIBA 2YBUA 1M5YA 3NI6A 2ZQUA 1FFRA 4WKHA 2F4EA 2A3BA 3KABA 5B8IC 4DIPA 3O5GA 2XP8A 4ZPWR 4ZPVR 3WQVA 4S3JA 1VF8A 3ARPA 2M1IA 3O5KA 3KAGA 1ZB5A 3UI5A 5HW8A 5GPRA 1GUVA 3WD3A 3IK8A 1C9HA 3QOKA 5HW7A 4P8VA 3JYMA 4DRJA 3KACA 2FDMA 3IKDA 4ODMA 2ZQVA 3O5OA 2ITKA 1R9HA 1KT1A 4Z2IA 4WK9A 4DZ2A 3ARZA 2A3AA 2XP5A 1W9VA 1BKFA 4KQZA 2DSZA 1FKJA 1PINA 2DSWA 1HKIA 4Q22A 4G2PA 1U79A 4IT4A 1ZBVA 4WKFA 4DRKA 3ARYA 5I98A 1HJXA 1NWRA 2XPAA 3O5QA 1FKRA 2AWGA 3B9DA 2ZR4A 3O5LA 3ARSA 1HJWA 2WLYA 1FKTA 2VN1A 2K8IA 3WIJA 2DT0A 1TCOC 3ARVA 2DG3A 5HT1A 4MTVA 3CZ8A 3ARTA 3RGCA 1UR8A 2PV3A 3H9RB 4DRMA 2MF9A 3B9EA 1KFWA 1OGGA 3IHZA 1T11A 5GPGA 1QPFA 3AROA 4DRHA 1EHNA 3BXWA 1FKDA 3OOBA 1ZBKA 1X6LA 2KE0A 1K9TA 3JXVA 3CGNA 5D75A 1E6RA 2PV2A 4QT2A 1JNTA 4ODPA 3O5RA 2RSEA 1JNSA 1A7XA 3WD1A 5HTGA 5DEZA 1EDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ2 A;  3UQB A;  1B6C A;  1M5Y A;  3NI6 A;  1FKF A;  4GGQ A;  4O2T A;  1D7H A;  2ZQU A;  3UQA A;  2ZQT A;  1EQ3 A;  4TW6 A;  2VCD A;  2F4E A;  3KAB A;  1EYM A;  5B8I C;  3O5D A;  1NMW A;  4ODN A;  3KAF A;  1P5Q A;  4DIP A;  3O5G A;  2XP8 A;  2L2S A;  4U85 A;  4DRP A;  2JZV A;  4TW7 A;  1FKH A;  1ZCN A;  5BXJ A;  4MSP A;  2KO7 A;  2M1I A;  2MLY A;  3KAH A;  3KAG A;  2DG9 A;  3O5K A;  4LAW A;  3TDB A;  3UI5 A;  5HW8 A;  4TW8 A;  4JFK A;  4QT3 A;  1FJD A;  3IK8 A;  1C9H A;  2KFW A;  1FKG A;  4DRI A;  4U86 A;  5HW7 A;  2LPV A;  3VAW A;  2RUC A;  1F8A B;  3JYM A;  4DRN A;  4DH0 A;  3O5F A;  2ZQS A;  3KAC A;  4DRJ A;  3ODK A;  1QPL A;  3IKD A;  2ZQV A;  3O5O A;  3O5J A;  4ITZ A;  4ODM A;  4DZ3 A;  2ITK A;  5J6E A;  1R9H A;  1D7J A;  1KT1 A;  1L1P A;  4G50 A;  4W9Q A;  4MGV A;  3KZ7 A;  4DZ2 A;  1D7I A;  2FKE A;  1HXV A;  1JVW A;  2N87 A;  4TYO A;  4R0X A;  4JFM A;  5DIT A;  1FKB A;  2XPB A;  3PA7 A;  2XP5 A;  2PPN A;  2XP9 A;  2XP3 A;  1FAP A;  1BKF A;  5DIV A;  4LAY A;  2MPH A;  3O5I A;  2IF4 A;  4N19 A;  1FKJ A;  2M08 A;  1PIN A;  2MNT A;  1NMV A;  2XP7 A;  3KCE A;  2OFN A;  4G2P A;  4BF8 A;  1U79 A;  2ZR6 A;  4IQC A;  4U84 A;  4DRK A;  1KT0 A;  5DIU A;  3NRK A;  3MDY B;  3WH0 A;  3PRB A;  5I98 A;  4LAX A;  5HWB A;  4GIV A;  2ZR5 A;  3O5M A;  3UI4 A;  2XPA A;  4IQ2 A;  1FKL A;  3FAP A;  3O5Q A;  1FKR A;  1FKI A;  2AWG A;  5HKG A;  2RUR A;  4ODL A;  1J4R A;  2ZR4 A;  3O5L A;  2MLX A;  4TX0 A;  1F40 A;  1FKT A;  2VN1 A;  3IKG A;  4LAV A;  2FAP A;  2K8I A;  1Q6I A;  1W26 A;  2XP4 A;  3TC5 A;  4DRO A;  1N1A A;  5HWC A;  3LUO A;  5HUA A;  1PBK A;  2Y78 A;  1TCO C;  2PBC A;  1NSG A;  4ODK A;  1Q1C A;  2DG3 A;  3CGM A;  4J4N A;  5HT1 A;  1Y0O A;  2PV1 A;  4W9O A;  3TCZ A;  3UQI A;  4J4O A;  4W9P A;  4JFL A;  4DRQ A;  4ODQ A;  3RGC A;  2PV3 A;  3H9R B;  2RQS A;  4DRM A;  2MF9 A;  4NNR A;  1Q6U A;  1ROU A;  2LJ4 A;  3NTP A;  4JFI A;  3JYJ A;  2PPP A;  1J6Y A;  3B7X A;  2F2D A;  3IHZ A;  1J4I A;  1T11 A;  2KR7 A;  2M2A A;  1J4H A;  5GPG A;  3UF8 A;  4C02 B;  4DT4 A;  1ZK6 A;  4ODO A;  3PRD A;  1YW5 A;  1QPF A;  1FKS A;  3I6C A;  3KAI A;  2Q5A A;  4DRH A;  1FKK A;  3GPK A;  1BL4 A;  4FAP A;  2LGO A;  2KI3 A;  2KGJ A;  4JFJ A;  5HW6 A;  2LKN A;  2MLZ A;  1FD9 A;  3EY6 A;  1FKD A;  3OOB A;  2PPO A;  2KE0 A;  4IPX A;  1YAT A;  2XP6 A;  2RUQ A;  3JXV A;  1Q6H A;  2UZ5 A;  3CGN A;  2F21 A;  2DG4 A;  2RUD A;  3RFW A;  4JYS A;  1ROT A;  4ODR A;  2PV2 A;  4QT2 A;  4TNS A;  1JNT A;  5D75 A;  4ODP A;  2D9F A;  1D6O A;  3O5R A;  2RSE A;  4FN2 A;  1A7X A;  4QIB A;  3KAD A;  3UI6 A;  3O5E A;  3O5P A;  5HTG A;  1JNS A; 
#chains in the Genus database with same CATH topology
 1H0G A;  4GGQ A;  3CHC A;  3B8S A;  1HJV A;  4TW6 A;  1X6N A;  4R5E A;  1EYM A;  1LL4 A;  3O5D A;  4NZC A;  4AY1 A;  1NMW A;  2WK2 A;  4UDM A;  3B9A A;  4TW7 A;  1ZCN A;  5BXJ A;  3PRA A;  2G41 A;  5DF0 A;  3CHF A;  3TDB A;  3KAH A;  1WB0 A;  2DG9 A;  4TW8 A;  1FJD A;  2KFW A;  4LGX A;  2LPV A;  3RM8 A;  3O5F A;  1QPL A;  4DZ3 A;  4ZPT R;  3FY1 A;  1XHG A;  4DWS D;  1JVW A;  2IUZ A;  1GOI A;  1WNO A;  3OA5 A;  3KCE A;  4P8W A;  4WKA A;  1H0I A;  2OFN A;  3WQW A;  2ZR6 A;  4IQC A;  5DIU A;  3NRK A;  3MDY B;  3WH0 A;  3W4R A;  2YBT A;  1GRJ A;  3WL0 A;  2ZR5 A;  3FAP A;  1J4R A;  2MLX A;  4TX0 A;  4Z2G A;  1F40 A;  4WJX A;  1SR0 A;  4DRO A;  5HWC A;  2WM0 A;  5HUA A;  1PBK A;  2Y78 A;  2PBC A;  4J4N A;  2F23 A;  1HKJ A;  3TCZ A;  3WD0 A;  4W9P A;  3FXY A;  5GQB A;  1NWS A;  1Q6U A;  3JYJ A;  4WIW A;  1CTN A;  2KR7 A;  1J4H A;  1UR9 A;  3KAI A;  1LG1 A;  1LL6 A;  2PI6 A;  4JFJ A;  2LKN A;  1LQ0 A;  4QZV B;  4IPX A;  1OGB A;  1YAT A;  1Q6H A;  3CH9 A;  2F21 A;  4JYS A;  1ZL1 A;  4TNS A;  2D9F A;  4ZS6 A;  4HAR A;  1E6Z A;  3O5P A;  2ESC A;  1FKF A;  1D7H A;  3UQA A;  3ARU A;  1GPF A;  4KR0 B;  1SYT A;  2DPE A;  3KAF A;  1P5Q A;  1FFQ A;  2ETN A;  4MSP A;  2KO7 A;  4LAW A;  3G6L A;  4JFK A;  4QT3 A;  1FKG A;  4DRI A;  1W1V A;  3VAW A;  2RUC A;  1F8A B;  1E6N A;  2ZQS A;  5J6E A;  4ITZ A;  1D7J A;  4IT6 A;  3CHD A;  1D7I A;  2G8Z A;  1HXV A;  4TYO A;  4R0X A;  1XRV A;  1FKB A;  2XPB A;  2XP9 A;  2XP3 A;  3GU0 A;  2MPH A;  4N19 A;  2IF4 A;  4URI A;  1JND A;  2MNT A;  3ARX A;  1NMV A;  1NWT A;  3WD4 A;  4BF8 A;  1W9U A;  4NSB A;  3WL1 A;  5JH8 A;  2DT1 A;  3PRB A;  5HWB A;  3O5M A;  3UI4 A;  4IQ2 A;  1FKL A;  1FKI A;  1IX5 A;  3IKG A;  2XP4 A;  1Q6I A;  3AQU A;  1ZU8 A;  4ODK A;  4DWS A;  1Q1C A;  3BMB A;  3CGM A;  1Y0O A;  4W9O A;  3UQI A;  4J4O A;  4Z2K A;  4JFL A;  3AS3 A;  4MNJ A;  2RQS A;  1E15 A;  4NNR A;  2LJ4 A;  1ROU A;  2PPP A;  1J6Y A;  3B7X A;  4HBE A;  2F2D A;  4C02 B;  2OLH A;  4DT4 A;  1EIB A;  1ZK6 A;  4MNK A;  3PRD A;  1YW5 A;  3I6C A;  1LL7 A;  1ITX A;  3GPK A;  1BL4 A;  4FAP A;  2LGO A;  2KI3 A;  3PR9 A;  4L72 B;  1FD9 A;  3EY6 A;  1LJY A;  3WD2 A;  4Z2J A;  1OWQ A;  2UZ5 A;  1LG2 A;  2RUD A;  1TFV A;  4ODR A;  1E9L A;  3ARW A;  3UI6 A;  1JCH B;  3KAD A;  3O5E A;  1QZ2 A;  2DSV A;  1B6C A;  3UQB A;  2DSU A;  4O2T A;  4MNM A;  1O6I A;  1WAW A;  2ZQT A;  1EQ3 A;  2VCD A;  1NWU A;  1ZBW A;  4PTM A;  4ODN A;  4S3K A;  4P8X A;  1HKM A;  2L2S A;  4U85 A;  2JZV A;  3EIP A;  1E6P A;  1FKH A;  1JNE A;  4ML4 A;  2MLY A;  2PN0 A;  4U86 A;  4Q7N A;  4DRN A;  2DT3 A;  4DH0 A;  3RM4 A;  4DRP A;  3ODK A;  3O5J A;  1L1P A;  4G50 A;  3AS1 A;  4W9Q A;  4MGV A;  5DO2 A;  3KZ7 A;  2FKE A;  2N87 A;  4HBO A;  4JFM A;  5DIT A;  3PA7 A;  2PPN A;  1D2K A;  1FAP A;  5DIV A;  1NH6 A;  4LAY A;  3ARQ A;  3O5I A;  4MPK A;  3RME A;  2XP7 A;  2M08 A;  4U84 A;  3AS2 A;  3WKZ A;  1KT0 A;  1W1Y A;  4Z2H A;  4LAX A;  4GIV A;  4MNL A;  5HKG A;  3ARR A;  2WLZ A;  2RUR A;  4ODL A;  4DWS B;  2A3E A;  4LAV A;  2FAP A;  1W26 A;  3TC5 A;  5HBF A;  1N1A A;  3AS0 A;  3ALF A;  3LUO A;  1NSG A;  4W5U A;  1W9P A;  2O9O A;  2PV1 A;  2AOS A;  4DRQ A;  4ODQ A;  3ALG A;  2O92 A;  1HKK A;  2A3C A;  4P8U A;  3NTP A;  4DWS C;  4JFI A;  1J4I A;  2M2A A;  3UF8 A;  2DT2 A;  4ODO A;  1FKS A;  4L3N A;  2Q5A A;  1FKK A;  1RD6 A;  2QF8 A;  2KGJ A;  3CHE A;  3G6M A;  2B31 A;  5HW6 A;  1ZBC A;  2MLZ A;  3RM9 A;  4Z2L A;  2PPO A;  1W1P A;  2XP6 A;  2RUQ A;  2DG4 A;  3RFW A;  4MAV A;  1ROT A;  4XAK A;  1W1T A;  1D6O A;  4FN2 A;  4QIB A;  2YBU A;  1M5Y A;  3NI6 A;  2ZQU A;  1FFR A;  4WKH A;  2F4E A;  2A3B A;  3KAB A;  5B8I C;  4DIP A;  3O5G A;  2XP8 A;  4ZPW R;  4ZPV R;  3WQV A;  4S3J A;  1VF8 A;  3ARP A;  2M1I A;  3O5K A;  3KAG A;  1ZB5 A;  3UI5 A;  5HW8 A;  5GPR A;  1GUV A;  3WD3 A;  3IK8 A;  1C9H A;  3QOK A;  5HW7 A;  4P8V A;  3JYM A;  4DRJ A;  3KAC A;  2FDM A;  3IKD A;  4ODM A;  2ZQV A;  3O5O A;  2ITK A;  1R9H A;  1KT1 A;  4Z2I A;  4WK9 A;  4DZ2 A;  3ARZ A;  2A3A A;  2XP5 A;  1W9V A;  1BKF A;  2EUL A;  4KQZ A;  2DSZ A;  1FKJ A;  1PIN A;  2P4V A;  2DSW A;  1HKI A;  4Q22 A;  4G2P A;  1U79 A;  2B5U B;  4IT4 A;  1ZBV A;  4WKF A;  4DRK A;  3ARY A;  5I98 A;  1HJX A;  1NWR A;  2XPA A;  3O5Q A;  1FKR A;  2AWG A;  3B9D A;  2ZR4 A;  3O5L A;  3ARS A;  1HJW A;  2WLY A;  1FKT A;  2VN1 A;  2K8I A;  3WIJ A;  2DT0 A;  1TCO C;  3ARV A;  2DG3 A;  5HT1 A;  4MTV A;  3CZ8 A;  3ART A;  3RGC A;  1UR8 A;  2PV3 A;  3H9R B;  4DRM A;  2MF9 A;  3B9E A;  1KFW A;  1OGG A;  3IHZ A;  1T11 A;  5GPG A;  1E44 A;  1QPF A;  3ARO A;  4DRH A;  1EHN A;  3BXW A;  3GTY X;  1FKD A;  3OOB A;  1ZBK A;  1X6L A;  2KE0 A;  1K9T A;  3JXV A;  3CGN A;  5D75 A;  1E6R A;  2PV2 A;  4QT2 A;  1JNT A;  4ODP A;  3O5R A;  2RSE A;  1JNS A;  1A7X A;  3WD1 A;  5HTG A;  5DEZ A;  1EDQ A; 
#chains in the Genus database with same CATH homology
 1H0G A;  4GGQ A;  3CHC A;  3B8S A;  1HJV A;  4TW6 A;  1X6N A;  4R5E A;  1EYM A;  1LL4 A;  3O5D A;  4NZC A;  4AY1 A;  1NMW A;  2WK2 A;  3B9A A;  4TW7 A;  1ZCN A;  5BXJ A;  3PRA A;  2G41 A;  5DF0 A;  3CHF A;  3TDB A;  3KAH A;  1WB0 A;  2DG9 A;  4TW8 A;  1FJD A;  2KFW A;  4LGX A;  2LPV A;  3RM8 A;  3O5F A;  1QPL A;  4DZ3 A;  4ZPT R;  3FY1 A;  1XHG A;  4DWS D;  1JVW A;  2IUZ A;  1GOI A;  1WNO A;  3OA5 A;  3KCE A;  4P8W A;  4WKA A;  1H0I A;  2OFN A;  3WQW A;  2ZR6 A;  4IQC A;  5DIU A;  3NRK A;  3MDY B;  3WH0 A;  3W4R A;  2YBT A;  3WL0 A;  2ZR5 A;  3FAP A;  1J4R A;  2MLX A;  4TX0 A;  4Z2G A;  1F40 A;  4WJX A;  1SR0 A;  4DRO A;  5HWC A;  2WM0 A;  5HUA A;  1PBK A;  2Y78 A;  2PBC A;  4J4N A;  1HKJ A;  3TCZ A;  3WD0 A;  4W9P A;  3FXY A;  5GQB A;  1NWS A;  1Q6U A;  3JYJ A;  4WIW A;  1CTN A;  2KR7 A;  1J4H A;  1UR9 A;  3KAI A;  1LG1 A;  1LL6 A;  2PI6 A;  4JFJ A;  2LKN A;  1LQ0 A;  4QZV B;  4IPX A;  1OGB A;  1YAT A;  1Q6H A;  3CH9 A;  2F21 A;  4JYS A;  1ZL1 A;  4TNS A;  2D9F A;  4ZS6 A;  4HAR A;  1E6Z A;  3O5P A;  2ESC A;  1FKF A;  1D7H A;  3UQA A;  3ARU A;  1GPF A;  4KR0 B;  1SYT A;  2DPE A;  3KAF A;  1P5Q A;  1FFQ A;  4MSP A;  2KO7 A;  4LAW A;  3G6L A;  4JFK A;  4QT3 A;  1FKG A;  4DRI A;  1W1V A;  3VAW A;  2RUC A;  1F8A B;  1E6N A;  2ZQS A;  5J6E A;  4ITZ A;  1D7J A;  4IT6 A;  3CHD A;  1D7I A;  2G8Z A;  1HXV A;  4TYO A;  4R0X A;  1XRV A;  1FKB A;  2XPB A;  2XP9 A;  2XP3 A;  2MPH A;  4N19 A;  2IF4 A;  4URI A;  1JND A;  2MNT A;  1NMV A;  3ARX A;  1NWT A;  3WD4 A;  4BF8 A;  1W9U A;  4NSB A;  3WL1 A;  5JH8 A;  2DT1 A;  3PRB A;  5HWB A;  3O5M A;  3UI4 A;  4IQ2 A;  1FKL A;  1FKI A;  1IX5 A;  3IKG A;  2XP4 A;  1Q6I A;  3AQU A;  1ZU8 A;  4ODK A;  4DWS A;  1Q1C A;  3CGM A;  1Y0O A;  4W9O A;  3UQI A;  4J4O A;  4Z2K A;  4JFL A;  3AS3 A;  4MNJ A;  2RQS A;  1E15 A;  4NNR A;  2LJ4 A;  1ROU A;  2PPP A;  1J6Y A;  3B7X A;  4HBE A;  2F2D A;  4C02 B;  2OLH A;  4DT4 A;  1EIB A;  1ZK6 A;  4MNK A;  3PRD A;  1YW5 A;  3I6C A;  1LL7 A;  1ITX A;  3GPK A;  1BL4 A;  4FAP A;  2LGO A;  2KI3 A;  3PR9 A;  4L72 B;  1FD9 A;  3EY6 A;  1LJY A;  3WD2 A;  4Z2J A;  1OWQ A;  2UZ5 A;  1LG2 A;  2RUD A;  1TFV A;  4ODR A;  1E9L A;  3ARW A;  3UI6 A;  3KAD A;  3O5E A;  1QZ2 A;  2DSV A;  1B6C A;  3UQB A;  2DSU A;  4O2T A;  4MNM A;  1O6I A;  1WAW A;  2ZQT A;  1EQ3 A;  2VCD A;  1NWU A;  1ZBW A;  4PTM A;  4ODN A;  4S3K A;  4P8X A;  1HKM A;  2L2S A;  4U85 A;  2JZV A;  1E6P A;  1FKH A;  1JNE A;  4ML4 A;  2MLY A;  4U86 A;  4Q7N A;  4DRN A;  2DT3 A;  4DH0 A;  3RM4 A;  4DRP A;  3ODK A;  3O5J A;  1L1P A;  4G50 A;  3AS1 A;  4W9Q A;  4MGV A;  5DO2 A;  3KZ7 A;  2FKE A;  2N87 A;  4HBO A;  4JFM A;  5DIT A;  3PA7 A;  2PPN A;  1D2K A;  1FAP A;  5DIV A;  1NH6 A;  4LAY A;  3ARQ A;  3O5I A;  4MPK A;  3RME A;  2XP7 A;  2M08 A;  4U84 A;  3AS2 A;  3WKZ A;  1KT0 A;  1W1Y A;  4Z2H A;  4LAX A;  4GIV A;  4MNL A;  5HKG A;  3ARR A;  2WLZ A;  2RUR A;  4ODL A;  4DWS B;  2A3E A;  4LAV A;  2FAP A;  1W26 A;  3TC5 A;  5HBF A;  1N1A A;  3AS0 A;  3ALF A;  3LUO A;  1NSG A;  4W5U A;  1W9P A;  2O9O A;  2PV1 A;  2AOS A;  4DRQ A;  4ODQ A;  3ALG A;  2O92 A;  1HKK A;  2A3C A;  4P8U A;  3NTP A;  4DWS C;  4JFI A;  1J4I A;  2M2A A;  3UF8 A;  2DT2 A;  4ODO A;  1FKS A;  4L3N A;  2Q5A A;  1FKK A;  1RD6 A;  2QF8 A;  2KGJ A;  3CHE A;  3G6M A;  2B31 A;  5HW6 A;  1ZBC A;  2MLZ A;  3RM9 A;  4Z2L A;  2PPO A;  1W1P A;  2XP6 A;  2RUQ A;  2DG4 A;  3RFW A;  4MAV A;  1ROT A;  4XAK A;  1W1T A;  1D6O A;  4FN2 A;  4QIB A;  2YBU A;  1M5Y A;  3NI6 A;  2ZQU A;  1FFR A;  4WKH A;  2F4E A;  2A3B A;  3KAB A;  5B8I C;  4DIP A;  3O5G A;  2XP8 A;  4ZPW R;  4ZPV R;  3WQV A;  4S3J A;  1VF8 A;  3ARP A;  2M1I A;  3O5K A;  3KAG A;  1ZB5 A;  3UI5 A;  5HW8 A;  5GPR A;  1GUV A;  3WD3 A;  3IK8 A;  1C9H A;  3QOK A;  5HW7 A;  4P8V A;  3JYM A;  4DRJ A;  3KAC A;  2FDM A;  3IKD A;  4ODM A;  2ZQV A;  3O5O A;  2ITK A;  1R9H A;  1KT1 A;  4Z2I A;  4WK9 A;  4DZ2 A;  3ARZ A;  2A3A A;  2XP5 A;  1W9V A;  1BKF A;  4KQZ A;  2DSZ A;  1FKJ A;  1PIN A;  2DSW A;  1HKI A;  4Q22 A;  4G2P A;  1U79 A;  4IT4 A;  1ZBV A;  4WKF A;  4DRK A;  3ARY A;  5I98 A;  1HJX A;  1NWR A;  2XPA A;  3O5Q A;  1FKR A;  2AWG A;  3B9D A;  2ZR4 A;  3O5L A;  3ARS A;  1HJW A;  2WLY A;  1FKT A;  2VN1 A;  2K8I A;  3WIJ A;  2DT0 A;  1TCO C;  3ARV A;  2DG3 A;  5HT1 A;  4MTV A;  3CZ8 A;  3ART A;  3RGC A;  1UR8 A;  2PV3 A;  3H9R B;  4DRM A;  2MF9 A;  3B9E A;  1KFW A;  1OGG A;  3IHZ A;  1T11 A;  5GPG A;  1QPF A;  3ARO A;  4DRH A;  1EHN A;  3BXW A;  1FKD A;  3OOB A;  1ZBK A;  1X6L A;  2KE0 A;  1K9T A;  3JXV A;  3CGN A;  5D75 A;  1E6R A;  2PV2 A;  4QT2 A;  1JNT A;  4ODP A;  3O5R A;  2RSE A;  1JNS A;  1A7X A;  3WD1 A;  5HTG A;  5DEZ A;  1EDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...