4JFLA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 6-({(1s,5r)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-2-oxo-3,9-diazabicyclo[3.3.1]non-9-yl}sulfonyl)-1,3-benzothiazol-2(3h)-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jflA00
1J6YA 2RSEA 2ZR4A 3O5OA 4JYSA 4DRQA 1Y0OA 1FD9A 3KAFA 3O5FA 3PRDA 2KO7A 5B8IC 1FKGA 1Q1CA 2Y78A 4TW8A 5DIUA 3IHZA 4QT3A 3KZ7A 2DG4A 1M5YA 1JVWA 2F2DA 2M1IA 3OOBA 1D7JA 4GGQA 1NSGA 2F4EA 1FKIA 2XP5A 3ODKA 4DIPA 4DRIA 5I98A 4QIBA 1U79A 2N87A 4LAXA 2FKEA 2Q5AA 1D6OA 3LUOA 4DZ3A 4ODNA 2PV3A 3O5JA 2DG9A 2MLZA 2MNTA 3TCZA 4BF8A 4N19A 4LAYA 2LKNA 1FKKA 4DRMA 2PV2A 2ZR5A 1ROUA 2LJ4A 1A7XA 3O5MA 4U86A 1NMWA 2PPPA 2XP9A 2PPOA 1B6CA 3O5PA 4IQCA 1BL4A 2OFNA 3O5LA 4DZ2A 2ZQUA 3B7XA 3CGMA 4R0XA 1P5QA 5HKGA 1ROTA 2FAPA 1F40A 4ODOA 1KT0A 5HW6A 1FKDA 1YW5A 2D9FA 2MLXA 3UI5A 1FKLA 2MLYA 1R9HA 2ZQVA 4MSPA 2KGJA 2L2SA 1PBKA 3UF8A 2XPBA 1QPLA 1QPFA 3VAWA 4FAPA 1JNSA 1FKHA 3O5EA 1EYMA 3O5QA 4NNRA 1FKBA 4LAWA 4DH0A 4DRHA 4DRPA 2XP8A 4ODLA 1D7HA 3KAGA 3PRBA 4JFJA 3H9RB 3MDYB 3NI6A 2M08A 3UQBA 2PPNA 2RURA 1EQ3A 2RQSA 4DRKA 1BKFA 5HWBA 3RGCA 1Q6HA 3NTPA 3O5IA 1ZK6A 3O5GA 1L1PA 3O5KA 1FKFA 1JNTA 4JFKA 1YATA 4ODQA 3UI4A 2PV1A 4W9QA 2XPAA 4JFLA 3KAIA 2ZQSA 2AWGA 2VN1A 3TC5A 5HW7A 3UI6A 4IPXA 4TW6A 3PA7A 2XP3A 2JZVA 1N1AA 3KADA 4ODMA 2IF4A 2RUQA 4W9OA 5DIVA 1J4HA 1NMVA 3I6CA 1TCOC 4QT2A 4TX0A 2ZQTA 2ITKA 1Q6IA 1ZCNA 1D7IA 4O2TA 1KT1A 5HW8A 3IKDA 4TNSA 2F21A 4U84A 4C02B 4ITZA 2UZ5A 2VCDA 4IQ2A 4DROA 2KE0A 5J6EA 1PINA 4J4OA 3KAHA 2MF9A 1FJDA 3KABA 4JFIA 2K8IA 3RFWA 5HWCA 4MGVA 4W9PA 4LAVA 2LPVA 1C9HA 2DG3A 1Q6UA 1QZ2A 4ODKA 1FAPA 2M2AA 3JYMA 2RUCA 4G2PA 1F8AB 5BXJA 2LGOA 3IK8A 4U85A 3JYJA 3KACA 4FN2A 3WH0A 4TW7A 4DRJA 4TYOA 2PBCA 4DT4A 3UQAA 3NRKA 1J4RA 3EY6A 4GIVA 5HT1A 1FKJA 1FKSA 3GPKA 4G50A 4DRNA 1HXVA 1W26A 2XP7A 1J4IA 2MPHA 2XP6A 3IKGA 2ZR6A 4J4NA 4JFMA 3O5RA 4ODRA 3TDBA 5HUAA 5D75A 3O5DA 3UQIA 5GPGA 3FAPA 3CGNA 5DITA 1FKRA 3KCEA 2RUDA 3JXVA 2XP4A 1FKTA 2KFWA 4ODPA 2KI3A 5HTGA 2KR7A 1T11A
chains in the Genus database with same CATH superfamily
1J6YA 1GOIA 3O5OA 2KO7A 3G6LA 2Y78A 3ARYA 3GU0A 3IHZA 2DG4A 2O9OA 4GGQA 1FKIA 1EHNA 1U79A 4LAXA 3ARZA 1NWRA 4WK9A 4MPKA 2DPEA 2MLZA 1HKKA 1W1PA 4DRMA 2PV2A 1ROUA 1KFWA 3CHCA 1HJWA 1NMWA 2PPPA 3O5PA 1BL4A 3B7XA 3WL0A 1F40A 3B9EA 1YW5A 3UI5A 2MLYA 4KR0B 4MSPA 2KGJA 3ARRA 3UF8A 4WKFA 3VAWA 3O5QA 4DRPA 4NNRA 1FKBA 3AS3A 4JFJA 5GQBA 1LG2A 5JH8A 3UQBA 2PPNA 1EQ3A 1BKFA 1E6NA 1NWSA 3O5GA 3O5KA 4JFKA 2XPAA 4JFLA 2A3CA 2AWGA 5HW7A 4Z2JA 3PA7A 2DT0A 1K9TA 1N1AA 4ODMA 1LL6A 2IUZA 4Z2LA 4IT4A 1J4HA 4QT2A 2ZQTA 1NWTA 4O2TA 5HW8A 1GRJA 1CTNA 3W4RA 1E6PA 2VCDA 4IQ2A 1PINA 4J4OA 3KAHA 3RFWA 1NH6A 2K8IA 4WIWA 4HBEA 1HKJA 2DG3A 1Q6UA 1QZ2A 4DWSA 4ODKA 3G6MA 2LGOA 4U85A 4FN2A 4TW7A 4DRJA 1VF8A 4TYOA 3UQAA 4S3KA 1OGGA 4W5UA 4G50A 4DRNA 1HXVA 2MPHA 2P4VA 2XP6A 3GTYX 1RD6A 2DT3A 1W9UA 3UQIA 1TFVA 5DITA 3WD1A 4ODPA 4LAWA 1FFRA 2A3EA 2RSEA 1Y0OA 1FD9A 2PI6A 3BMBA 3PRDA 3CH9A 5B8IC 1FKGA 2WK2A 4Q7NA 5DIUA 1JVWA 3BXWA 3ODKA 4DIPA 2FDMA 2N87A 2FKEA 2Q5AA 4HBOA 1D6OA 1IX5A 4DZ3A 4ODNA 2YBTA 3B9DA 2DG9A 4LAYA 2ETNA 2LKNA 3OA5A 4ZS6A 2LJ4A 4U86A 3ALGA 3ARTA 1X6NA 1B6CA 2OFNA 4P8VA 4MTVA 3CGMA 1KT0A 2MLXA 1FKLA 1R9HA 2ZQVA 2DT1A 3AQUA 1QPFA 1FFQA 1FKHA 3O5EA 1EYMA 4DH0A 1D7HA 3KAGA 3CHEA 1LJYA 3EIPA 3NI6A 2OLHA 1E15A 2WLYA 3O5IA 1ZK6A 4MNLA 1L1PA 1FKFA 1O6IA 2F23A 4W9QA 3TC5A 2VN1A 3UI6A 4TW6A 2JZVA 3KADA 3CZ8A 2RUQA 4KQZA 3I6CA 1NMVA 1TCOC 1ITXA 1Q6IA 3PRAA 3WD3A 4U84A 1EDQA 1ZBVA 2B5UB 4C02B 2MF9A 4MAVA 1H0GA 4XAKA 4MGVA 4W9PA 3AS2A 4LAVA 2O92A 2G41A 4G2PA 1FAPA 3CHDA 5BXJA 4ZPWR 1F8AB 4DWSD 3IK8A 3JYJA 3KACA 2DSWA 1H0IA 3WL1A 1J4RA 5HT1A 1W26A 4ODRA 1ZU8A 2AOSA 3TDBA 4HARA 5GPGA 3FAPA 3CGNA 3JXVA 2XP4A 1FKTA 2KFWA 4DT4A 1LL7A 2KI3A 3B9AA 2ZR4A 4DRQA 1E6ZA 1GUVA 3O5FA 4NSBA 1Q1CA 1E9LA 3KZ7A 3WD2A 2F2DA 3OOBA 1D7JA 4DRIA 3RM8A 1ZB5A 4DWSB 1UR9A 1W9PA 1HKIA 3O5JA 2MNTA 4BF8A 4N19A 1EIBA 1FKKA 2ESCA 4IT6A 4LGXA 2ZR5A 3ARXA 1OGBA 1WAWA 1A7XA 4WJXA 4IQCA 1W1VA 2PPOA 2ZQUA 1P5QA 2FAPA 5HW6A 1W9VA 4PTMA 1JCHB 2XPBA 2DSZA 1JNSA 2PN0A 3ARUA 4ODLA 3PRBA 3RM4A 3H9RB 4R5EA 2M08A 1JNDA 2RURA 3PR9A 2RQSA 4DRKA 5GPRA 3RGCA 3NTPA 2DT2A 1JNTA 5DO2A 3ARQA 2WLZA 4S3JA 5DF0A 4W9OA 2IF4A 1ZBWA 4Z2KA 1D7IA 2B31A 2A3BA 1XHGA 4ITZA 3ARPA 4MNJA 2KE0A 5J6EA 3RMEA 4AY1A 4URIA 3KABA 4JFIA 4MNMA 1LQ0A 4P8WA 4ZPTR 4Z2HA 1D2KA 3CHFA 3JYMA 2A3AA 1HJVA 3WH0A 3AROA 3WD4A 3NRKA 2DSVA 3EY6A 1WB0A 3WQVA 1FKJA 1FKSA 3GPKA 1GPFA 2XP7A 3IKGA 4J4NA 4JFMA 5HUAA 1LG1A 1FKRA 3ALFA 3QOKA 3KCEA 5HTGA 2KR7A 5D75A 1T11A 2G8ZA 4JYSA 1E6RA 3KAFA 1UR8A 4TW8A 4QT3A 1ZBKA 1M5YA 2M1IA 1NSGA 2F4EA 2XP5A 5I98A 1LL4A 1ZBCA 4QIBA 1HKMA 3LUOA 3FXYA 2PV3A 3WKZA 4DWSC 3AS1A 4Q22A 3TCZA 2DSUA 4P8UA 3O5MA 2XP9A 3B8SA 3O5LA 4DZ2A 4R0XA 5HKGA 1ROTA 1SYTA 4ODOA 1FKDA 2D9FA 4Z2GA 4ZPVR 2L2SA 1PBKA 1X6LA 1QPLA 4FAPA 1ZL1A 4Z2IA 4DRHA 2XP8A 3RM9A 1HJXA 3MDYB 2WM0A 5HWBA 4MNKA 1Q6HA 5HBFA 1OWQA 2YBUA 3UI4A 3ARWA 4ODQA 1YATA 3FY1A 2PV1A 3KAIA 2ZQSA 1E44A 4P8XA 4IPXA 5DEZA 2XP3A 3ARVA 5DIVA 3AS0A 4ML4A 4TX0A 2ITKA 1ZCNA 3WIJA 4L3NA 1KT1A 3IKDA 3ARSA 4TNSA 2F21A 4L72B 2QF8A 2UZ5A 1WNOA 4DROA 1SR0A 1FJDA 5HWCA 4NZCA 2LPVA 1C9HA 1W1TA 1JNEA 2M2AA 2RUCA 4WKAA 2PBCA 1XRVA 1W1YA 4GIVA 1J4IA 2ZR6A 3O5RA 1NWUA 3O5DA 2EULA 4UDMA 3WQWA 4WKHA 4QZVB 2RUDA 3WD0A
chains in the Genus database with same CATH topology
1J6YA 1GOIA 3O5OA 2KO7A 3G6LA 2Y78A 3ARYA 3IHZA 2DG4A 2O9OA 4GGQA 1FKIA 1EHNA 1U79A 4LAXA 3ARZA 1NWRA 4WK9A 4MPKA 2DPEA 2MLZA 1HKKA 1W1PA 4DRMA 2PV2A 1ROUA 1KFWA 3CHCA 1HJWA 1NMWA 2PPPA 3O5PA 1BL4A 3B7XA 3WL0A 1F40A 3B9EA 1YW5A 3UI5A 2MLYA 4KR0B 4MSPA 2KGJA 3ARRA 3UF8A 4WKFA 3VAWA 3O5QA 4DRPA 4NNRA 1FKBA 3AS3A 4JFJA 5GQBA 1LG2A 5JH8A 3UQBA 2PPNA 1EQ3A 1BKFA 1E6NA 1NWSA 3O5GA 3O5KA 4JFKA 2XPAA 4JFLA 2A3CA 2AWGA 5HW7A 4Z2JA 3PA7A 2DT0A 1K9TA 1N1AA 4ODMA 1LL6A 2IUZA 4Z2LA 4IT4A 1J4HA 4QT2A 2ZQTA 1NWTA 4O2TA 5HW8A 1CTNA 3W4RA 1E6PA 2VCDA 4IQ2A 1PINA 4J4OA 3KAHA 3RFWA 1NH6A 2K8IA 4WIWA 4HBEA 1HKJA 2DG3A 1Q6UA 1QZ2A 4DWSA 4ODKA 3G6MA 2LGOA 4U85A 4FN2A 4TW7A 4DRJA 1VF8A 4TYOA 3UQAA 4S3KA 1OGGA 4W5UA 4G50A 4DRNA 1HXVA 2MPHA 2XP6A 1RD6A 2DT3A 1W9UA 3UQIA 1TFVA 5DITA 3WD1A 4ODPA 4LAWA 1FFRA 2A3EA 2RSEA 1Y0OA 1FD9A 2PI6A 3PRDA 3CH9A 5B8IC 1FKGA 2WK2A 4Q7NA 5DIUA 1JVWA 3BXWA 3ODKA 4DIPA 2FDMA 2N87A 2FKEA 2Q5AA 4HBOA 1D6OA 1IX5A 4DZ3A 4ODNA 2YBTA 3B9DA 2DG9A 4LAYA 2LKNA 3OA5A 4ZS6A 2LJ4A 4U86A 3ALGA 3ARTA 1X6NA 1B6CA 2OFNA 4P8VA 4MTVA 3CGMA 1KT0A 2MLXA 1FKLA 1R9HA 2ZQVA 2DT1A 3AQUA 1QPFA 1FFQA 1FKHA 3O5EA 1EYMA 4DH0A 1D7HA 3KAGA 3CHEA 1LJYA 3NI6A 2OLHA 1E15A 2WLYA 3O5IA 1ZK6A 4MNLA 1L1PA 1FKFA 1O6IA 4W9QA 3TC5A 2VN1A 3UI6A 4TW6A 2JZVA 3KADA 3CZ8A 2RUQA 4KQZA 3I6CA 1NMVA 1TCOC 1ITXA 1Q6IA 3PRAA 3WD3A 4U84A 1EDQA 1ZBVA 4C02B 2MF9A 4MAVA 1H0GA 4XAKA 4MGVA 4W9PA 3AS2A 4LAVA 2O92A 2G41A 4G2PA 1FAPA 3CHDA 5BXJA 4ZPWR 1F8AB 4DWSD 3IK8A 3JYJA 3KACA 2DSWA 1H0IA 3WL1A 1J4RA 5HT1A 1W26A 4ODRA 1ZU8A 2AOSA 3TDBA 4HARA 5GPGA 3FAPA 3CGNA 3JXVA 2XP4A 1FKTA 2KFWA 4DT4A 1LL7A 2KI3A 3B9AA 2ZR4A 4DRQA 1E6ZA 1GUVA 3O5FA 4NSBA 1Q1CA 1E9LA 3KZ7A 3WD2A 2F2DA 3OOBA 1D7JA 4DRIA 3RM8A 1ZB5A 4DWSB 1UR9A 1W9PA 1HKIA 3O5JA 2MNTA 4BF8A 4N19A 1EIBA 1FKKA 2ESCA 4IT6A 4LGXA 2ZR5A 3ARXA 1OGBA 1WAWA 1A7XA 4WJXA 4IQCA 1W1VA 2PPOA 2ZQUA 1P5QA 2FAPA 5HW6A 1W9VA 4PTMA 2XPBA 2DSZA 1JNSA 3ARUA 4ODLA 3PRBA 3RM4A 3H9RB 4R5EA 2M08A 1JNDA 2RURA 3PR9A 2RQSA 4DRKA 5GPRA 3RGCA 3NTPA 2DT2A 1JNTA 5DO2A 3ARQA 2WLZA 4S3JA 5DF0A 4W9OA 2IF4A 1ZBWA 4Z2KA 1D7IA 2B31A 2A3BA 1XHGA 4ITZA 3ARPA 4MNJA 2KE0A 5J6EA 3RMEA 4AY1A 4URIA 3KABA 4JFIA 4MNMA 1LQ0A 4P8WA 4ZPTR 4Z2HA 1D2KA 3CHFA 3JYMA 2A3AA 1HJVA 3WH0A 3AROA 3WD4A 3NRKA 2DSVA 3EY6A 1WB0A 3WQVA 1FKJA 1FKSA 3GPKA 1GPFA 2XP7A 4J4NA 3IKGA 4JFMA 5HUAA 1LG1A 1FKRA 3ALFA 3QOKA 3KCEA 5HTGA 2KR7A 5D75A 1T11A 2G8ZA 4JYSA 1E6RA 3KAFA 1UR8A 4TW8A 4QT3A 1ZBKA 1M5YA 2M1IA 1NSGA 2F4EA 2XP5A 5I98A 1LL4A 1ZBCA 4QIBA 1HKMA 3LUOA 3FXYA 2PV3A 3WKZA 4DWSC 3AS1A 4Q22A 3TCZA 2DSUA 4P8UA 3O5MA 2XP9A 3B8SA 3O5LA 4DZ2A 4R0XA 5HKGA 1ROTA 1SYTA 4ODOA 1FKDA 2D9FA 4Z2GA 4ZPVR 2L2SA 1PBKA 1X6LA 1QPLA 4FAPA 1ZL1A 4Z2IA 4DRHA 2XP8A 3RM9A 1HJXA 3MDYB 2WM0A 5HWBA 4MNKA 1Q6HA 5HBFA 1OWQA 2YBUA 3UI4A 3ARWA 4ODQA 1YATA 3FY1A 2PV1A 3KAIA 2ZQSA 4P8XA 4IPXA 5DEZA 2XP3A 3ARVA 5DIVA 3AS0A 4ML4A 4TX0A 2ITKA 1ZCNA 3WIJA 4L3NA 1KT1A 3IKDA 3ARSA 4TNSA 2F21A 4L72B 2QF8A 2UZ5A 1WNOA 4DROA 1SR0A 1FJDA 5HWCA 4NZCA 2LPVA 1C9HA 1W1TA 1JNEA 2M2AA 2RUCA 4WKAA 2PBCA 1XRVA 1W1YA 4GIVA 1J4IA 2ZR6A 3O5RA 1NWUA 3O5DA 3WQWA 4WKHA 4QZVB 2RUDA 3WD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Y A;  2RSE A;  2ZR4 A;  3O5O A;  4JYS A;  4DRQ A;  1Y0O A;  1FD9 A;  3KAF A;  3O5F A;  3PRD A;  2KO7 A;  5B8I C;  1FKG A;  1Q1C A;  2Y78 A;  4TW8 A;  5DIU A;  3IHZ A;  4QT3 A;  3KZ7 A;  2DG4 A;  1M5Y A;  1JVW A;  2F2D A;  2M1I A;  3OOB A;  1D7J A;  4GGQ A;  1NSG A;  2F4E A;  1FKI A;  2XP5 A;  3ODK A;  4DIP A;  4DRI A;  5I98 A;  4QIB A;  1U79 A;  2N87 A;  4LAX A;  2FKE A;  2Q5A A;  1D6O A;  3LUO A;  4DZ3 A;  4ODN A;  2PV3 A;  3O5J A;  2DG9 A;  2MLZ A;  2MNT A;  3TCZ A;  4BF8 A;  4N19 A;  4LAY A;  2LKN A;  1FKK A;  4DRM A;  2PV2 A;  2ZR5 A;  1ROU A;  2LJ4 A;  1A7X A;  3O5M A;  4U86 A;  1NMW A;  2PPP A;  2XP9 A;  2PPO A;  1B6C A;  3O5P A;  4IQC A;  1BL4 A;  2OFN A;  3O5L A;  4DZ2 A;  2ZQU A;  3B7X A;  3CGM A;  4R0X A;  1P5Q A;  5HKG A;  1ROT A;  2FAP A;  1F40 A;  4ODO A;  1KT0 A;  5HW6 A;  1FKD A;  1YW5 A;  2D9F A;  2MLX A;  3UI5 A;  1FKL A;  2MLY A;  1R9H A;  2ZQV A;  4MSP A;  2KGJ A;  2L2S A;  1PBK A;  3UF8 A;  2XPB A;  1QPL A;  1QPF A;  3VAW A;  4FAP A;  1JNS A;  1FKH A;  3O5E A;  1EYM A;  3O5Q A;  4NNR A;  1FKB A;  4LAW A;  4DH0 A;  4DRH A;  4DRP A;  2XP8 A;  4ODL A;  1D7H A;  3KAG A;  3PRB A;  4JFJ A;  3H9R B;  3MDY B;  3NI6 A;  2M08 A;  3UQB A;  2PPN A;  2RUR A;  1EQ3 A;  2RQS A;  4DRK A;  1BKF A;  5HWB A;  3RGC A;  1Q6H A;  3NTP A;  3O5I A;  1ZK6 A;  3O5G A;  1L1P A;  3O5K A;  1FKF A;  1JNT A;  4JFK A;  1YAT A;  4ODQ A;  3UI4 A;  2PV1 A;  4W9Q A;  2XPA A;  4JFL A;  3KAI A;  2ZQS A;  2AWG A;  2VN1 A;  3TC5 A;  5HW7 A;  3UI6 A;  4IPX A;  4TW6 A;  3PA7 A;  2XP3 A;  2JZV A;  1N1A A;  3KAD A;  4ODM A;  2IF4 A;  2RUQ A;  4W9O A;  5DIV A;  1J4H A;  1NMV A;  3I6C A;  1TCO C;  4QT2 A;  4TX0 A;  2ZQT A;  2ITK A;  1Q6I A;  1ZCN A;  1D7I A;  4O2T A;  1KT1 A;  5HW8 A;  3IKD A;  4TNS A;  2F21 A;  4U84 A;  4C02 B;  4ITZ A;  2UZ5 A;  2VCD A;  4IQ2 A;  4DRO A;  2KE0 A;  5J6E A;  1PIN A;  4J4O A;  3KAH A;  2MF9 A;  1FJD A;  3KAB A;  4JFI A;  2K8I A;  3RFW A;  5HWC A;  4MGV A;  4W9P A;  4LAV A;  2LPV A;  1C9H A;  2DG3 A;  1Q6U A;  1QZ2 A;  4ODK A;  1FAP A;  2M2A A;  3JYM A;  2RUC A;  4G2P A;  1F8A B;  5BXJ A;  2LGO A;  3IK8 A;  4U85 A;  3JYJ A;  3KAC A;  4FN2 A;  3WH0 A;  4TW7 A;  4DRJ A;  4TYO A;  2PBC A;  4DT4 A;  3UQA A;  3NRK A;  1J4R A;  3EY6 A;  4GIV A;  5HT1 A;  1FKJ A;  1FKS A;  3GPK A;  4G50 A;  4DRN A;  1HXV A;  1W26 A;  2XP7 A;  1J4I A;  2MPH A;  2XP6 A;  3IKG A;  2ZR6 A;  4J4N A;  4JFM A;  3O5R A;  4ODR A;  3TDB A;  5HUA A;  5D75 A;  3O5D A;  3UQI A;  5GPG A;  3FAP A;  3CGN A;  5DIT A;  1FKR A;  3KCE A;  2RUD A;  3JXV A;  2XP4 A;  1FKT A;  2KFW A;  4ODP A;  2KI3 A;  5HTG A;  2KR7 A;  1T11 A; 
#chains in the Genus database with same CATH topology
 1J6Y A;  1GOI A;  3O5O A;  2KO7 A;  3G6L A;  2Y78 A;  3ARY A;  3GU0 A;  3IHZ A;  2DG4 A;  2O9O A;  4GGQ A;  1FKI A;  1EHN A;  1U79 A;  4LAX A;  3ARZ A;  1NWR A;  4WK9 A;  4MPK A;  2DPE A;  2MLZ A;  1HKK A;  1W1P A;  4DRM A;  2PV2 A;  1ROU A;  1KFW A;  3CHC A;  1HJW A;  1NMW A;  2PPP A;  3O5P A;  1BL4 A;  3B7X A;  3WL0 A;  1F40 A;  3B9E A;  1YW5 A;  3UI5 A;  2MLY A;  4KR0 B;  4MSP A;  2KGJ A;  3ARR A;  3UF8 A;  4WKF A;  3VAW A;  3O5Q A;  4DRP A;  4NNR A;  1FKB A;  3AS3 A;  4JFJ A;  5GQB A;  1LG2 A;  5JH8 A;  3UQB A;  2PPN A;  1EQ3 A;  1BKF A;  1E6N A;  1NWS A;  3O5G A;  3O5K A;  4JFK A;  2XPA A;  4JFL A;  2A3C A;  2AWG A;  5HW7 A;  4Z2J A;  3PA7 A;  2DT0 A;  1K9T A;  1N1A A;  4ODM A;  1LL6 A;  2IUZ A;  4Z2L A;  4IT4 A;  1J4H A;  4QT2 A;  2ZQT A;  1NWT A;  4O2T A;  5HW8 A;  1GRJ A;  1CTN A;  3W4R A;  1E6P A;  2VCD A;  4IQ2 A;  1PIN A;  4J4O A;  3KAH A;  3RFW A;  1NH6 A;  2K8I A;  4WIW A;  4HBE A;  1HKJ A;  2DG3 A;  1Q6U A;  1QZ2 A;  4DWS A;  4ODK A;  3G6M A;  2LGO A;  4U85 A;  4FN2 A;  4TW7 A;  4DRJ A;  1VF8 A;  4TYO A;  3UQA A;  4S3K A;  1OGG A;  4W5U A;  4G50 A;  4DRN A;  1HXV A;  2MPH A;  2P4V A;  2XP6 A;  3GTY X;  1RD6 A;  2DT3 A;  1W9U A;  3UQI A;  1TFV A;  5DIT A;  3WD1 A;  4ODP A;  4LAW A;  1FFR A;  2A3E A;  2RSE A;  1Y0O A;  1FD9 A;  2PI6 A;  3BMB A;  3PRD A;  3CH9 A;  5B8I C;  1FKG A;  2WK2 A;  4Q7N A;  5DIU A;  1JVW A;  3BXW A;  3ODK A;  4DIP A;  2FDM A;  2N87 A;  2FKE A;  2Q5A A;  4HBO A;  1D6O A;  1IX5 A;  4DZ3 A;  4ODN A;  2YBT A;  3B9D A;  2DG9 A;  4LAY A;  2ETN A;  2LKN A;  3OA5 A;  4ZS6 A;  2LJ4 A;  4U86 A;  3ALG A;  3ART A;  1X6N A;  1B6C A;  2OFN A;  4P8V A;  4MTV A;  3CGM A;  1KT0 A;  2MLX A;  1FKL A;  1R9H A;  2ZQV A;  2DT1 A;  3AQU A;  1QPF A;  1FFQ A;  1FKH A;  3O5E A;  1EYM A;  4DH0 A;  1D7H A;  3KAG A;  3CHE A;  1LJY A;  3EIP A;  3NI6 A;  2OLH A;  1E15 A;  2WLY A;  3O5I A;  1ZK6 A;  4MNL A;  1L1P A;  1FKF A;  1O6I A;  2F23 A;  4W9Q A;  3TC5 A;  2VN1 A;  3UI6 A;  4TW6 A;  2JZV A;  3KAD A;  3CZ8 A;  2RUQ A;  4KQZ A;  3I6C A;  1NMV A;  1TCO C;  1ITX A;  1Q6I A;  3PRA A;  3WD3 A;  4U84 A;  1EDQ A;  1ZBV A;  2B5U B;  4C02 B;  2MF9 A;  4MAV A;  1H0G A;  4XAK A;  4MGV A;  4W9P A;  3AS2 A;  4LAV A;  2O92 A;  2G41 A;  4G2P A;  1FAP A;  3CHD A;  5BXJ A;  4ZPW R;  1F8A B;  4DWS D;  3IK8 A;  3JYJ A;  3KAC A;  2DSW A;  1H0I A;  3WL1 A;  1J4R A;  5HT1 A;  1W26 A;  4ODR A;  1ZU8 A;  2AOS A;  3TDB A;  4HAR A;  5GPG A;  3FAP A;  3CGN A;  3JXV A;  2XP4 A;  1FKT A;  2KFW A;  4DT4 A;  1LL7 A;  2KI3 A;  3B9A A;  2ZR4 A;  4DRQ A;  1E6Z A;  1GUV A;  3O5F A;  4NSB A;  1Q1C A;  1E9L A;  3KZ7 A;  3WD2 A;  2F2D A;  3OOB A;  1D7J A;  4DRI A;  3RM8 A;  1ZB5 A;  4DWS B;  1UR9 A;  1W9P A;  1HKI A;  3O5J A;  2MNT A;  4BF8 A;  4N19 A;  1EIB A;  1FKK A;  2ESC A;  4IT6 A;  4LGX A;  2ZR5 A;  3ARX A;  1OGB A;  1WAW A;  1A7X A;  4WJX A;  4IQC A;  1W1V A;  2PPO A;  2ZQU A;  1P5Q A;  2FAP A;  5HW6 A;  1W9V A;  4PTM A;  1JCH B;  2XPB A;  2DSZ A;  1JNS A;  2PN0 A;  3ARU A;  4ODL A;  3PRB A;  3RM4 A;  3H9R B;  4R5E A;  2M08 A;  1JND A;  2RUR A;  3PR9 A;  2RQS A;  4DRK A;  5GPR A;  3RGC A;  3NTP A;  2DT2 A;  1JNT A;  5DO2 A;  3ARQ A;  2WLZ A;  4S3J A;  5DF0 A;  4W9O A;  2IF4 A;  1ZBW A;  4Z2K A;  1D7I A;  2B31 A;  2A3B A;  1XHG A;  4ITZ A;  3ARP A;  4MNJ A;  2KE0 A;  5J6E A;  3RME A;  4AY1 A;  4URI A;  3KAB A;  4JFI A;  4MNM A;  1LQ0 A;  4P8W A;  4ZPT R;  4Z2H A;  1D2K A;  3CHF A;  3JYM A;  2A3A A;  1HJV A;  3WH0 A;  3ARO A;  3WD4 A;  3NRK A;  2DSV A;  3EY6 A;  1WB0 A;  3WQV A;  1FKJ A;  1FKS A;  3GPK A;  1GPF A;  2XP7 A;  3IKG A;  4J4N A;  4JFM A;  5HUA A;  1LG1 A;  1FKR A;  3ALF A;  3QOK A;  3KCE A;  5HTG A;  2KR7 A;  5D75 A;  1T11 A;  2G8Z A;  4JYS A;  1E6R A;  3KAF A;  1UR8 A;  4TW8 A;  4QT3 A;  1ZBK A;  1M5Y A;  2M1I A;  1NSG A;  2F4E A;  2XP5 A;  5I98 A;  1LL4 A;  1ZBC A;  4QIB A;  1HKM A;  3LUO A;  3FXY A;  2PV3 A;  3WKZ A;  4DWS C;  3AS1 A;  4Q22 A;  3TCZ A;  2DSU A;  4P8U A;  3O5M A;  2XP9 A;  3B8S A;  3O5L A;  4DZ2 A;  4R0X A;  5HKG A;  1ROT A;  1SYT A;  4ODO A;  1FKD A;  2D9F A;  4Z2G A;  4ZPV R;  2L2S A;  1PBK A;  1X6L A;  1QPL A;  4FAP A;  1ZL1 A;  4Z2I A;  4DRH A;  2XP8 A;  3RM9 A;  1HJX A;  3MDY B;  2WM0 A;  5HWB A;  4MNK A;  1Q6H A;  5HBF A;  1OWQ A;  2YBU A;  3UI4 A;  3ARW A;  4ODQ A;  1YAT A;  3FY1 A;  2PV1 A;  3KAI A;  2ZQS A;  1E44 A;  4P8X A;  4IPX A;  5DEZ A;  2XP3 A;  3ARV A;  5DIV A;  3AS0 A;  4ML4 A;  4TX0 A;  2ITK A;  1ZCN A;  3WIJ A;  4L3N A;  1KT1 A;  3IKD A;  3ARS A;  4TNS A;  2F21 A;  4L72 B;  2QF8 A;  2UZ5 A;  1WNO A;  4DRO A;  1SR0 A;  1FJD A;  5HWC A;  4NZC A;  2LPV A;  1C9H A;  1W1T A;  1JNE A;  2M2A A;  2RUC A;  4WKA A;  2PBC A;  1XRV A;  1W1Y A;  4GIV A;  1J4I A;  2ZR6 A;  3O5R A;  1NWU A;  3O5D A;  2EUL A;  4UDM A;  3WQW A;  4WKH A;  4QZV B;  2RUD A;  3WD0 A; 
#chains in the Genus database with same CATH homology
 1J6Y A;  1GOI A;  3O5O A;  2KO7 A;  3G6L A;  2Y78 A;  3ARY A;  3IHZ A;  2DG4 A;  2O9O A;  4GGQ A;  1FKI A;  1EHN A;  1U79 A;  4LAX A;  3ARZ A;  1NWR A;  4WK9 A;  4MPK A;  2DPE A;  2MLZ A;  1HKK A;  1W1P A;  4DRM A;  2PV2 A;  1ROU A;  1KFW A;  3CHC A;  1HJW A;  1NMW A;  2PPP A;  3O5P A;  1BL4 A;  3B7X A;  3WL0 A;  1F40 A;  3B9E A;  1YW5 A;  3UI5 A;  2MLY A;  4KR0 B;  4MSP A;  2KGJ A;  3ARR A;  3UF8 A;  4WKF A;  3VAW A;  3O5Q A;  4DRP A;  4NNR A;  1FKB A;  3AS3 A;  4JFJ A;  5GQB A;  1LG2 A;  5JH8 A;  3UQB A;  2PPN A;  1EQ3 A;  1BKF A;  1E6N A;  1NWS A;  3O5G A;  3O5K A;  4JFK A;  2XPA A;  4JFL A;  2A3C A;  2AWG A;  5HW7 A;  4Z2J A;  3PA7 A;  2DT0 A;  1K9T A;  1N1A A;  4ODM A;  1LL6 A;  2IUZ A;  4Z2L A;  4IT4 A;  1J4H A;  4QT2 A;  2ZQT A;  1NWT A;  4O2T A;  5HW8 A;  1CTN A;  3W4R A;  1E6P A;  2VCD A;  4IQ2 A;  1PIN A;  4J4O A;  3KAH A;  3RFW A;  1NH6 A;  2K8I A;  4WIW A;  4HBE A;  1HKJ A;  2DG3 A;  1Q6U A;  1QZ2 A;  4DWS A;  4ODK A;  3G6M A;  2LGO A;  4U85 A;  4FN2 A;  4TW7 A;  4DRJ A;  1VF8 A;  4TYO A;  3UQA A;  4S3K A;  1OGG A;  4W5U A;  4G50 A;  4DRN A;  1HXV A;  2MPH A;  2XP6 A;  1RD6 A;  2DT3 A;  1W9U A;  3UQI A;  1TFV A;  5DIT A;  3WD1 A;  4ODP A;  4LAW A;  1FFR A;  2A3E A;  2RSE A;  1Y0O A;  1FD9 A;  2PI6 A;  3PRD A;  3CH9 A;  5B8I C;  1FKG A;  2WK2 A;  4Q7N A;  5DIU A;  1JVW A;  3BXW A;  3ODK A;  4DIP A;  2FDM A;  2N87 A;  2FKE A;  2Q5A A;  4HBO A;  1D6O A;  1IX5 A;  4DZ3 A;  4ODN A;  2YBT A;  3B9D A;  2DG9 A;  4LAY A;  2LKN A;  3OA5 A;  4ZS6 A;  2LJ4 A;  4U86 A;  3ALG A;  3ART A;  1X6N A;  1B6C A;  2OFN A;  4P8V A;  4MTV A;  3CGM A;  1KT0 A;  2MLX A;  1FKL A;  1R9H A;  2ZQV A;  2DT1 A;  3AQU A;  1QPF A;  1FFQ A;  1FKH A;  3O5E A;  1EYM A;  4DH0 A;  1D7H A;  3KAG A;  3CHE A;  1LJY A;  3NI6 A;  2OLH A;  1E15 A;  2WLY A;  3O5I A;  1ZK6 A;  4MNL A;  1L1P A;  1FKF A;  1O6I A;  4W9Q A;  3TC5 A;  2VN1 A;  3UI6 A;  4TW6 A;  2JZV A;  3KAD A;  3CZ8 A;  2RUQ A;  4KQZ A;  3I6C A;  1NMV A;  1TCO C;  1ITX A;  1Q6I A;  3PRA A;  3WD3 A;  4U84 A;  1EDQ A;  1ZBV A;  4C02 B;  2MF9 A;  4MAV A;  1H0G A;  4XAK A;  4MGV A;  4W9P A;  3AS2 A;  4LAV A;  2O92 A;  2G41 A;  4G2P A;  1FAP A;  3CHD A;  5BXJ A;  4ZPW R;  1F8A B;  4DWS D;  3IK8 A;  3JYJ A;  3KAC A;  2DSW A;  1H0I A;  3WL1 A;  1J4R A;  5HT1 A;  1W26 A;  4ODR A;  1ZU8 A;  2AOS A;  3TDB A;  4HAR A;  5GPG A;  3FAP A;  3CGN A;  3JXV A;  2XP4 A;  1FKT A;  2KFW A;  4DT4 A;  1LL7 A;  2KI3 A;  3B9A A;  2ZR4 A;  4DRQ A;  1E6Z A;  1GUV A;  3O5F A;  4NSB A;  1Q1C A;  1E9L A;  3KZ7 A;  3WD2 A;  2F2D A;  3OOB A;  1D7J A;  4DRI A;  3RM8 A;  1ZB5 A;  4DWS B;  1UR9 A;  1W9P A;  1HKI A;  3O5J A;  2MNT A;  4BF8 A;  4N19 A;  1EIB A;  1FKK A;  2ESC A;  4IT6 A;  4LGX A;  2ZR5 A;  3ARX A;  1OGB A;  1WAW A;  1A7X A;  4WJX A;  4IQC A;  1W1V A;  2PPO A;  2ZQU A;  1P5Q A;  2FAP A;  5HW6 A;  1W9V A;  4PTM A;  2XPB A;  2DSZ A;  1JNS A;  3ARU A;  4ODL A;  3PRB A;  3RM4 A;  3H9R B;  4R5E A;  2M08 A;  1JND A;  2RUR A;  3PR9 A;  2RQS A;  4DRK A;  5GPR A;  3RGC A;  3NTP A;  2DT2 A;  1JNT A;  5DO2 A;  3ARQ A;  2WLZ A;  4S3J A;  5DF0 A;  4W9O A;  2IF4 A;  1ZBW A;  4Z2K A;  1D7I A;  2B31 A;  2A3B A;  1XHG A;  4ITZ A;  3ARP A;  4MNJ A;  2KE0 A;  5J6E A;  3RME A;  4AY1 A;  4URI A;  3KAB A;  4JFI A;  4MNM A;  1LQ0 A;  4P8W A;  4ZPT R;  4Z2H A;  1D2K A;  3CHF A;  3JYM A;  2A3A A;  1HJV A;  3WH0 A;  3ARO A;  3WD4 A;  3NRK A;  2DSV A;  3EY6 A;  1WB0 A;  3WQV A;  1FKJ A;  1FKS A;  3GPK A;  1GPF A;  2XP7 A;  4J4N A;  3IKG A;  4JFM A;  5HUA A;  1LG1 A;  1FKR A;  3ALF A;  3QOK A;  3KCE A;  5HTG A;  2KR7 A;  5D75 A;  1T11 A;  2G8Z A;  4JYS A;  1E6R A;  3KAF A;  1UR8 A;  4TW8 A;  4QT3 A;  1ZBK A;  1M5Y A;  2M1I A;  1NSG A;  2F4E A;  2XP5 A;  5I98 A;  1LL4 A;  1ZBC A;  4QIB A;  1HKM A;  3LUO A;  3FXY A;  2PV3 A;  3WKZ A;  4DWS C;  3AS1 A;  4Q22 A;  3TCZ A;  2DSU A;  4P8U A;  3O5M A;  2XP9 A;  3B8S A;  3O5L A;  4DZ2 A;  4R0X A;  5HKG A;  1ROT A;  1SYT A;  4ODO A;  1FKD A;  2D9F A;  4Z2G A;  4ZPV R;  2L2S A;  1PBK A;  1X6L A;  1QPL A;  4FAP A;  1ZL1 A;  4Z2I A;  4DRH A;  2XP8 A;  3RM9 A;  1HJX A;  3MDY B;  2WM0 A;  5HWB A;  4MNK A;  1Q6H A;  5HBF A;  1OWQ A;  2YBU A;  3UI4 A;  3ARW A;  4ODQ A;  1YAT A;  3FY1 A;  2PV1 A;  3KAI A;  2ZQS A;  4P8X A;  4IPX A;  5DEZ A;  2XP3 A;  3ARV A;  5DIV A;  3AS0 A;  4ML4 A;  4TX0 A;  2ITK A;  1ZCN A;  3WIJ A;  4L3N A;  1KT1 A;  3IKD A;  3ARS A;  4TNS A;  2F21 A;  4L72 B;  2QF8 A;  2UZ5 A;  1WNO A;  4DRO A;  1SR0 A;  1FJD A;  5HWC A;  4NZC A;  2LPV A;  1C9H A;  1W1T A;  1JNE A;  2M2A A;  2RUC A;  4WKA A;  2PBC A;  1XRV A;  1W1Y A;  4GIV A;  1J4I A;  2ZR6 A;  3O5R A;  1NWU A;  3O5D A;  3WQW A;  4WKH A;  4QZV B;  2RUD A;  3WD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...