4JFLA

Increasing the efficiency efficiency of ligands for the fk506-binding protein 51 by conformational control: complex of fkbp51 with 6-({(1s,5r)-3-[2-(3,4-dimethoxyphenoxy)ethyl]-2-oxo-3,9-diazabicyclo[3.3.1]non-9-yl}sulfonyl)-1,3-benzothiazol-2(3h)-one
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control.
pubmed doi rcsb
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
molecule tags Isomerase
source organism Homo sapiens
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4jflA00
5HTGA 3O5LA 4TNSA 1FD9A 1J4RA 3LUOA 2KO7A 1FKFA 2VN1A 2LJ4A 3KAFA 4ODNA 5BXJA 3UQAA 1FKTA 2UZ5A 2FAPA 3TCZA 4DRKA 4FAPA 4DRQA 3IKGA 1Q6UA 2ZQTA 4ODQA 4LAVA 1NMWA 2MLYA 2L2SA 3EY6A 1ZK6A 3GPKA 3JXVA 1FKBA 4NNRA 1KT1A 3CGNA 1D7IA 1PBKA 1ZCNA 2RSEA 3FAPA 4IQCA 4O2TA 4TW8A 4U85A 4W9QA 5HW8A 3NTPA 3CGMA 1EQ3A 2XPAA 1F8AB 1QPFA 1F40A 3O5KA 1L1PA 1TCOC 1FAPA 4BF8A 2ZR5A 4QIBA 4DH0A 1M5YA 1Q6IA 2ITKA 1B6CA 2K8IA 2LPVA 4IPXA 4J4OA 3H9RB 2M08A 4LAWA 5HWCA 1BL4A 2FKEA 1N1AA 5DITA 2ZQVA 2RUQA 1EYMA 4JFLA 4DRMA 1FKRA 1A7XA 3JYJA 2AWGA 3UF8A 4DZ2A 1QPLA 2Y78A 4U84A 1KT0A 4DIPA 3KACA 3OOBA 3O5QA 3O5GA 5J6EA 4QT2A 2LGOA 3ODKA 1YW5A 4ODPA 2F4EA 1FKGA 3UQIA 3IKDA 2KI3A 2KR7A 2PPNA 1C9HA 3O5DA 1Q1CA 4GGQA 3RFWA 2LKNA 3JYMA 3O5MA 3WH0A 3KAHA 1FKSA 1FJDA 1HXVA 2PV2A 2JZVA 2F2DA 1R9HA 5HW6A 1FKIA 4N19A 4FN2A 4ODKA 2ZR4A 3KZ7A 4J4NA 3TC5A 2OFNA 5HW7A 3NI6A 4ODOA 1BKFA 2XP3A 3UI4A 2DG3A 4LAYA 2D9FA 1NSGA 3O5IA 4DRPA 4TW6A 1FKKA 4DT4A 1Q6HA 3IHZA 2M2AA 2XP8A 2PBCA 1D7JA 3KAIA 2N87A 2Q5AA 1J6YA 1J4IA 2PV1A 5DIVA 2VCDA 2XP4A 1D7HA 1ROUA 3KADA 2IF4A 3MDYB 1J4HA 3O5PA 4JFKA 4TX0A 2M1IA 4JFMA 1ROTA 2RURA 3KCEA 3UQBA 5HKGA 2XP7A 5GPGA 2KGJA 3KABA 4GIVA 3O5OA 4MGVA 2RUCA 4ODRA 4TW7A 5D75A 3VAWA 5HWBA 4MSPA 1FKDA 2MLZA 4DRNA 4ITZA 2XPBA 3RGCA 2RQSA 2MLXA 1FKHA 2MPHA 4JFJA 4JYSA 3TDBA 5HUAA 4R0XA 5I98A 3O5RA 3PRDA 3I6CA 3PRBA 2DG9A 2XP6A 1D6OA 3NRKA 3UI6A 5HT1A 2ZR6A 4DRHA 2PPPA 2XP9A 4DRIA 4G50A 4DRJA 4DZ3A 4IQ2A 1U79A 3PA7A 2ZQSA 4G2PA 3O5EA 1FKJA 5DIUA 4W9OA 1NMVA 3B7XA 2F21A 2PPOA 1Y0OA 3O5JA 1JVWA 1P5QA 4ODLA 1PINA 2KE0A 4LAXA 3IK8A 1YATA 2PV3A 4QT3A 2RUDA 4JFIA 4U86A 4W9PA 1W26A 4C02B 4ODMA 1FKLA 2XP5A 2KFWA 2DG4A 4DROA 5B8IC 3O5FA 1T11A 1QZ2A 1JNTA 3KAGA 4TYOA 3UI5A 1JNSA 2MNTA 2ZQUA 2MF9A
chains in the Genus database with same CATH superfamily
4TNSA 4R5EA 1FD9A 1FKFA 2UZ5A 3B9DA 4HBOA 2A3AA 4Q22A 2DT1A 3G6MA 3IKGA 1Q6UA 4LAVA 1LG2A 4MNJA 3CGNA 3FAPA 1D7IA 4O2TA 3NTPA 1ZBVA 3CGMA 2XPAA 1W9UA 3O5KA 1GRJA 1ITXA 1TCOC 1NWUA 3WL0A 4DH0A 1M5YA 1Q6IA 2K8IA 1HJXA 2DT3A 1H0IA 4DWSC 4WJXA 1BL4A 4IT4A 1FKRA 3UF8A 1ZL1A 1QPLA 1OGGA 1KT0A 1SYTA 1WAWA 3ODKA 2YBTA 2F4EA 3CHDA 2KI3A 2PPNA 1C9HA 3JYMA 3WH0A 4LGXA 4AY1A 1HKJA 1W1TA 4ZPVR 1JNDA 4J4NA 5HBFA 2OFNA 5HW7A 4ODOA 2A3CA 3UI4A 2DG3A 2D9FA 4DWSB 1NSGA 3B9AA 3ALFA 4TW6A 1Q6HA 1HKIA 2N87A 2Q5AA 3PR9A 2PV1A 2G8ZA 2AOSA 3KCEA 4WK9A 1CTNA 3UQBA 4GIVA 5HWBA 4DRNA 4ITZA 2XPBA 2MLXA 2MPHA 4R0XA 1E6RA 3BXWA 3AS2A 2ZR6A 2WM0A 4P8WA 4DZ3A 4IQ2A 3PA7A 2WK2A 4XAKA 1NMVA 1Y0OA 3O5JA 2KE0A 4LAXA 1YATA 2PV3A 3AROA 4Z2JA 4ODMA 1FKLA 2DG4A 4DROA 3WQVA 3KAGA 3UI5A 1JNSA 1K9TA 4URIA 2O9OA 2VN1A 2LJ4A 3KAFA 1NH6A 4FAPA 1OGBA 4DRQA 2MLYA 4NNRA 4S3KA 4TW8A 1ZCNA 4Q7NA 4U85A 1F40A 1UR8A 4MNKA 4KQZA 3EIPA 4QIBA 4J4OA 1OWQA 1GOIA 2ZQVA 4P8XA 3B8SA 3BMBA 3CHCA 4NSBA 4UDMA 2Y78A 4U84A 4Z2IA 4DIPA 3O5GA 1WB0A 1W9VA 1LL4A 3RM4A 4ODPA 1FKGA 1LL7A 4GGQA 5HWCA 2LKNA 3KAHA 2F2DA 1R9HA 1E6ZA 3WD2A 4FN2A 2DSZA 1NWTA 2FDMA 1HKKA 1IX5A 3NI6A 1BKFA 3ARVA 1W1PA 4DT4A 2PBCA 1J6YA 1SR0A 1XRVA 5GQBA 3MDYB 2DSWA 3O5PA 2M1IA 5HKGA 3KABA 4L3NA 4MSPA 1FKDA 1NWSA 3CH9A 4JFJA 3O5RA 1ZU8A 2F23A 3PRBA 2XP6A 3NRKA 2DSUA 3AS3A 2PPPA 2XP9A 3AS0A 2G41A 4WKAA 3OA5A 4P8VA 4G2PA 5DIUA 3O5EA 1FKJA 2F21A 3ARUA 4HARA 2PPOA 1P5QA 3W4RA 1TFVA 4PTMA 4DWSD 3AS1A 3ARYA 3ARSA 4MTVA 4U86A 1GPFA 4C02B 3O5FA 1QZ2A 1JNTA 3FY1A 3WIJA 3IHZA 5HTGA 3LUOA 4ODNA 5BXJA 4W5UA 1FKTA 2FAPA 3TCZA 4DRKA 4ODQA 1NMWA 3EY6A 3JXVA 3ARQA 1ZK6A 1HXVA 1FKBA 4MNLA 1PBKA 2RSEA 4IQCA 4W9QA 5HW8A 1VF8A 1F8AB 1L1PA 2LPVA 1EHNA 4IPXA 3H9RB 2M08A 3RM9A 1EDQA 1N1AA 5DITA 4JFLA 4DRMA 3CZ8A 2A3BA 1A7XA 4DZ2A 3G6LA 4MPKA 1JCHB 1W1VA 4WIWA 1D2KA 1KFWA 3RMEA 3UQIA 2KR7A 3O5DA 1Q1CA 3RFWA 1FJDA 3O5MA 1HJVA 2PV2A 4NZCA 1LG1A 1FKIA 2QF8A 4N19A 4ODKA 2ZR4A 3KZ7A 3ARRA 3TC5A 5DF0A 2XP3A 4WKFA 3WD0A 3WKZA 4DRPA 2IUZA 2XP8A 1D7JA 1JNEA 3KAIA 4ML4A 1J4IA 5DIVA 2VCDA 2XP4A 3KADA 1ROUA 3WD1A 5DO2A 4DRIA 3GU0A 1ROTA 5D75A 2RUCA 1NWRA 4WKHA 4JYSA 2DG9A 1D6OA 4DWSA 4DRHA 4Z2KA 1E6PA 4G50A 4DRJA 1U79A 2ZQSA 1X6NA 1FFRA 1JVWA 3ARTA 3ARPA 3IK8A 2RUDA 2PI6A 2EULA 4ZPTR 4JFIA 1LL6A 1W26A 5B8IC 2DSVA 1T11A 1ZBCA 4TYOA 1E15A 2ZQUA 2MF9A 3O5LA 1J4RA 2KO7A 3WL1A 2DT0A 1X6LA 2ZQTA 2L2SA 4Z2LA 3GPKA 1KT1A 2DT2A 1GUVA 2ESCA 3RM8A 2B5UB 3AQUA 4L72B 1EQ3A 1ZBKA 1QPFA 1FAPA 4BF8A 2ZR5A 3ARXA 2DPEA 2ITKA 1B6CA 4LAWA 2FKEA 2WLYA 3FXYA 4ZPWR 2RUQA 1EYMA 4Z2GA 3JYJA 2AWGA 1E9LA 2O92A 2WLZA 3CHEA 3KACA 4MNMA 3OOBA 3O5QA 1ZBWA 5J6EA 1W9PA 4P8UA 1W1YA 4QT2A 2LGOA 1YW5A 4KR0B 1H0GA 3IKDA 3WD4A 3UQAA 5JH8A 2A3EA 1FKSA 2JZVA 5HW6A 1E6NA 3ARZA 4Z2HA 4HBEA 2OLHA 4S3JA 4IT6A 4LAYA 1ZB5A 1UR9A 3O5IA 1FKKA 2M2AA 1EIBA 5DEZA 1LJYA 1D7HA 2IF4A 1J4HA 4JFKA 3WQWA 4TX0A 4QZVB 1RD6A 2RURA 4JFMA 2P4VA 3GTYX 2XP7A 5GPGA 2KGJA 4TW7A 4MGVA 3O5OA 4ODRA 3VAWA 2MLZA 3RGCA 2RQSA 1FKHA 3TDBA 5HUAA 5I98A 1LQ0A 3PRDA 3WD3A 3I6CA 3UI6A 5HT1A 4MAVA 2PN0A 1O6IA 3ALGA 4W9OA 3B7XA 3QOKA 1HKMA 1XHGA 4ODLA 1PINA 4QT3A 1FFQA 3CHFA 3B9EA 1HJWA 4W9PA 2ETNA 3ARWA 2XP5A 2KFWA 1WNOA 2B31A 3PRAA 4ZS6A 1E44A 5GPRA 2YBUA 2MNTA
chains in the Genus database with same CATH topology
4TNSA 4R5EA 1FD9A 1FKFA 2UZ5A 3B9DA 4HBOA 2A3AA 4Q22A 2DT1A 3G6MA 3IKGA 1Q6UA 4LAVA 1LG2A 4MNJA 3CGNA 3FAPA 1D7IA 4O2TA 3NTPA 1ZBVA 3CGMA 2XPAA 1W9UA 3O5KA 1TCOC 1ITXA 1NWUA 3WL0A 4DH0A 1M5YA 1Q6IA 2K8IA 1HJXA 2DT3A 1H0IA 4DWSC 4WJXA 1BL4A 4IT4A 1FKRA 3UF8A 1ZL1A 1QPLA 1OGGA 1KT0A 1SYTA 1WAWA 3ODKA 2YBTA 2F4EA 3CHDA 2KI3A 2PPNA 1C9HA 3JYMA 3WH0A 4LGXA 4AY1A 1HKJA 1W1TA 4ZPVR 1JNDA 4J4NA 5HBFA 2OFNA 5HW7A 4ODOA 2A3CA 3UI4A 2DG3A 2D9FA 4DWSB 1NSGA 3B9AA 3ALFA 4TW6A 1Q6HA 1HKIA 2N87A 2Q5AA 3PR9A 2PV1A 2G8ZA 2AOSA 3KCEA 4WK9A 1CTNA 3UQBA 4GIVA 5HWBA 4DRNA 4ITZA 2XPBA 2MLXA 2MPHA 4R0XA 1E6RA 3BXWA 3AS2A 2ZR6A 2WM0A 4P8WA 4DZ3A 4IQ2A 3PA7A 2WK2A 4XAKA 1NMVA 1Y0OA 3O5JA 2KE0A 4LAXA 1YATA 2PV3A 3AROA 4Z2JA 4ODMA 1FKLA 2DG4A 4DROA 3WQVA 3KAGA 3UI5A 1JNSA 1K9TA 4URIA 2O9OA 2VN1A 2LJ4A 3KAFA 1NH6A 4FAPA 1OGBA 4DRQA 2MLYA 4NNRA 4S3KA 4TW8A 1ZCNA 4Q7NA 4U85A 1F40A 1UR8A 4MNKA 4KQZA 4QIBA 4J4OA 1OWQA 1GOIA 2ZQVA 4P8XA 3B8SA 3CHCA 4NSBA 2Y78A 4U84A 4Z2IA 4DIPA 3O5GA 1WB0A 1W9VA 1LL4A 3RM4A 4ODPA 1FKGA 1LL7A 4GGQA 5HWCA 2LKNA 3KAHA 2F2DA 1R9HA 1E6ZA 3WD2A 4FN2A 2DSZA 1NWTA 2FDMA 1HKKA 1IX5A 3NI6A 1BKFA 3ARVA 1W1PA 4DT4A 2PBCA 1J6YA 1SR0A 1XRVA 5GQBA 2DSWA 3MDYB 3O5PA 2M1IA 5HKGA 3KABA 4L3NA 4MSPA 1FKDA 1NWSA 3CH9A 4JFJA 3O5RA 1ZU8A 3PRBA 2XP6A 3NRKA 2DSUA 3AS3A 2PPPA 2XP9A 3AS0A 2G41A 4WKAA 3OA5A 4P8VA 4G2PA 5DIUA 3O5EA 1FKJA 2F21A 3ARUA 4HARA 2PPOA 1P5QA 3W4RA 1TFVA 4PTMA 4DWSD 3AS1A 3ARYA 3ARSA 4MTVA 4U86A 1GPFA 4C02B 3O5FA 1QZ2A 1JNTA 3FY1A 3WIJA 3IHZA 5HTGA 3LUOA 4ODNA 5BXJA 4W5UA 1FKTA 2FAPA 3TCZA 4DRKA 4ODQA 1NMWA 3EY6A 3JXVA 3ARQA 1ZK6A 1HXVA 1FKBA 4MNLA 1PBKA 2RSEA 4IQCA 4W9QA 5HW8A 1VF8A 1F8AB 1L1PA 2LPVA 1EHNA 4IPXA 3H9RB 2M08A 3RM9A 1EDQA 1N1AA 5DITA 4JFLA 4DRMA 3CZ8A 2A3BA 1A7XA 4DZ2A 3G6LA 4MPKA 1W1VA 4WIWA 1D2KA 1KFWA 3RMEA 3UQIA 2KR7A 3O5DA 1Q1CA 3RFWA 1FJDA 3O5MA 1HJVA 2PV2A 4NZCA 1LG1A 1FKIA 2QF8A 4N19A 4ODKA 2ZR4A 3KZ7A 3ARRA 3TC5A 5DF0A 2XP3A 4WKFA 3WD0A 3WKZA 4DRPA 2IUZA 2XP8A 1D7JA 1JNEA 3KAIA 4ML4A 1J4IA 5DIVA 2VCDA 2XP4A 3KADA 1ROUA 3WD1A 5DO2A 4DRIA 1ROTA 5D75A 2RUCA 1NWRA 4WKHA 4JYSA 2DG9A 1D6OA 4DWSA 4DRHA 4Z2KA 1E6PA 4G50A 4DRJA 1U79A 2ZQSA 1X6NA 1FFRA 1JVWA 3ARTA 3ARPA 3IK8A 2RUDA 2PI6A 4ZPTR 4JFIA 1LL6A 1W26A 5B8IC 2DSVA 1T11A 1ZBCA 4TYOA 1E15A 2ZQUA 2MF9A 3O5LA 1J4RA 2KO7A 3WL1A 2DT0A 1X6LA 2ZQTA 2L2SA 4Z2LA 3GPKA 1KT1A 2DT2A 1GUVA 2ESCA 3RM8A 4L72B 3AQUA 1EQ3A 1ZBKA 1QPFA 1FAPA 4BF8A 2ZR5A 3ARXA 2DPEA 2ITKA 1B6CA 4LAWA 2FKEA 2WLYA 3FXYA 4ZPWR 2RUQA 1EYMA 4Z2GA 3JYJA 2AWGA 1E9LA 2O92A 2WLZA 3CHEA 3KACA 4MNMA 3OOBA 3O5QA 1ZBWA 5J6EA 1W9PA 4P8UA 1W1YA 4QT2A 2LGOA 1YW5A 4KR0B 1H0GA 3IKDA 3WD4A 3UQAA 5JH8A 2A3EA 1FKSA 2JZVA 5HW6A 1E6NA 3ARZA 4Z2HA 4HBEA 2OLHA 4S3JA 4IT6A 4LAYA 1ZB5A 1UR9A 3O5IA 1FKKA 2M2AA 1EIBA 5DEZA 1LJYA 1D7HA 2IF4A 1J4HA 4JFKA 3WQWA 4TX0A 4QZVB 1RD6A 2RURA 4JFMA 2XP7A 5GPGA 2KGJA 4TW7A 4MGVA 3O5OA 4ODRA 3VAWA 2MLZA 3RGCA 2RQSA 1FKHA 3TDBA 5HUAA 5I98A 1LQ0A 3PRDA 3WD3A 3I6CA 3UI6A 5HT1A 4MAVA 1O6IA 3ALGA 4W9OA 3B7XA 3QOKA 1HKMA 1XHGA 4ODLA 1PINA 4QT3A 1FFQA 3CHFA 3B9EA 1HJWA 4W9PA 3ARWA 2XP5A 2KFWA 1WNOA 2B31A 3PRAA 4ZS6A 5GPRA 2YBUA 2MNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HTG A;  3O5L A;  4TNS A;  1FD9 A;  1J4R A;  3LUO A;  2KO7 A;  1FKF A;  2VN1 A;  2LJ4 A;  3KAF A;  4ODN A;  5BXJ A;  3UQA A;  1FKT A;  2UZ5 A;  2FAP A;  3TCZ A;  4DRK A;  4FAP A;  4DRQ A;  3IKG A;  1Q6U A;  2ZQT A;  4ODQ A;  4LAV A;  1NMW A;  2MLY A;  2L2S A;  3EY6 A;  1ZK6 A;  3GPK A;  3JXV A;  1FKB A;  4NNR A;  1KT1 A;  3CGN A;  1D7I A;  1PBK A;  1ZCN A;  2RSE A;  3FAP A;  4IQC A;  4O2T A;  4TW8 A;  4U85 A;  4W9Q A;  5HW8 A;  3NTP A;  3CGM A;  1EQ3 A;  2XPA A;  1F8A B;  1QPF A;  1F40 A;  3O5K A;  1L1P A;  1TCO C;  1FAP A;  4BF8 A;  2ZR5 A;  4QIB A;  4DH0 A;  1M5Y A;  1Q6I A;  2ITK A;  1B6C A;  2K8I A;  2LPV A;  4IPX A;  4J4O A;  3H9R B;  2M08 A;  4LAW A;  5HWC A;  1BL4 A;  2FKE A;  1N1A A;  5DIT A;  2ZQV A;  2RUQ A;  1EYM A;  4JFL A;  4DRM A;  1FKR A;  1A7X A;  3JYJ A;  2AWG A;  3UF8 A;  4DZ2 A;  1QPL A;  2Y78 A;  4U84 A;  1KT0 A;  4DIP A;  3KAC A;  3OOB A;  3O5Q A;  3O5G A;  5J6E A;  4QT2 A;  2LGO A;  3ODK A;  1YW5 A;  4ODP A;  2F4E A;  1FKG A;  3UQI A;  3IKD A;  2KI3 A;  2KR7 A;  2PPN A;  1C9H A;  3O5D A;  1Q1C A;  4GGQ A;  3RFW A;  2LKN A;  3JYM A;  3O5M A;  3WH0 A;  3KAH A;  1FKS A;  1FJD A;  1HXV A;  2PV2 A;  2JZV A;  2F2D A;  1R9H A;  5HW6 A;  1FKI A;  4N19 A;  4FN2 A;  4ODK A;  2ZR4 A;  3KZ7 A;  4J4N A;  3TC5 A;  2OFN A;  5HW7 A;  3NI6 A;  4ODO A;  1BKF A;  2XP3 A;  3UI4 A;  2DG3 A;  4LAY A;  2D9F A;  1NSG A;  3O5I A;  4DRP A;  4TW6 A;  1FKK A;  4DT4 A;  1Q6H A;  3IHZ A;  2M2A A;  2XP8 A;  2PBC A;  1D7J A;  3KAI A;  2N87 A;  2Q5A A;  1J6Y A;  1J4I A;  2PV1 A;  5DIV A;  2VCD A;  2XP4 A;  1D7H A;  1ROU A;  3KAD A;  2IF4 A;  3MDY B;  1J4H A;  3O5P A;  4JFK A;  4TX0 A;  2M1I A;  4JFM A;  1ROT A;  2RUR A;  3KCE A;  3UQB A;  5HKG A;  2XP7 A;  5GPG A;  2KGJ A;  3KAB A;  4GIV A;  3O5O A;  4MGV A;  2RUC A;  4ODR A;  4TW7 A;  5D75 A;  3VAW A;  5HWB A;  4MSP A;  1FKD A;  2MLZ A;  4DRN A;  4ITZ A;  2XPB A;  3RGC A;  2RQS A;  2MLX A;  1FKH A;  2MPH A;  4JFJ A;  4JYS A;  3TDB A;  5HUA A;  4R0X A;  5I98 A;  3O5R A;  3PRD A;  3I6C A;  3PRB A;  2DG9 A;  2XP6 A;  1D6O A;  3NRK A;  3UI6 A;  5HT1 A;  2ZR6 A;  4DRH A;  2PPP A;  2XP9 A;  4DRI A;  4G50 A;  4DRJ A;  4DZ3 A;  4IQ2 A;  1U79 A;  3PA7 A;  2ZQS A;  4G2P A;  3O5E A;  1FKJ A;  5DIU A;  4W9O A;  1NMV A;  3B7X A;  2F21 A;  2PPO A;  1Y0O A;  3O5J A;  1JVW A;  1P5Q A;  4ODL A;  1PIN A;  2KE0 A;  4LAX A;  3IK8 A;  1YAT A;  2PV3 A;  4QT3 A;  2RUD A;  4JFI A;  4U86 A;  4W9P A;  1W26 A;  4C02 B;  4ODM A;  1FKL A;  2XP5 A;  2KFW A;  2DG4 A;  4DRO A;  5B8I C;  3O5F A;  1T11 A;  1QZ2 A;  1JNT A;  3KAG A;  4TYO A;  3UI5 A;  1JNS A;  2MNT A;  2ZQU A;  2MF9 A; 
#chains in the Genus database with same CATH topology
 4TNS A;  4R5E A;  1FD9 A;  1FKF A;  2UZ5 A;  3B9D A;  4HBO A;  2A3A A;  4Q22 A;  2DT1 A;  3G6M A;  3IKG A;  1Q6U A;  4LAV A;  1LG2 A;  4MNJ A;  3CGN A;  3FAP A;  1D7I A;  4O2T A;  3NTP A;  1ZBV A;  3CGM A;  2XPA A;  1W9U A;  3O5K A;  1GRJ A;  1ITX A;  1TCO C;  1NWU A;  3WL0 A;  4DH0 A;  1M5Y A;  1Q6I A;  2K8I A;  1HJX A;  2DT3 A;  1H0I A;  4DWS C;  4WJX A;  1BL4 A;  4IT4 A;  1FKR A;  3UF8 A;  1ZL1 A;  1QPL A;  1OGG A;  1KT0 A;  1SYT A;  1WAW A;  3ODK A;  2YBT A;  2F4E A;  3CHD A;  2KI3 A;  2PPN A;  1C9H A;  3JYM A;  3WH0 A;  4LGX A;  4AY1 A;  1HKJ A;  1W1T A;  4ZPV R;  1JND A;  4J4N A;  5HBF A;  2OFN A;  5HW7 A;  4ODO A;  2A3C A;  3UI4 A;  2DG3 A;  2D9F A;  4DWS B;  1NSG A;  3B9A A;  3ALF A;  4TW6 A;  1Q6H A;  1HKI A;  2N87 A;  2Q5A A;  3PR9 A;  2PV1 A;  2G8Z A;  2AOS A;  3KCE A;  4WK9 A;  1CTN A;  3UQB A;  4GIV A;  5HWB A;  4DRN A;  4ITZ A;  2XPB A;  2MLX A;  2MPH A;  4R0X A;  1E6R A;  3BXW A;  3AS2 A;  2ZR6 A;  2WM0 A;  4P8W A;  4DZ3 A;  4IQ2 A;  3PA7 A;  2WK2 A;  4XAK A;  1NMV A;  1Y0O A;  3O5J A;  2KE0 A;  4LAX A;  1YAT A;  2PV3 A;  3ARO A;  4Z2J A;  4ODM A;  1FKL A;  2DG4 A;  4DRO A;  3WQV A;  3KAG A;  3UI5 A;  1JNS A;  1K9T A;  4URI A;  2O9O A;  2VN1 A;  2LJ4 A;  3KAF A;  1NH6 A;  4FAP A;  1OGB A;  4DRQ A;  2MLY A;  4NNR A;  4S3K A;  4TW8 A;  1ZCN A;  4Q7N A;  4U85 A;  1F40 A;  1UR8 A;  4MNK A;  4KQZ A;  3EIP A;  4QIB A;  4J4O A;  1OWQ A;  1GOI A;  2ZQV A;  4P8X A;  3B8S A;  3BMB A;  3CHC A;  4NSB A;  4UDM A;  2Y78 A;  4U84 A;  4Z2I A;  4DIP A;  3O5G A;  1WB0 A;  1W9V A;  1LL4 A;  3RM4 A;  4ODP A;  1FKG A;  1LL7 A;  4GGQ A;  5HWC A;  2LKN A;  3KAH A;  2F2D A;  1R9H A;  1E6Z A;  3WD2 A;  4FN2 A;  2DSZ A;  1NWT A;  2FDM A;  1HKK A;  1IX5 A;  3NI6 A;  1BKF A;  3ARV A;  1W1P A;  4DT4 A;  2PBC A;  1J6Y A;  1SR0 A;  1XRV A;  5GQB A;  3MDY B;  2DSW A;  3O5P A;  2M1I A;  5HKG A;  3KAB A;  4L3N A;  4MSP A;  1FKD A;  1NWS A;  3CH9 A;  4JFJ A;  3O5R A;  1ZU8 A;  2F23 A;  3PRB A;  2XP6 A;  3NRK A;  2DSU A;  3AS3 A;  2PPP A;  2XP9 A;  3AS0 A;  2G41 A;  4WKA A;  3OA5 A;  4P8V A;  4G2P A;  5DIU A;  3O5E A;  1FKJ A;  2F21 A;  3ARU A;  4HAR A;  2PPO A;  1P5Q A;  3W4R A;  1TFV A;  4PTM A;  4DWS D;  3AS1 A;  3ARY A;  3ARS A;  4MTV A;  4U86 A;  1GPF A;  4C02 B;  3O5F A;  1QZ2 A;  1JNT A;  3FY1 A;  3WIJ A;  3IHZ A;  5HTG A;  3LUO A;  4ODN A;  5BXJ A;  4W5U A;  1FKT A;  2FAP A;  3TCZ A;  4DRK A;  4ODQ A;  1NMW A;  3EY6 A;  3JXV A;  3ARQ A;  1ZK6 A;  1HXV A;  1FKB A;  4MNL A;  1PBK A;  2RSE A;  4IQC A;  4W9Q A;  5HW8 A;  1VF8 A;  1F8A B;  1L1P A;  2LPV A;  1EHN A;  4IPX A;  3H9R B;  2M08 A;  3RM9 A;  1EDQ A;  1N1A A;  5DIT A;  4JFL A;  4DRM A;  3CZ8 A;  2A3B A;  1A7X A;  4DZ2 A;  3G6L A;  4MPK A;  1JCH B;  1W1V A;  4WIW A;  1D2K A;  1KFW A;  3RME A;  3UQI A;  2KR7 A;  3O5D A;  1Q1C A;  3RFW A;  1FJD A;  3O5M A;  1HJV A;  2PV2 A;  4NZC A;  1LG1 A;  1FKI A;  2QF8 A;  4N19 A;  4ODK A;  2ZR4 A;  3KZ7 A;  3ARR A;  3TC5 A;  5DF0 A;  2XP3 A;  4WKF A;  3WD0 A;  3WKZ A;  4DRP A;  2IUZ A;  2XP8 A;  1D7J A;  1JNE A;  3KAI A;  4ML4 A;  1J4I A;  5DIV A;  2VCD A;  2XP4 A;  3KAD A;  1ROU A;  3WD1 A;  5DO2 A;  4DRI A;  3GU0 A;  1ROT A;  5D75 A;  2RUC A;  1NWR A;  4WKH A;  4JYS A;  2DG9 A;  1D6O A;  4DWS A;  4DRH A;  4Z2K A;  1E6P A;  4G50 A;  4DRJ A;  1U79 A;  2ZQS A;  1X6N A;  1FFR A;  1JVW A;  3ART A;  3ARP A;  3IK8 A;  2RUD A;  2PI6 A;  2EUL A;  4ZPT R;  4JFI A;  1LL6 A;  1W26 A;  5B8I C;  2DSV A;  1T11 A;  1ZBC A;  4TYO A;  1E15 A;  2ZQU A;  2MF9 A;  3O5L A;  1J4R A;  2KO7 A;  3WL1 A;  2DT0 A;  1X6L A;  2ZQT A;  2L2S A;  4Z2L A;  3GPK A;  1KT1 A;  2DT2 A;  1GUV A;  2ESC A;  3RM8 A;  2B5U B;  3AQU A;  4L72 B;  1EQ3 A;  1ZBK A;  1QPF A;  1FAP A;  4BF8 A;  2ZR5 A;  3ARX A;  2DPE A;  2ITK A;  1B6C A;  4LAW A;  2FKE A;  2WLY A;  3FXY A;  4ZPW R;  2RUQ A;  1EYM A;  4Z2G A;  3JYJ A;  2AWG A;  1E9L A;  2O92 A;  2WLZ A;  3CHE A;  3KAC A;  4MNM A;  3OOB A;  3O5Q A;  1ZBW A;  5J6E A;  1W9P A;  4P8U A;  1W1Y A;  4QT2 A;  2LGO A;  1YW5 A;  4KR0 B;  1H0G A;  3IKD A;  3WD4 A;  3UQA A;  5JH8 A;  2A3E A;  1FKS A;  2JZV A;  5HW6 A;  1E6N A;  3ARZ A;  4Z2H A;  4HBE A;  2OLH A;  4S3J A;  4IT6 A;  4LAY A;  1ZB5 A;  1UR9 A;  3O5I A;  1FKK A;  2M2A A;  1EIB A;  5DEZ A;  1LJY A;  1D7H A;  2IF4 A;  1J4H A;  4JFK A;  3WQW A;  4TX0 A;  4QZV B;  1RD6 A;  2RUR A;  4JFM A;  2P4V A;  3GTY X;  2XP7 A;  5GPG A;  2KGJ A;  4TW7 A;  4MGV A;  3O5O A;  4ODR A;  3VAW A;  2MLZ A;  3RGC A;  2RQS A;  1FKH A;  3TDB A;  5HUA A;  5I98 A;  1LQ0 A;  3PRD A;  3WD3 A;  3I6C A;  3UI6 A;  5HT1 A;  4MAV A;  2PN0 A;  1O6I A;  3ALG A;  4W9O A;  3B7X A;  3QOK A;  1HKM A;  1XHG A;  4ODL A;  1PIN A;  4QT3 A;  1FFQ A;  3CHF A;  3B9E A;  1HJW A;  4W9P A;  2ETN A;  3ARW A;  2XP5 A;  2KFW A;  1WNO A;  2B31 A;  3PRA A;  4ZS6 A;  1E44 A;  5GPR A;  2YBU A;  2MNT A; 
#chains in the Genus database with same CATH homology
 4TNS A;  4R5E A;  1FD9 A;  1FKF A;  2UZ5 A;  3B9D A;  4HBO A;  2A3A A;  4Q22 A;  2DT1 A;  3G6M A;  3IKG A;  1Q6U A;  4LAV A;  1LG2 A;  4MNJ A;  3CGN A;  3FAP A;  1D7I A;  4O2T A;  3NTP A;  1ZBV A;  3CGM A;  2XPA A;  1W9U A;  3O5K A;  1TCO C;  1ITX A;  1NWU A;  3WL0 A;  4DH0 A;  1M5Y A;  1Q6I A;  2K8I A;  1HJX A;  2DT3 A;  1H0I A;  4DWS C;  4WJX A;  1BL4 A;  4IT4 A;  1FKR A;  3UF8 A;  1ZL1 A;  1QPL A;  1OGG A;  1KT0 A;  1SYT A;  1WAW A;  3ODK A;  2YBT A;  2F4E A;  3CHD A;  2KI3 A;  2PPN A;  1C9H A;  3JYM A;  3WH0 A;  4LGX A;  4AY1 A;  1HKJ A;  1W1T A;  4ZPV R;  1JND A;  4J4N A;  5HBF A;  2OFN A;  5HW7 A;  4ODO A;  2A3C A;  3UI4 A;  2DG3 A;  2D9F A;  4DWS B;  1NSG A;  3B9A A;  3ALF A;  4TW6 A;  1Q6H A;  1HKI A;  2N87 A;  2Q5A A;  3PR9 A;  2PV1 A;  2G8Z A;  2AOS A;  3KCE A;  4WK9 A;  1CTN A;  3UQB A;  4GIV A;  5HWB A;  4DRN A;  4ITZ A;  2XPB A;  2MLX A;  2MPH A;  4R0X A;  1E6R A;  3BXW A;  3AS2 A;  2ZR6 A;  2WM0 A;  4P8W A;  4DZ3 A;  4IQ2 A;  3PA7 A;  2WK2 A;  4XAK A;  1NMV A;  1Y0O A;  3O5J A;  2KE0 A;  4LAX A;  1YAT A;  2PV3 A;  3ARO A;  4Z2J A;  4ODM A;  1FKL A;  2DG4 A;  4DRO A;  3WQV A;  3KAG A;  3UI5 A;  1JNS A;  1K9T A;  4URI A;  2O9O A;  2VN1 A;  2LJ4 A;  3KAF A;  1NH6 A;  4FAP A;  1OGB A;  4DRQ A;  2MLY A;  4NNR A;  4S3K A;  4TW8 A;  1ZCN A;  4Q7N A;  4U85 A;  1F40 A;  1UR8 A;  4MNK A;  4KQZ A;  4QIB A;  4J4O A;  1OWQ A;  1GOI A;  2ZQV A;  4P8X A;  3B8S A;  3CHC A;  4NSB A;  2Y78 A;  4U84 A;  4Z2I A;  4DIP A;  3O5G A;  1WB0 A;  1W9V A;  1LL4 A;  3RM4 A;  4ODP A;  1FKG A;  1LL7 A;  4GGQ A;  5HWC A;  2LKN A;  3KAH A;  2F2D A;  1R9H A;  1E6Z A;  3WD2 A;  4FN2 A;  2DSZ A;  1NWT A;  2FDM A;  1HKK A;  1IX5 A;  3NI6 A;  1BKF A;  3ARV A;  1W1P A;  4DT4 A;  2PBC A;  1J6Y A;  1SR0 A;  1XRV A;  5GQB A;  2DSW A;  3MDY B;  3O5P A;  2M1I A;  5HKG A;  3KAB A;  4L3N A;  4MSP A;  1FKD A;  1NWS A;  3CH9 A;  4JFJ A;  3O5R A;  1ZU8 A;  3PRB A;  2XP6 A;  3NRK A;  2DSU A;  3AS3 A;  2PPP A;  2XP9 A;  3AS0 A;  2G41 A;  4WKA A;  3OA5 A;  4P8V A;  4G2P A;  5DIU A;  3O5E A;  1FKJ A;  2F21 A;  3ARU A;  4HAR A;  2PPO A;  1P5Q A;  3W4R A;  1TFV A;  4PTM A;  4DWS D;  3AS1 A;  3ARY A;  3ARS A;  4MTV A;  4U86 A;  1GPF A;  4C02 B;  3O5F A;  1QZ2 A;  1JNT A;  3FY1 A;  3WIJ A;  3IHZ A;  5HTG A;  3LUO A;  4ODN A;  5BXJ A;  4W5U A;  1FKT A;  2FAP A;  3TCZ A;  4DRK A;  4ODQ A;  1NMW A;  3EY6 A;  3JXV A;  3ARQ A;  1ZK6 A;  1HXV A;  1FKB A;  4MNL A;  1PBK A;  2RSE A;  4IQC A;  4W9Q A;  5HW8 A;  1VF8 A;  1F8A B;  1L1P A;  2LPV A;  1EHN A;  4IPX A;  3H9R B;  2M08 A;  3RM9 A;  1EDQ A;  1N1A A;  5DIT A;  4JFL A;  4DRM A;  3CZ8 A;  2A3B A;  1A7X A;  4DZ2 A;  3G6L A;  4MPK A;  1W1V A;  4WIW A;  1D2K A;  1KFW A;  3RME A;  3UQI A;  2KR7 A;  3O5D A;  1Q1C A;  3RFW A;  1FJD A;  3O5M A;  1HJV A;  2PV2 A;  4NZC A;  1LG1 A;  1FKI A;  2QF8 A;  4N19 A;  4ODK A;  2ZR4 A;  3KZ7 A;  3ARR A;  3TC5 A;  5DF0 A;  2XP3 A;  4WKF A;  3WD0 A;  3WKZ A;  4DRP A;  2IUZ A;  2XP8 A;  1D7J A;  1JNE A;  3KAI A;  4ML4 A;  1J4I A;  5DIV A;  2VCD A;  2XP4 A;  3KAD A;  1ROU A;  3WD1 A;  5DO2 A;  4DRI A;  1ROT A;  5D75 A;  2RUC A;  1NWR A;  4WKH A;  4JYS A;  2DG9 A;  1D6O A;  4DWS A;  4DRH A;  4Z2K A;  1E6P A;  4G50 A;  4DRJ A;  1U79 A;  2ZQS A;  1X6N A;  1FFR A;  1JVW A;  3ART A;  3ARP A;  3IK8 A;  2RUD A;  2PI6 A;  4ZPT R;  4JFI A;  1LL6 A;  1W26 A;  5B8I C;  2DSV A;  1T11 A;  1ZBC A;  4TYO A;  1E15 A;  2ZQU A;  2MF9 A;  3O5L A;  1J4R A;  2KO7 A;  3WL1 A;  2DT0 A;  1X6L A;  2ZQT A;  2L2S A;  4Z2L A;  3GPK A;  1KT1 A;  2DT2 A;  1GUV A;  2ESC A;  3RM8 A;  4L72 B;  3AQU A;  1EQ3 A;  1ZBK A;  1QPF A;  1FAP A;  4BF8 A;  2ZR5 A;  3ARX A;  2DPE A;  2ITK A;  1B6C A;  4LAW A;  2FKE A;  2WLY A;  3FXY A;  4ZPW R;  2RUQ A;  1EYM A;  4Z2G A;  3JYJ A;  2AWG A;  1E9L A;  2O92 A;  2WLZ A;  3CHE A;  3KAC A;  4MNM A;  3OOB A;  3O5Q A;  1ZBW A;  5J6E A;  1W9P A;  4P8U A;  1W1Y A;  4QT2 A;  2LGO A;  1YW5 A;  4KR0 B;  1H0G A;  3IKD A;  3WD4 A;  3UQA A;  5JH8 A;  2A3E A;  1FKS A;  2JZV A;  5HW6 A;  1E6N A;  3ARZ A;  4Z2H A;  4HBE A;  2OLH A;  4S3J A;  4IT6 A;  4LAY A;  1ZB5 A;  1UR9 A;  3O5I A;  1FKK A;  2M2A A;  1EIB A;  5DEZ A;  1LJY A;  1D7H A;  2IF4 A;  1J4H A;  4JFK A;  3WQW A;  4TX0 A;  4QZV B;  1RD6 A;  2RUR A;  4JFM A;  2XP7 A;  5GPG A;  2KGJ A;  4TW7 A;  4MGV A;  3O5O A;  4ODR A;  3VAW A;  2MLZ A;  3RGC A;  2RQS A;  1FKH A;  3TDB A;  5HUA A;  5I98 A;  1LQ0 A;  3PRD A;  3WD3 A;  3I6C A;  3UI6 A;  5HT1 A;  4MAV A;  1O6I A;  3ALG A;  4W9O A;  3B7X A;  3QOK A;  1HKM A;  1XHG A;  4ODL A;  1PIN A;  4QT3 A;  1FFQ A;  3CHF A;  3B9E A;  1HJW A;  4W9P A;  3ARW A;  2XP5 A;  2KFW A;  1WNO A;  2B31 A;  3PRA A;  4ZS6 A;  5GPR A;  2YBU A;  2MNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...