5D75A

Crystal structure of human fkbd25 in complex with fk506
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDIDLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Crystal structure of the FK506 binding domain of human FKBP25 in complex with FK506.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/inhibitor
total genus 27
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5d75A00
2ZR4A 1M5YA 2JZVA 3TCZA 1FKBA 1Q1CA 2ZQSA 2FAPA 1F40A 2M2AA 3KCEA 4JYSA 1JVWA 4LAVA 4DRJA 3H9RB 1BKFA 4FN2A 2LGOA 2XP7A 3O5EA 2Q5AA 2ZQTA 2FKEA 5HWBA 1HXVA 4IQCA 5BXJA 2MLYA 3PRBA 4JFLA 2F21A 2KGJA 3CGMA 3O5MA 1J4IA 2KE0A 1PBKA 1FKKA 3O5JA 4ODRA 4TW8A 5HW7A 5HKGA 1Q6HA 4JFJA 4GGQA 3O5DA 1NMWA 5DITA 3UQIA 1D7IA 2F4EA 2XP9A 2PPNA 3I6CA 5HW8A 1N1AA 1EQ3A 1FKRA 2Y78A 4QIBA 3KAGA 1FJDA 2PV2A 3IHZA 1FD9A 3KAFA 2PBCA 1NMVA 2DG9A 2RUCA 4J4NA 2N87A 1ROUA 2MNTA 4GIVA 4FAPA 4TYOA 4LAYA 1R9HA 2OFNA 1BL4A 4W9QA 1B6CA 2MLXA 2PPPA 4LAXA 4DRQA 2K8IA 4TNSA 1F8AB 1FKJA 2IF4A 3KZ7A 1PINA 4W9PA 3UI4A 4BF8A 3CGNA 5HUAA 1L1PA 1P5QA 4DRMA 4NNRA 1D7JA 2M1IA 1Q6IA 2RQSA 4ODMA 4DZ2A 1J4HA 4QT2A 4JFIA 4DRKA 3UQAA 1KT0A 3O5IA 5HW6A 4TW6A 1W26A 3O5QA 5J6EA 4JFMA 2XP5A 2LPVA 1FKLA 1ROTA 1FKDA 2RURA 4U84A 4O2TA 3LUOA 2VN1A 1A7XA 4DRIA 2ITKA 5B8IC 3O5RA 3MDYB 4J4OA 5D75A 4N19A 3O5LA 2XP3A 5DIVA 3WH0A 1EYMA 2KR7A 2ZR6A 4MSPA 4TW7A 3O5OA 4DT4A 2AWGA 3KAHA 4DRHA 2L2SA 3IKGA 2KFWA 3NTPA 2UZ5A 1KT1A 2ZQUA 4W9OA 4G2PA 3UI6A 4ODNA 1FKFA 4IQ2A 2PV3A 4R0XA 1U79A 4DZ3A 4ODKA 2XP6A 3ODKA 2PV1A 5HT1A 3JXVA 1FKIA 2ZQVA 3IK8A 3KADA 2PPOA 4G50A 3RFWA 3UI5A 4U86A 2VCDA 4IPXA 2XP8A 4DRPA 2LJ4A 3O5PA 3KABA 2RUDA 5HTGA 3NRKA 4JFKA 2KI3A 3EY6A 3B7XA 3O5KA 4U85A 1ZK6A 3TDBA 1Y0OA 1FKGA 2KO7A 4ODQA 4DRNA 3KACA 3NI6A 1QPLA 1QPFA 5I98A 3IKDA 2XPBA 5GPGA 2RUQA 1FKTA 1TCOC 1Q6UA 2LKNA 3FAPA 4ODPA 1FKSA 4DIPA 2MLZA 3JYMA 1JNSA 1YW5A 1YATA 3O5GA 5DIUA 4C02B 2XP4A 2MPHA 4DROA 2F2DA 3GPKA 1J4RA 3OOBA 1T11A 2M08A 2D9FA 2XPAA 1NSGA 1ZCNA 3UF8A 2DG4A 1D6OA 2ZR5A 4ITZA 1J6YA 1QZ2A 2RSEA 3PRDA 4MGVA 1FAPA 1JNTA 4ODLA 4QT3A 4DH0A 4LAWA 1D7HA 3O5FA 3RGCA 3PA7A 3JYJA 2MF9A 3UQBA 2DG3A 3VAWA 5HWCA 4ODOA 1C9HA 1FKHA 3TC5A 4TX0A 3KAIA
chains in the Genus database with same CATH superfamily
3B9EA 4P8WA 1F40A 1JVWA 4R5EA 1WAWA 3ARXA 2DSVA 1HKKA 2ZQTA 1LG2A 1ZU8A 3RM4A 4UDMA 2DPEA 2KGJA 3CGMA 1E6NA 4TW8A 3RMEA 1Q6HA 2WLYA 4GGQA 3O5DA 2DT3A 4HBOA 1X6LA 2F4EA 2XP9A 1HKIA 3FXYA 4HBEA 4Z2LA 1FKRA 3IHZA 1FD9A 1ZBWA 2N87A 4L3NA 4ZPVR 3ARRA 3WD0A 4W5UA 1B6CA 2MLXA 2K8IA 4Z2JA 1FKJA 2IF4A 5HUAA 3UI4A 4ZS6A 2M1IA 2A3CA 4ODMA 4QT2A 4JFIA 3UQAA 1GPFA 2XP5A 5GQBA 4DRIA 2VN1A 1LL4A 3MDYB 1W1VA 5DEZA 5HBFA 2XP3A 4MSPA 3KAHA 3IKGA 2ZQUA 4Q7NA 4MNLA 4IT6A 3WL0A 4WKHA 2AOSA 5HT1A 3JXVA 4Z2GA 1LQ0A 3G6MA 3WQWA 4IPXA 5HTGA 3NRKA 4DWSB 3QOKA 1ZK6A 1Y0OA 4DRNA 1QPLA 2DSUA 1XHGA 3ARUA 4ODPA 2LKNA 1FKSA 4C02B 2XP4A 1RD6A 1J4RA 4HARA 2D9FA 1E9LA 2XPAA 1NSGA 1ZCNA 3ALGA 3BMBA 1D6OA 3ARVA 1J6YA 4MGVA 4ODLA 3W4RA 3O5FA 3ARPA 3RGCA 2A3BA 3PA7A 1HJWA 2MF9A 5HWCA 1NWSA 4ZPTR 3ARSA 2JZVA 1H0GA 1Q1CA 2ZQSA 2FAPA 4JYSA 1BKFA 4MNKA 2G41A 4WKAA 1OGGA 3AS0A 1HXVA 4IQCA 4JFLA 1EDQA 1J4IA 4MNMA 3O5JA 3GU0A 1NWTA 2OLHA 2WLZA 4L72B 3AS3A 4URIA 5DITA 1D7IA 2PPNA 3B8SA 1N1AA 1GUVA 3WQVA 4NSBA 1FJDA 4P8XA 2DG9A 4J4NA 4GIVA 4FAPA 4TYOA 1O6IA 1NWUA 2OFNA 1E6ZA 4LAXA 4TNSA 4BF8A 1L1PA 3CGNA 4DRMA 2RQSA 4DZ2A 4WK9A 2QF8A 3O5IA 5JH8A 4KR0B 5HW6A 3O5QA 5J6EA 4JFMA 2LPVA 1LL7A 4O2TA 3LUOA 3B9DA 5D75A 3O5LA 1EYMA 2KR7A 4DT4A 1GRJA 4DRHA 3NTPA 4P8VA 3FY1A 4W9OA 3UI6A 4ODNA 1SR0A 1SYTA 2PV3A 3PR9A 4DWSA 1IX5A 1W9PA 2DT1A 2VCDA 2DT2A 2XP8A 4Z2HA 1WB0A 3KABA 1X6NA 2RUDA 2ETNA 2YBUA 2B5UB 4NZCA 4U85A 3NI6A 1JCHB 1QPFA 1HJVA 2F23A 3IKDA 1FKTA 4DIPA 1VF8A 4DROA 2F2DA 3GPKA 1W9VA 1T11A 2M08A 3RM9A 3CHEA 1HJXA 2DG4A 4MTVA 3UF8A 4ITZA 3PRDA 4DH0A 4QT3A 2EULA 2A3EA 2DG3A 3VAWA 2O9OA 1K9TA 1TFVA 1FKHA 3TC5A 2DSZA 3WD2A 1FKBA 1LG1A 3ARQA 4LAVA 4WKFA 4DRJA 3ARTA 1OWQA 3H9RB 4FN2A 2XP7A 4S3JA 3ARYA 1ZB5A 1JNDA 5BXJA 2MLYA 3PRBA 3WKZA 1ZL1A 1FFRA 2G8ZA 4S3KA 3CZ8A 1PBKA 1FKKA 4ODRA 3G6LA 4JFJA 1NMWA 3UQIA 3I6CA 3CHCA 4DWSD 2Y78A 4QIBA 3KAGA 3AS2A 2PV2A 3KAFA 2PBCA 2PN0A 2FDMA 2RUCA 1ROUA 3AROA 1GOIA 4W9QA 4MPKA 4DRQA 2PI6A 3KZ7A 1PINA 4XAKA 1D2KA 4WIWA 1Q6IA 1H0IA 5DO2A 2P4VA 4DRKA 1LL6A 1W26A 4TW6A 1FKLA 1ROTA 1FKDA 2RURA 1UR9A 1A7XA 2ITKA 3O5RA 4J4OA 4N19A 1E15A 5DIVA 3WL1A 2ZR6A 3O5OA 4P8UA 4Z2KA 2L2SA 2KFWA 3RM8A 2UZ5A 4IQ2A 4R0XA 1U79A 4DZ3A 2XP6A 3OA5A 4MAVA 3RFWA 3KADA 2PPOA 3GTYX 3O5PA 2DSWA 2KI3A 3B7XA 3O5KA 4TX0A 3AQUA 2XPBA 5GPGA 4DWSC 1NH6A 1Q6UA 3WD4A 2MLZA 3JYMA 3ALFA 1YATA 3O5GA 3PRAA 3CH9A 3OOBA 1NWRA 2ZR5A 1QZ2A 2RSEA 1FAPA 1JNTA 2IUZA 3JYJA 3CHDA 3KAIA 2ZR4A 1OGBA 1M5YA 3TCZA 4ZPWR 1E6RA 1ZBKA 2M2AA 3KCEA 1ZBCA 3O5EA 2Q5AA 2FKEA 5HWBA 1FFQA 2WM0A 2F21A 3O5MA 2KE0A 5GPRA 4QZVB 2YBTA 5HW7A 5HKGA 1EHNA 1W1YA 5HW8A 3ARZA 4Q22A 1EQ3A 2O92A 1W9UA 1NMVA 3WIJA 3EIPA 2MNTA 4LAYA 1R9HA 2WK2A 1C9HA 1BL4A 1JNEA 2PPPA 1WNOA 4AY1A 1HKJA 1F8AB 1CTNA 1KFWA 4W9PA 3CHFA 1P5QA 4NNRA 4KQZA 1D7JA 4ML4A 1J4HA 1KT0A 5DF0A 1EIBA 4U84A 1W1PA 4Z2IA 4TW7A 1LJYA 3AS1A 5B8IC 2AWGA 1KT1A 2DT0A 4G2PA 4PTMA 2A3AA 3B9AA 1FKFA 4WJXA 1E44A 4ODKA 1UR8A 3ODKA 2PV1A 4MNJA 1FKIA 2ZQVA 3IK8A 4G50A 3WH0A 3UI5A 4IT4A 4U86A 4DRPA 2LJ4A 2ESCA 4JFKA 3WD1A 1ITXA 3EY6A 3TDBA 1FKGA 2KO7A 4ODQA 3KACA 1HKMA 5I98A 3WD3A 1E6PA 2RUQA 1TCOC 1JNSA 1W1TA 3FAPA 1YW5A 2MPHA 1ZBVA 3BXWA 4LGXA 4LAWA 1D7HA 1XRVA 3UQBA 4ODOA 3ARWA 2LGOA 5DIUA 2B31A
chains in the Genus database with same CATH topology
3B9EA 4P8WA 1F40A 1JVWA 4R5EA 1WAWA 3ARXA 2DSVA 1HKKA 2ZQTA 1LG2A 1ZU8A 3RM4A 2DPEA 2KGJA 3CGMA 1E6NA 4TW8A 3RMEA 1Q6HA 2WLYA 4GGQA 3O5DA 2DT3A 4HBOA 1X6LA 2F4EA 2XP9A 1HKIA 3FXYA 4HBEA 4Z2LA 1FKRA 3IHZA 1FD9A 1ZBWA 2N87A 4L3NA 4ZPVR 3ARRA 3WD0A 4W5UA 1B6CA 2MLXA 2K8IA 4Z2JA 1FKJA 2IF4A 5HUAA 3UI4A 4ZS6A 2M1IA 2A3CA 4ODMA 4QT2A 4JFIA 3UQAA 1GPFA 2XP5A 5GQBA 4DRIA 2VN1A 1LL4A 3MDYB 1W1VA 5DEZA 5HBFA 2XP3A 4MSPA 3KAHA 3IKGA 2ZQUA 4Q7NA 4MNLA 4IT6A 3WL0A 4WKHA 2AOSA 5HT1A 3JXVA 4Z2GA 1LQ0A 3G6MA 3WQWA 4IPXA 5HTGA 3NRKA 4DWSB 3QOKA 1ZK6A 1Y0OA 4DRNA 1QPLA 2DSUA 1XHGA 3ARUA 4ODPA 2LKNA 1FKSA 4C02B 2XP4A 1RD6A 1J4RA 4HARA 2D9FA 1E9LA 2XPAA 1NSGA 1ZCNA 3ALGA 1D6OA 3ARVA 1J6YA 4MGVA 4ODLA 3W4RA 3O5FA 3ARPA 3RGCA 2A3BA 3PA7A 1HJWA 2MF9A 5HWCA 1NWSA 4ZPTR 3ARSA 2JZVA 1H0GA 1Q1CA 2ZQSA 2FAPA 4JYSA 1BKFA 4MNKA 2G41A 4WKAA 1OGGA 3AS0A 1HXVA 4IQCA 4JFLA 1EDQA 1J4IA 4MNMA 3O5JA 1NWTA 2OLHA 2WLZA 4L72B 3AS3A 4URIA 5DITA 1D7IA 2PPNA 3B8SA 1N1AA 1GUVA 3WQVA 4NSBA 1FJDA 4P8XA 2DG9A 4J4NA 4GIVA 4FAPA 4TYOA 1O6IA 1NWUA 2OFNA 1E6ZA 4LAXA 4TNSA 4BF8A 1L1PA 3CGNA 4DRMA 2RQSA 4DZ2A 4WK9A 2QF8A 3O5IA 5JH8A 4KR0B 5HW6A 3O5QA 5J6EA 4JFMA 2LPVA 1LL7A 4O2TA 3LUOA 3B9DA 5D75A 3O5LA 1EYMA 2KR7A 4DT4A 4DRHA 3NTPA 4P8VA 3FY1A 4W9OA 3UI6A 4ODNA 1SR0A 1SYTA 2PV3A 3PR9A 4DWSA 1IX5A 1W9PA 2DT1A 2VCDA 2DT2A 2XP8A 4Z2HA 1WB0A 3KABA 1X6NA 2RUDA 2YBUA 4NZCA 4U85A 3NI6A 1QPFA 1HJVA 3IKDA 1FKTA 4DIPA 1VF8A 4DROA 2F2DA 3GPKA 1W9VA 1T11A 2M08A 3RM9A 1HJXA 3CHEA 2DG4A 4MTVA 3UF8A 4ITZA 3PRDA 4DH0A 4QT3A 2A3EA 2DG3A 3VAWA 2O9OA 1K9TA 1TFVA 1FKHA 3TC5A 2DSZA 3WD2A 1FKBA 1LG1A 3ARQA 4LAVA 4WKFA 4DRJA 3ARTA 1OWQA 3H9RB 4FN2A 2XP7A 4S3JA 3ARYA 1ZB5A 1JNDA 5BXJA 2MLYA 3PRBA 3WKZA 1ZL1A 1FFRA 2G8ZA 4S3KA 3CZ8A 1PBKA 1FKKA 4ODRA 3G6LA 4JFJA 1NMWA 3UQIA 3I6CA 3CHCA 4DWSD 2Y78A 4QIBA 3KAGA 3AS2A 2PV2A 3KAFA 2PBCA 2FDMA 2RUCA 1ROUA 3AROA 1GOIA 4W9QA 4MPKA 4DRQA 2PI6A 3KZ7A 1PINA 4XAKA 1D2KA 4WIWA 1Q6IA 1H0IA 5DO2A 4DRKA 1LL6A 1W26A 4TW6A 1FKLA 1ROTA 1FKDA 2RURA 1UR9A 1A7XA 2ITKA 3O5RA 4J4OA 4N19A 1E15A 5DIVA 3WL1A 2ZR6A 3O5OA 4P8UA 4Z2KA 2L2SA 2KFWA 3RM8A 2UZ5A 4IQ2A 4R0XA 1U79A 4DZ3A 2XP6A 3OA5A 4MAVA 3RFWA 3KADA 2PPOA 3O5PA 2DSWA 2KI3A 3B7XA 3O5KA 4TX0A 3AQUA 2XPBA 5GPGA 4DWSC 1NH6A 1Q6UA 3WD4A 2MLZA 3JYMA 3ALFA 1YATA 3O5GA 3PRAA 3CH9A 3OOBA 1NWRA 2ZR5A 1QZ2A 2RSEA 1FAPA 1JNTA 2IUZA 3JYJA 3CHDA 3KAIA 2ZR4A 1OGBA 1M5YA 3TCZA 4ZPWR 1E6RA 1ZBKA 2M2AA 3KCEA 1ZBCA 3O5EA 2Q5AA 2FKEA 5HWBA 1FFQA 2WM0A 2F21A 3O5MA 2KE0A 5GPRA 4QZVB 2YBTA 5HW7A 5HKGA 1EHNA 1W1YA 5HW8A 3ARZA 4Q22A 1EQ3A 2O92A 1W9UA 1NMVA 3WIJA 2MNTA 4LAYA 1R9HA 2WK2A 1C9HA 1BL4A 1JNEA 2PPPA 1WNOA 4AY1A 1HKJA 1F8AB 1CTNA 1KFWA 4W9PA 3CHFA 1P5QA 4NNRA 4KQZA 1D7JA 4ML4A 1J4HA 1KT0A 5DF0A 1EIBA 4U84A 1W1PA 4Z2IA 4TW7A 1LJYA 3AS1A 5B8IC 2AWGA 1KT1A 2DT0A 4G2PA 4PTMA 2A3AA 3B9AA 1FKFA 4WJXA 4ODKA 1UR8A 3ODKA 2PV1A 4MNJA 1FKIA 2ZQVA 3IK8A 4G50A 3WH0A 3UI5A 4IT4A 4U86A 4DRPA 2LJ4A 2ESCA 4JFKA 3WD1A 1ITXA 3EY6A 3TDBA 1FKGA 2KO7A 4ODQA 3KACA 1HKMA 5I98A 3WD3A 1E6PA 2RUQA 1TCOC 1JNSA 1W1TA 3FAPA 1YW5A 2MPHA 1ZBVA 3BXWA 4LGXA 4LAWA 1D7HA 1XRVA 3UQBA 4ODOA 3ARWA 2LGOA 5DIUA 2B31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR4 A;  1M5Y A;  2JZV A;  3TCZ A;  1FKB A;  1Q1C A;  2ZQS A;  2FAP A;  1F40 A;  2M2A A;  3KCE A;  4JYS A;  1JVW A;  4LAV A;  4DRJ A;  3H9R B;  1BKF A;  4FN2 A;  2LGO A;  2XP7 A;  3O5E A;  2Q5A A;  2ZQT A;  2FKE A;  5HWB A;  1HXV A;  4IQC A;  5BXJ A;  2MLY A;  3PRB A;  4JFL A;  2F21 A;  2KGJ A;  3CGM A;  3O5M A;  1J4I A;  2KE0 A;  1PBK A;  1FKK A;  3O5J A;  4ODR A;  4TW8 A;  5HW7 A;  5HKG A;  1Q6H A;  4JFJ A;  4GGQ A;  3O5D A;  1NMW A;  5DIT A;  3UQI A;  1D7I A;  2F4E A;  2XP9 A;  2PPN A;  3I6C A;  5HW8 A;  1N1A A;  1EQ3 A;  1FKR A;  2Y78 A;  4QIB A;  3KAG A;  1FJD A;  2PV2 A;  3IHZ A;  1FD9 A;  3KAF A;  2PBC A;  1NMV A;  2DG9 A;  2RUC A;  4J4N A;  2N87 A;  1ROU A;  2MNT A;  4GIV A;  4FAP A;  4TYO A;  4LAY A;  1R9H A;  2OFN A;  1BL4 A;  4W9Q A;  1B6C A;  2MLX A;  2PPP A;  4LAX A;  4DRQ A;  2K8I A;  4TNS A;  1F8A B;  1FKJ A;  2IF4 A;  3KZ7 A;  1PIN A;  4W9P A;  3UI4 A;  4BF8 A;  3CGN A;  5HUA A;  1L1P A;  1P5Q A;  4DRM A;  4NNR A;  1D7J A;  2M1I A;  1Q6I A;  2RQS A;  4ODM A;  4DZ2 A;  1J4H A;  4QT2 A;  4JFI A;  4DRK A;  3UQA A;  1KT0 A;  3O5I A;  5HW6 A;  4TW6 A;  1W26 A;  3O5Q A;  5J6E A;  4JFM A;  2XP5 A;  2LPV A;  1FKL A;  1ROT A;  1FKD A;  2RUR A;  4U84 A;  4O2T A;  3LUO A;  2VN1 A;  1A7X A;  4DRI A;  2ITK A;  5B8I C;  3O5R A;  3MDY B;  4J4O A;  5D75 A;  4N19 A;  3O5L A;  2XP3 A;  5DIV A;  3WH0 A;  1EYM A;  2KR7 A;  2ZR6 A;  4MSP A;  4TW7 A;  3O5O A;  4DT4 A;  2AWG A;  3KAH A;  4DRH A;  2L2S A;  3IKG A;  2KFW A;  3NTP A;  2UZ5 A;  1KT1 A;  2ZQU A;  4W9O A;  4G2P A;  3UI6 A;  4ODN A;  1FKF A;  4IQ2 A;  2PV3 A;  4R0X A;  1U79 A;  4DZ3 A;  4ODK A;  2XP6 A;  3ODK A;  2PV1 A;  5HT1 A;  3JXV A;  1FKI A;  2ZQV A;  3IK8 A;  3KAD A;  2PPO A;  4G50 A;  3RFW A;  3UI5 A;  4U86 A;  2VCD A;  4IPX A;  2XP8 A;  4DRP A;  2LJ4 A;  3O5P A;  3KAB A;  2RUD A;  5HTG A;  3NRK A;  4JFK A;  2KI3 A;  3EY6 A;  3B7X A;  3O5K A;  4U85 A;  1ZK6 A;  3TDB A;  1Y0O A;  1FKG A;  2KO7 A;  4ODQ A;  4DRN A;  3KAC A;  3NI6 A;  1QPL A;  1QPF A;  5I98 A;  3IKD A;  2XPB A;  5GPG A;  2RUQ A;  1FKT A;  1TCO C;  1Q6U A;  2LKN A;  3FAP A;  4ODP A;  1FKS A;  4DIP A;  2MLZ A;  3JYM A;  1JNS A;  1YW5 A;  1YAT A;  3O5G A;  5DIU A;  4C02 B;  2XP4 A;  2MPH A;  4DRO A;  2F2D A;  3GPK A;  1J4R A;  3OOB A;  1T11 A;  2M08 A;  2D9F A;  2XPA A;  1NSG A;  1ZCN A;  3UF8 A;  2DG4 A;  1D6O A;  2ZR5 A;  4ITZ A;  1J6Y A;  1QZ2 A;  2RSE A;  3PRD A;  4MGV A;  1FAP A;  1JNT A;  4ODL A;  4QT3 A;  4DH0 A;  4LAW A;  1D7H A;  3O5F A;  3RGC A;  3PA7 A;  3JYJ A;  2MF9 A;  3UQB A;  2DG3 A;  3VAW A;  5HWC A;  4ODO A;  1C9H A;  1FKH A;  3TC5 A;  4TX0 A;  3KAI A; 
#chains in the Genus database with same CATH topology
 3B9E A;  4P8W A;  1F40 A;  1JVW A;  4R5E A;  1WAW A;  3ARX A;  2DSV A;  1HKK A;  2ZQT A;  1LG2 A;  1ZU8 A;  3RM4 A;  4UDM A;  2DPE A;  2KGJ A;  3CGM A;  1E6N A;  4TW8 A;  3RME A;  1Q6H A;  2WLY A;  4GGQ A;  3O5D A;  2DT3 A;  4HBO A;  1X6L A;  2F4E A;  2XP9 A;  1HKI A;  3FXY A;  4HBE A;  4Z2L A;  1FKR A;  3IHZ A;  1FD9 A;  1ZBW A;  2N87 A;  4L3N A;  4ZPV R;  3ARR A;  3WD0 A;  4W5U A;  1B6C A;  2MLX A;  2K8I A;  4Z2J A;  1FKJ A;  2IF4 A;  5HUA A;  3UI4 A;  4ZS6 A;  2M1I A;  2A3C A;  4ODM A;  4QT2 A;  4JFI A;  3UQA A;  1GPF A;  2XP5 A;  5GQB A;  4DRI A;  2VN1 A;  1LL4 A;  3MDY B;  1W1V A;  5DEZ A;  5HBF A;  2XP3 A;  4MSP A;  3KAH A;  3IKG A;  2ZQU A;  4Q7N A;  4MNL A;  4IT6 A;  3WL0 A;  4WKH A;  2AOS A;  5HT1 A;  3JXV A;  4Z2G A;  1LQ0 A;  3G6M A;  3WQW A;  4IPX A;  5HTG A;  3NRK A;  4DWS B;  3QOK A;  1ZK6 A;  1Y0O A;  4DRN A;  1QPL A;  2DSU A;  1XHG A;  3ARU A;  4ODP A;  2LKN A;  1FKS A;  4C02 B;  2XP4 A;  1RD6 A;  1J4R A;  4HAR A;  2D9F A;  1E9L A;  2XPA A;  1NSG A;  1ZCN A;  3ALG A;  3BMB A;  1D6O A;  3ARV A;  1J6Y A;  4MGV A;  4ODL A;  3W4R A;  3O5F A;  3ARP A;  3RGC A;  2A3B A;  3PA7 A;  1HJW A;  2MF9 A;  5HWC A;  1NWS A;  4ZPT R;  3ARS A;  2JZV A;  1H0G A;  1Q1C A;  2ZQS A;  2FAP A;  4JYS A;  1BKF A;  4MNK A;  2G41 A;  4WKA A;  1OGG A;  3AS0 A;  1HXV A;  4IQC A;  4JFL A;  1EDQ A;  1J4I A;  4MNM A;  3O5J A;  3GU0 A;  1NWT A;  2OLH A;  2WLZ A;  4L72 B;  3AS3 A;  4URI A;  5DIT A;  1D7I A;  2PPN A;  3B8S A;  1N1A A;  1GUV A;  3WQV A;  4NSB A;  1FJD A;  4P8X A;  2DG9 A;  4J4N A;  4GIV A;  4FAP A;  4TYO A;  1O6I A;  1NWU A;  2OFN A;  1E6Z A;  4LAX A;  4TNS A;  4BF8 A;  1L1P A;  3CGN A;  4DRM A;  2RQS A;  4DZ2 A;  4WK9 A;  2QF8 A;  3O5I A;  5JH8 A;  4KR0 B;  5HW6 A;  3O5Q A;  5J6E A;  4JFM A;  2LPV A;  1LL7 A;  4O2T A;  3LUO A;  3B9D A;  5D75 A;  3O5L A;  1EYM A;  2KR7 A;  4DT4 A;  1GRJ A;  4DRH A;  3NTP A;  4P8V A;  3FY1 A;  4W9O A;  3UI6 A;  4ODN A;  1SR0 A;  1SYT A;  2PV3 A;  3PR9 A;  4DWS A;  1IX5 A;  1W9P A;  2DT1 A;  2VCD A;  2DT2 A;  2XP8 A;  4Z2H A;  1WB0 A;  3KAB A;  1X6N A;  2RUD A;  2ETN A;  2YBU A;  2B5U B;  4NZC A;  4U85 A;  3NI6 A;  1JCH B;  1QPF A;  1HJV A;  2F23 A;  3IKD A;  1FKT A;  4DIP A;  1VF8 A;  4DRO A;  2F2D A;  3GPK A;  1W9V A;  1T11 A;  2M08 A;  3RM9 A;  3CHE A;  1HJX A;  2DG4 A;  4MTV A;  3UF8 A;  4ITZ A;  3PRD A;  4DH0 A;  4QT3 A;  2EUL A;  2A3E A;  2DG3 A;  3VAW A;  2O9O A;  1K9T A;  1TFV A;  1FKH A;  3TC5 A;  2DSZ A;  3WD2 A;  1FKB A;  1LG1 A;  3ARQ A;  4LAV A;  4WKF A;  4DRJ A;  3ART A;  1OWQ A;  3H9R B;  4FN2 A;  2XP7 A;  4S3J A;  3ARY A;  1ZB5 A;  1JND A;  5BXJ A;  2MLY A;  3PRB A;  3WKZ A;  1ZL1 A;  1FFR A;  2G8Z A;  4S3K A;  3CZ8 A;  1PBK A;  1FKK A;  4ODR A;  3G6L A;  4JFJ A;  1NMW A;  3UQI A;  3I6C A;  3CHC A;  4DWS D;  2Y78 A;  4QIB A;  3KAG A;  3AS2 A;  2PV2 A;  3KAF A;  2PBC A;  2PN0 A;  2FDM A;  2RUC A;  1ROU A;  3ARO A;  1GOI A;  4W9Q A;  4MPK A;  4DRQ A;  2PI6 A;  3KZ7 A;  1PIN A;  4XAK A;  1D2K A;  4WIW A;  1Q6I A;  1H0I A;  5DO2 A;  2P4V A;  4DRK A;  1LL6 A;  1W26 A;  4TW6 A;  1FKL A;  1ROT A;  1FKD A;  2RUR A;  1UR9 A;  1A7X A;  2ITK A;  3O5R A;  4J4O A;  4N19 A;  1E15 A;  5DIV A;  3WL1 A;  2ZR6 A;  3O5O A;  4P8U A;  4Z2K A;  2L2S A;  2KFW A;  3RM8 A;  2UZ5 A;  4IQ2 A;  4R0X A;  1U79 A;  4DZ3 A;  2XP6 A;  3OA5 A;  4MAV A;  3RFW A;  3KAD A;  2PPO A;  3GTY X;  3O5P A;  2DSW A;  2KI3 A;  3B7X A;  3O5K A;  4TX0 A;  3AQU A;  2XPB A;  5GPG A;  4DWS C;  1NH6 A;  1Q6U A;  3WD4 A;  2MLZ A;  3JYM A;  3ALF A;  1YAT A;  3O5G A;  3PRA A;  3CH9 A;  3OOB A;  1NWR A;  2ZR5 A;  1QZ2 A;  2RSE A;  1FAP A;  1JNT A;  2IUZ A;  3JYJ A;  3CHD A;  3KAI A;  2ZR4 A;  1OGB A;  1M5Y A;  3TCZ A;  4ZPW R;  1E6R A;  1ZBK A;  2M2A A;  3KCE A;  1ZBC A;  3O5E A;  2Q5A A;  2FKE A;  5HWB A;  1FFQ A;  2WM0 A;  2F21 A;  3O5M A;  2KE0 A;  5GPR A;  4QZV B;  2YBT A;  5HW7 A;  5HKG A;  1EHN A;  1W1Y A;  5HW8 A;  3ARZ A;  4Q22 A;  1EQ3 A;  2O92 A;  1W9U A;  1NMV A;  3WIJ A;  3EIP A;  2MNT A;  4LAY A;  1R9H A;  2WK2 A;  1C9H A;  1BL4 A;  1JNE A;  2PPP A;  1WNO A;  4AY1 A;  1HKJ A;  1F8A B;  1CTN A;  1KFW A;  4W9P A;  3CHF A;  1P5Q A;  4NNR A;  4KQZ A;  1D7J A;  4ML4 A;  1J4H A;  1KT0 A;  5DF0 A;  1EIB A;  4U84 A;  1W1P A;  4Z2I A;  4TW7 A;  1LJY A;  3AS1 A;  5B8I C;  2AWG A;  1KT1 A;  2DT0 A;  4G2P A;  4PTM A;  2A3A A;  3B9A A;  1FKF A;  4WJX A;  1E44 A;  4ODK A;  1UR8 A;  3ODK A;  2PV1 A;  4MNJ A;  1FKI A;  2ZQV A;  3IK8 A;  4G50 A;  3WH0 A;  3UI5 A;  4IT4 A;  4U86 A;  4DRP A;  2LJ4 A;  2ESC A;  4JFK A;  3WD1 A;  1ITX A;  3EY6 A;  3TDB A;  1FKG A;  2KO7 A;  4ODQ A;  3KAC A;  1HKM A;  5I98 A;  3WD3 A;  1E6P A;  2RUQ A;  1TCO C;  1JNS A;  1W1T A;  3FAP A;  1YW5 A;  2MPH A;  1ZBV A;  3BXW A;  4LGX A;  4LAW A;  1D7H A;  1XRV A;  3UQB A;  4ODO A;  3ARW A;  2LGO A;  5DIU A;  2B31 A; 
#chains in the Genus database with same CATH homology
 3B9E A;  4P8W A;  1F40 A;  1JVW A;  4R5E A;  1WAW A;  3ARX A;  2DSV A;  1HKK A;  2ZQT A;  1LG2 A;  1ZU8 A;  3RM4 A;  2DPE A;  2KGJ A;  3CGM A;  1E6N A;  4TW8 A;  3RME A;  1Q6H A;  2WLY A;  4GGQ A;  3O5D A;  2DT3 A;  4HBO A;  1X6L A;  2F4E A;  2XP9 A;  1HKI A;  3FXY A;  4HBE A;  4Z2L A;  1FKR A;  3IHZ A;  1FD9 A;  1ZBW A;  2N87 A;  4L3N A;  4ZPV R;  3ARR A;  3WD0 A;  4W5U A;  1B6C A;  2MLX A;  2K8I A;  4Z2J A;  1FKJ A;  2IF4 A;  5HUA A;  3UI4 A;  4ZS6 A;  2M1I A;  2A3C A;  4ODM A;  4QT2 A;  4JFI A;  3UQA A;  1GPF A;  2XP5 A;  5GQB A;  4DRI A;  2VN1 A;  1LL4 A;  3MDY B;  1W1V A;  5DEZ A;  5HBF A;  2XP3 A;  4MSP A;  3KAH A;  3IKG A;  2ZQU A;  4Q7N A;  4MNL A;  4IT6 A;  3WL0 A;  4WKH A;  2AOS A;  5HT1 A;  3JXV A;  4Z2G A;  1LQ0 A;  3G6M A;  3WQW A;  4IPX A;  5HTG A;  3NRK A;  4DWS B;  3QOK A;  1ZK6 A;  1Y0O A;  4DRN A;  1QPL A;  2DSU A;  1XHG A;  3ARU A;  4ODP A;  2LKN A;  1FKS A;  4C02 B;  2XP4 A;  1RD6 A;  1J4R A;  4HAR A;  2D9F A;  1E9L A;  2XPA A;  1NSG A;  1ZCN A;  3ALG A;  1D6O A;  3ARV A;  1J6Y A;  4MGV A;  4ODL A;  3W4R A;  3O5F A;  3ARP A;  3RGC A;  2A3B A;  3PA7 A;  1HJW A;  2MF9 A;  5HWC A;  1NWS A;  4ZPT R;  3ARS A;  2JZV A;  1H0G A;  1Q1C A;  2ZQS A;  2FAP A;  4JYS A;  1BKF A;  4MNK A;  2G41 A;  4WKA A;  1OGG A;  3AS0 A;  1HXV A;  4IQC A;  4JFL A;  1EDQ A;  1J4I A;  4MNM A;  3O5J A;  1NWT A;  2OLH A;  2WLZ A;  4L72 B;  3AS3 A;  4URI A;  5DIT A;  1D7I A;  2PPN A;  3B8S A;  1N1A A;  1GUV A;  3WQV A;  4NSB A;  1FJD A;  4P8X A;  2DG9 A;  4J4N A;  4GIV A;  4FAP A;  4TYO A;  1O6I A;  1NWU A;  2OFN A;  1E6Z A;  4LAX A;  4TNS A;  4BF8 A;  1L1P A;  3CGN A;  4DRM A;  2RQS A;  4DZ2 A;  4WK9 A;  2QF8 A;  3O5I A;  5JH8 A;  4KR0 B;  5HW6 A;  3O5Q A;  5J6E A;  4JFM A;  2LPV A;  1LL7 A;  4O2T A;  3LUO A;  3B9D A;  5D75 A;  3O5L A;  1EYM A;  2KR7 A;  4DT4 A;  4DRH A;  3NTP A;  4P8V A;  3FY1 A;  4W9O A;  3UI6 A;  4ODN A;  1SR0 A;  1SYT A;  2PV3 A;  3PR9 A;  4DWS A;  1IX5 A;  1W9P A;  2DT1 A;  2VCD A;  2DT2 A;  2XP8 A;  4Z2H A;  1WB0 A;  3KAB A;  1X6N A;  2RUD A;  2YBU A;  4NZC A;  4U85 A;  3NI6 A;  1QPF A;  1HJV A;  3IKD A;  1FKT A;  4DIP A;  1VF8 A;  4DRO A;  2F2D A;  3GPK A;  1W9V A;  1T11 A;  2M08 A;  3RM9 A;  1HJX A;  3CHE A;  2DG4 A;  4MTV A;  3UF8 A;  4ITZ A;  3PRD A;  4DH0 A;  4QT3 A;  2A3E A;  2DG3 A;  3VAW A;  2O9O A;  1K9T A;  1TFV A;  1FKH A;  3TC5 A;  2DSZ A;  3WD2 A;  1FKB A;  1LG1 A;  3ARQ A;  4LAV A;  4WKF A;  4DRJ A;  3ART A;  1OWQ A;  3H9R B;  4FN2 A;  2XP7 A;  4S3J A;  3ARY A;  1ZB5 A;  1JND A;  5BXJ A;  2MLY A;  3PRB A;  3WKZ A;  1ZL1 A;  1FFR A;  2G8Z A;  4S3K A;  3CZ8 A;  1PBK A;  1FKK A;  4ODR A;  3G6L A;  4JFJ A;  1NMW A;  3UQI A;  3I6C A;  3CHC A;  4DWS D;  2Y78 A;  4QIB A;  3KAG A;  3AS2 A;  2PV2 A;  3KAF A;  2PBC A;  2FDM A;  2RUC A;  1ROU A;  3ARO A;  1GOI A;  4W9Q A;  4MPK A;  4DRQ A;  2PI6 A;  3KZ7 A;  1PIN A;  4XAK A;  1D2K A;  4WIW A;  1Q6I A;  1H0I A;  5DO2 A;  4DRK A;  1LL6 A;  1W26 A;  4TW6 A;  1FKL A;  1ROT A;  1FKD A;  2RUR A;  1UR9 A;  1A7X A;  2ITK A;  3O5R A;  4J4O A;  4N19 A;  1E15 A;  5DIV A;  3WL1 A;  2ZR6 A;  3O5O A;  4P8U A;  4Z2K A;  2L2S A;  2KFW A;  3RM8 A;  2UZ5 A;  4IQ2 A;  4R0X A;  1U79 A;  4DZ3 A;  2XP6 A;  3OA5 A;  4MAV A;  3RFW A;  3KAD A;  2PPO A;  3O5P A;  2DSW A;  2KI3 A;  3B7X A;  3O5K A;  4TX0 A;  3AQU A;  2XPB A;  5GPG A;  4DWS C;  1NH6 A;  1Q6U A;  3WD4 A;  2MLZ A;  3JYM A;  3ALF A;  1YAT A;  3O5G A;  3PRA A;  3CH9 A;  3OOB A;  1NWR A;  2ZR5 A;  1QZ2 A;  2RSE A;  1FAP A;  1JNT A;  2IUZ A;  3JYJ A;  3CHD A;  3KAI A;  2ZR4 A;  1OGB A;  1M5Y A;  3TCZ A;  4ZPW R;  1E6R A;  1ZBK A;  2M2A A;  3KCE A;  1ZBC A;  3O5E A;  2Q5A A;  2FKE A;  5HWB A;  1FFQ A;  2WM0 A;  2F21 A;  3O5M A;  2KE0 A;  5GPR A;  4QZV B;  2YBT A;  5HW7 A;  5HKG A;  1EHN A;  1W1Y A;  5HW8 A;  3ARZ A;  4Q22 A;  1EQ3 A;  2O92 A;  1W9U A;  1NMV A;  3WIJ A;  2MNT A;  4LAY A;  1R9H A;  2WK2 A;  1C9H A;  1BL4 A;  1JNE A;  2PPP A;  1WNO A;  4AY1 A;  1HKJ A;  1F8A B;  1CTN A;  1KFW A;  4W9P A;  3CHF A;  1P5Q A;  4NNR A;  4KQZ A;  1D7J A;  4ML4 A;  1J4H A;  1KT0 A;  5DF0 A;  1EIB A;  4U84 A;  1W1P A;  4Z2I A;  4TW7 A;  1LJY A;  3AS1 A;  5B8I C;  2AWG A;  1KT1 A;  2DT0 A;  4G2P A;  4PTM A;  2A3A A;  3B9A A;  1FKF A;  4WJX A;  4ODK A;  1UR8 A;  3ODK A;  2PV1 A;  4MNJ A;  1FKI A;  2ZQV A;  3IK8 A;  4G50 A;  3WH0 A;  3UI5 A;  4IT4 A;  4U86 A;  4DRP A;  2LJ4 A;  2ESC A;  4JFK A;  3WD1 A;  1ITX A;  3EY6 A;  3TDB A;  1FKG A;  2KO7 A;  4ODQ A;  3KAC A;  1HKM A;  5I98 A;  3WD3 A;  1E6P A;  2RUQ A;  1TCO C;  1JNS A;  1W1T A;  3FAP A;  1YW5 A;  2MPH A;  1ZBV A;  3BXW A;  4LGX A;  4LAW A;  1D7H A;  1XRV A;  3UQB A;  4ODO A;  3ARW A;  2LGO A;  5DIU A;  2B31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...