5D75A

Crystal structure of human fkbd25 in complex with fk506
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDIDLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the FK506 binding domain of human FKBP25 in complex with FK506.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
total genus 27
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5d75A00
3O5LA 2F4EA 4NNRA 2RQSA 4JFKA 5HW8A 1EYMA 4LAWA 4DZ2A 1FJDA 2DG9A 3FAPA 4GIVA 1J4HA 3NRKA 4O2TA 3NTPA 2PPOA 1F40A 5I98A 1FKDA 3KAFA 1NMVA 5GPGA 1P5QA 4FAPA 2AWGA 4ODMA 4DRMA 1D7HA 2UZ5A 1NSGA 1PBKA 4JYSA 2XP6A 5DITA 3O5KA 4QIBA 4GGQA 4TW7A 3KAGA 4DZ3A 4TX0A 2VCDA 2XP7A 5HTGA 1J4IA 2FAPA 3IHZA 3KACA 4ODNA 4C02B 2LKNA 1FKBA 1M5YA 1TCOC 2KI3A 1YW5A 2F2DA 2XPBA 4G50A 4DROA 1A7XA 1FKFA 3O5QA 4DRPA 1FKIA 2PPPA 1B6CA 1ROTA 2MF9A 3I6CA 3H9RB 3O5JA 4ODLA 5HW7A 3ODKA 2JZVA 1ZCNA 5HT1A 1FKJA 4TNSA 1R9HA 1Q1CA 4ODOA 2LPVA 2ZQUA 4ITZA 4MGVA 1D6OA 4U84A 2KR7A 2Q5AA 2XPAA 3IK8A 3O5EA 4MSPA 4W9OA 1U79A 4IQCA 1BL4A 2LJ4A 2MLXA 4ODRA 1PINA 2DG3A 4LAVA 2ZQTA 3IKGA 4N19A 3MDYB 1Q6IA 2MNTA 2ZQVA 4ODKA 2DG4A 3UI5A 2KE0A 4LAYA 5D75A 3KZ7A 1JNSA 1Q6HA 3JYMA 1JNTA 3CGMA 1FKHA 1FKTA 1Y0OA 3WH0A 5B8IC 2RUCA 3O5FA 2Y78A 3B7XA 4U86A 3UQIA 2ZR6A 1FAPA 1J4RA 2L2SA 1L1PA 5HWCA 2RUDA 2XP8A 2ZR4A 2PV2A 3UI4A 4DRKA 4DRHA 2MPHA 4R0XA 2XP5A 2LGOA 3EY6A 2KGJA 4IPXA 1FKKA 4FN2A 4W9PA 5HKGA 1F8AB 1QPFA 1JVWA 4JFIA 1EQ3A 3PA7A 5J6EA 4TYOA 1C9HA 3OOBA 2IF4A 3O5MA 4QT2A 1KT1A 2PV1A 2ZR5A 3LUOA 1HXVA 4G2PA 5BXJA 1FKLA 4DRNA 4BF8A 4J4OA 3VAWA 4DRJA 2RURA 1W26A 3GPKA 3O5PA 4JFMA 5DIUA 5DIVA 1KT0A 4LAXA 4W9QA 3UI6A 2N87A 2PPNA 1BKFA 2PV3A 3KCEA 4J4NA 1ROUA 1J6YA 4IQ2A 3UF8A 3TCZA 1YATA 4JFJA 2K8IA 4DIPA 5HUAA 4ODQA 3UQAA 1Q6UA 2ZQSA 1ZK6A 2KFWA 4QT3A 3O5IA 3CGNA 4DT4A 3TDBA 2PBCA 1D7JA 1QZ2A 3RGCA 3KAIA 2FKEA 2D9FA 3PRDA 1T11A 2KO7A 3TC5A 4DRIA 4TW6A 2MLYA 3KADA 3O5RA 2M1IA 3O5OA 2XP3A 3UQBA 3KAHA 2XP9A 1FKGA 2OFNA 1QPLA 1FKRA 1D7IA 5HW6A 5HWBA 2M08A 4ODPA 3O5GA 1NMWA 3O5DA 3IKDA 1FKSA 2VN1A 4U85A 3RFWA 2F21A 4DH0A 4TW8A 1N1AA 3JYJA 3NI6A 3PRBA 4DRQA 2M2AA 2XP4A 2ITKA 2MLZA 2RSEA 4JFLA 3JXVA 2RUQA 1FD9A 3KABA
chains in the Genus database with same CATH superfamily
2F4EA 1GRJA 2RQSA 1E15A 4DZ2A 1FJDA 2DG9A 3FAPA 1J4HA 3NRKA 1NWUA 3NTPA 2PPOA 1F40A 1E6NA 5I98A 1NMVA 2AWGA 4Z2JA 1NSGA 4L72B 4MAVA 5HTGA 2FDMA 5JH8A 2A3AA 4C02B 1M5YA 1TCOC 2XPBA 1YW5A 2KI3A 5B8IC 1A7XA 2MF9A 1E6RA 1Q1CA 2O9OA 4UDMA 2YBUA 4ITZA 3GU0A 4NZCA 4XAKA 4WIWA 1ITXA 3IK8A 4W9OA 1BL4A 1PINA 3ARVA 3IKGA 3AS0A 4ODKA 1LL7A 1JNSA 4KQZA 1ZBWA 5DEZA 3G6LA 1SR0A 2Y78A 4U86A 5DO2A 3CHEA 3UQIA 3WD0A 3EIPA 4Q22A 2L2SA 1WNOA 2DSZA 2XP8A 2G8ZA 1RD6A 2B5UB 1ZB5A 1JVWA 1FFQA 4JFIA 4Z2GA 2PV1A 3LUOA 5BXJA 4Z2IA 4DRNA 4BF8A 3VAWA 4DRJA 1W26A 5DIVA 3UI6A 4LAXA 1HJWA 4W9QA 2N87A 1W9VA 2PPNA 2PV3A 1OGBA 1D2KA 1W9PA 3KCEA 4J4NA 3TCZA 2K8IA 3UQAA 4ODQA 4WKAA 3WQVA 2ZQSA 1E44A 1CTNA 3KAIA 4DWSB 4P8WA 3KADA 1D7IA 1HKJA 5HW6A 1UR9A 3O5DA 3IKDA 2VN1A 1N1AA 3PRBA 2RSEA 2MLZA 3JXVA 1HKIA 1X6NA 3O5LA 4NNRA 4JFKA 4ML4A 3ARZA 3KAFA 4ODMA 4DRMA 1D7HA 1PBKA 3O5KA 4QIBA 1H0IA 4GGQA 4TW7A 4IT4A 4MNJA 4TX0A 2VCDA 4NSBA 4W5UA 2P4VA 1J4IA 2FAPA 3KACA 4S3JA 2O92A 3RM9A 3ALFA 4AY1A 3ODKA 1HKMA 4URIA 2LPVA 2ZQUA 1LJYA 3WQWA 2B31A 4DWSA 3O5EA 4MSPA 2LJ4A 3AROA 3WD2A 2PI6A 2ETNA 4DWSC 1JNDA 1Q6IA 1X6LA 3OA5A 3KZ7A 3JYMA 3CGMA 1FKHA 5GPRA 1JNEA 3AS1A 3CHDA 1LG2A 1WAWA 4R5EA 1L1PA 1W1VA 1OGGA 5HWCA 2RUDA 2ZR4A 1ZU8A 1WB0A 3UI4A 3WD4A 2DPEA 2MPHA 5HBFA 3WKZA 4P8VA 2DT1A 1O6IA 5HKGA 1QPFA 1EQ3A 3AS3A 5J6EA 1ZBKA 3OOBA 4MTVA 1KT1A 1IX5A 3B8SA 3ARWA 4Z2HA 4J4OA 3ALGA 3ARYA 1ZL1A 1J6YA 4JFJA 1ZK6A 2KFWA 3CGNA 2PBCA 1QZ2A 3RGCA 2WK2A 4IT6A 2KO7A 4DRIA 4TW6A 2MLYA 1EDQA 3UQBA 3O5OA 2XP3A 1FKGA 2DSVA 4LGXA 2WLYA 1NMWA 1FKSA 1XRVA 3RFWA 2F21A 3NI6A 2M2AA 1LL6A 2DT0A 1FD9A 4LAWA 1JCHB 3B9DA 1HKKA 3QOKA 3CH9A 3PRAA 4L3NA 5GPGA 1P5QA 4MNKA 1NWSA 4JYSA 5DITA 3KAGA 4DZ3A 1H0GA 1GUVA 3CHFA 4ODNA 1FKBA 2LKNA 4DROA 4G50A 2PPPA 1B6CA 1ROTA 3I6CA 3H9RB 4ODLA 3PR9A 4MNLA 1ZCNA 5HT1A 3AS2A 4TNSA 1R9HA 1ZBVA 3G6MA 4MGVA 4U84A 2KR7A 2Q5AA 2XPAA 4WJXA 3FXYA 1U79A 1E6PA 4ODRA 3ARTA 2DG3A 3ARQA 4LAVA 2ZQTA 4N19A 3MDYB 2MNTA 2ZQVA 4ZS6A 2DG4A 3UI5A 5D75A 4LAYA 1Q6HA 3BXWA 1FKTA 1Y0OA 3WH0A 2RUCA 3O5FA 3WD3A 2ZR6A 1KFWA 1FAPA 3WL1A 4HBOA 3ARPA 3WD1A 4DRKA 2A3EA 2F23A 4DRHA 4R0XA 2XP5A 2LGOA 4W9PA 2A3CA 1F8AB 3O5MA 2IUZA 1HXVA 1NWRA 3B9AA 3RM8A 5GQBA 2RURA 1HJXA 3GPKA 5DIUA 2A3BA 3UF8A 3ARXA 1Q6UA 3GTYX 2WLZA 4KR0B 4Q7NA 3TDBA 3PRDA 3W4RA 3TC5A 3O5RA 4ZPWR 1NH6A 2M1IA 1LG1A 3KAHA 4ZPTR 5HWBA 2M08A 4ODPA 4U85A 3WIJA 4DRQA 4JFLA 2XP4A 2ITKA 1EIBA 3KABA 5DF0A 5HW8A 2OLHA 4S3KA 4QZVB 1EYMA 4GIVA 1GOIA 4O2TA 1FKDA 1XHGA 3AQUA 4FAPA 2UZ5A 2XP6A 4MNMA 1HJVA 2XP7A 4Z2KA 4PTMA 1EHNA 3IHZA 2F2DA 2DT3A 2PN0A 1W9UA 1FKFA 3O5QA 4DRPA 1FKIA 1W1YA 1LQ0A 4WKHA 3O5JA 3B9EA 5HW7A 2JZVA 3FY1A 3CHCA 1FKJA 4ODOA 4Z2LA 1D6OA 3BMBA 4WK9A 4DWSD 1K9TA 1FFRA 4IQCA 2DT2A 2MLXA 1LL4A 2EULA 3RM4A 3CZ8A 1OWQA 1NWTA 2KE0A 1JNTA 2AOSA 1W1PA 3WL0A 4HBEA 2QF8A 3B7XA 2YBTA 3ARSA 1J4RA 4P8XA 2PV2A 3EY6A 2KGJA 4IPXA 1FKKA 4FN2A 4HARA 1TFVA 2G41A 2DSUA 3PA7A 4TYOA 1C9HA 2IF4A 4QT2A 2ZR5A 4MPKA 2WM0A 4G2PA 3RMEA 1SYTA 3ARUA 1FKLA 1ZBCA 3ARRA 3O5PA 1UR8A 4JFMA 1KT0A 1GPFA 1BKFA 1ROUA 4IQ2A 4DIPA 1YATA 5HUAA 2ESCA 4QT3A 3O5IA 2DSWA 4DT4A 1D7JA 1E6ZA 2FKEA 2D9FA 1VF8A 1T11A 4WKFA 2XP9A 2OFNA 1QPLA 4ZPVR 1FKRA 3O5GA 4P8UA 4DH0A 1E9LA 4TW8A 3JYJA 1W1TA 2RUQA
chains in the Genus database with same CATH topology
2F4EA 2RQSA 1E15A 4DZ2A 1FJDA 2DG9A 3FAPA 1J4HA 3NRKA 1NWUA 3NTPA 2PPOA 1F40A 1E6NA 5I98A 1NMVA 2AWGA 4Z2JA 1NSGA 4L72B 4MAVA 5HTGA 2FDMA 5JH8A 2A3AA 4C02B 1M5YA 1TCOC 2XPBA 1YW5A 2KI3A 5B8IC 1A7XA 2MF9A 1E6RA 1Q1CA 2O9OA 2YBUA 4ITZA 4XAKA 4NZCA 4WIWA 1ITXA 3IK8A 4W9OA 1BL4A 1PINA 3ARVA 3IKGA 3AS0A 4ODKA 1LL7A 1JNSA 4KQZA 1ZBWA 5DEZA 3G6LA 1SR0A 2Y78A 4U86A 5DO2A 3CHEA 3UQIA 3WD0A 4Q22A 2L2SA 1WNOA 2DSZA 2XP8A 2G8ZA 1RD6A 1ZB5A 1JVWA 1FFQA 4JFIA 4Z2GA 2PV1A 3LUOA 5BXJA 4Z2IA 4DRNA 4BF8A 3VAWA 4DRJA 1W26A 5DIVA 3UI6A 4LAXA 1HJWA 4W9QA 2N87A 1W9VA 2PPNA 2PV3A 1OGBA 1D2KA 1W9PA 3KCEA 4J4NA 3TCZA 2K8IA 3UQAA 4ODQA 4WKAA 3WQVA 2ZQSA 1CTNA 3KAIA 4DWSB 4P8WA 3KADA 1D7IA 1HKJA 5HW6A 1UR9A 3O5DA 3IKDA 2VN1A 1N1AA 3PRBA 2RSEA 2MLZA 3JXVA 1HKIA 1X6NA 3O5LA 4NNRA 4JFKA 4ML4A 3ARZA 3KAFA 4ODMA 4DRMA 1D7HA 1PBKA 3O5KA 4QIBA 1H0IA 4GGQA 4TW7A 4IT4A 4MNJA 4TX0A 2VCDA 4NSBA 4W5UA 1J4IA 2FAPA 3KACA 4S3JA 2O92A 3RM9A 3ALFA 4AY1A 3ODKA 1HKMA 4URIA 2LPVA 2ZQUA 1LJYA 3WQWA 2B31A 4DWSA 3O5EA 4MSPA 2LJ4A 3AROA 3WD2A 2PI6A 4DWSC 1JNDA 1Q6IA 1X6LA 3OA5A 3KZ7A 3JYMA 3CGMA 1FKHA 5GPRA 1JNEA 3AS1A 3CHDA 1LG2A 1WAWA 4R5EA 1L1PA 1W1VA 1OGGA 5HWCA 2RUDA 2ZR4A 1ZU8A 1WB0A 3UI4A 3WD4A 2DPEA 2MPHA 5HBFA 3WKZA 4P8VA 2DT1A 1O6IA 5HKGA 1QPFA 1EQ3A 3AS3A 5J6EA 1ZBKA 3OOBA 4MTVA 1KT1A 1IX5A 3B8SA 3ARWA 4Z2HA 4J4OA 3ALGA 3ARYA 1ZL1A 1J6YA 4JFJA 1ZK6A 2KFWA 3CGNA 2PBCA 1QZ2A 3RGCA 2WK2A 4IT6A 2KO7A 4DRIA 4TW6A 2MLYA 1EDQA 3UQBA 3O5OA 2XP3A 1FKGA 2DSVA 4LGXA 2WLYA 1NMWA 1FKSA 1XRVA 3RFWA 2F21A 3NI6A 2M2AA 1LL6A 2DT0A 1FD9A 4LAWA 3B9DA 1HKKA 3QOKA 3CH9A 3PRAA 4L3NA 5GPGA 1P5QA 4MNKA 1NWSA 4JYSA 5DITA 3KAGA 4DZ3A 1H0GA 1GUVA 3CHFA 4ODNA 1FKBA 2LKNA 4DROA 4G50A 2PPPA 1B6CA 1ROTA 3I6CA 3H9RB 4ODLA 3PR9A 4MNLA 1ZCNA 5HT1A 3AS2A 4TNSA 1R9HA 1ZBVA 3G6MA 4MGVA 4U84A 2KR7A 2Q5AA 2XPAA 4WJXA 3FXYA 1U79A 1E6PA 4ODRA 3ARTA 2DG3A 3ARQA 4LAVA 2ZQTA 4N19A 3MDYB 2MNTA 2ZQVA 4ZS6A 2DG4A 3UI5A 5D75A 4LAYA 1Q6HA 3BXWA 1FKTA 1Y0OA 3WH0A 2RUCA 3O5FA 3WD3A 2ZR6A 1KFWA 1FAPA 3WL1A 4HBOA 3ARPA 3WD1A 4DRKA 2A3EA 4DRHA 4R0XA 2XP5A 2LGOA 4W9PA 2A3CA 1F8AB 3O5MA 2IUZA 1HXVA 1NWRA 3B9AA 3RM8A 5GQBA 2RURA 1HJXA 3GPKA 5DIUA 2A3BA 3UF8A 3ARXA 1Q6UA 2WLZA 4KR0B 4Q7NA 3TDBA 3PRDA 3W4RA 3TC5A 3O5RA 4ZPWR 1NH6A 2M1IA 1LG1A 3KAHA 4ZPTR 5HWBA 2M08A 4ODPA 4U85A 3WIJA 4DRQA 4JFLA 2XP4A 2ITKA 1EIBA 3KABA 5DF0A 5HW8A 2OLHA 4S3KA 4QZVB 1EYMA 4GIVA 1GOIA 4O2TA 1FKDA 1XHGA 3AQUA 4FAPA 2UZ5A 2XP6A 4MNMA 1HJVA 2XP7A 4Z2KA 4PTMA 1EHNA 3IHZA 2F2DA 2DT3A 1W9UA 1FKFA 3O5QA 4DRPA 1FKIA 1W1YA 1LQ0A 4WKHA 3O5JA 3B9EA 5HW7A 2JZVA 3FY1A 3CHCA 1FKJA 4ODOA 4Z2LA 1D6OA 4WK9A 4DWSD 1K9TA 1FFRA 4IQCA 2DT2A 2MLXA 1LL4A 3RM4A 3CZ8A 1OWQA 1NWTA 2KE0A 1JNTA 2AOSA 1W1PA 3WL0A 4HBEA 2QF8A 3B7XA 2YBTA 3ARSA 1J4RA 4P8XA 2PV2A 3EY6A 2KGJA 4IPXA 1FKKA 4FN2A 4HARA 1TFVA 2G41A 2DSUA 3PA7A 4TYOA 1C9HA 2IF4A 4QT2A 2ZR5A 4MPKA 2WM0A 4G2PA 3RMEA 1SYTA 3ARUA 1FKLA 1ZBCA 3ARRA 3O5PA 1UR8A 4JFMA 1KT0A 1GPFA 1BKFA 1ROUA 4IQ2A 4DIPA 1YATA 5HUAA 2ESCA 4QT3A 3O5IA 2DSWA 4DT4A 1D7JA 1E6ZA 2FKEA 2D9FA 1VF8A 1T11A 4WKFA 2XP9A 2OFNA 1QPLA 4ZPVR 1FKRA 3O5GA 4P8UA 4DH0A 1E9LA 4TW8A 3JYJA 1W1TA 2RUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5L A;  2F4E A;  4NNR A;  2RQS A;  4JFK A;  5HW8 A;  1EYM A;  4LAW A;  4DZ2 A;  1FJD A;  2DG9 A;  3FAP A;  4GIV A;  1J4H A;  3NRK A;  4O2T A;  3NTP A;  2PPO A;  1F40 A;  5I98 A;  1FKD A;  3KAF A;  1NMV A;  5GPG A;  1P5Q A;  4FAP A;  2AWG A;  4ODM A;  4DRM A;  1D7H A;  2UZ5 A;  1NSG A;  1PBK A;  4JYS A;  2XP6 A;  5DIT A;  3O5K A;  4QIB A;  4GGQ A;  4TW7 A;  3KAG A;  4DZ3 A;  4TX0 A;  2VCD A;  2XP7 A;  5HTG A;  1J4I A;  2FAP A;  3IHZ A;  3KAC A;  4ODN A;  4C02 B;  2LKN A;  1FKB A;  1M5Y A;  1TCO C;  2KI3 A;  1YW5 A;  2F2D A;  2XPB A;  4G50 A;  4DRO A;  1A7X A;  1FKF A;  3O5Q A;  4DRP A;  1FKI A;  2PPP A;  1B6C A;  1ROT A;  2MF9 A;  3I6C A;  3H9R B;  3O5J A;  4ODL A;  5HW7 A;  3ODK A;  2JZV A;  1ZCN A;  5HT1 A;  1FKJ A;  4TNS A;  1R9H A;  1Q1C A;  4ODO A;  2LPV A;  2ZQU A;  4ITZ A;  4MGV A;  1D6O A;  4U84 A;  2KR7 A;  2Q5A A;  2XPA A;  3IK8 A;  3O5E A;  4MSP A;  4W9O A;  1U79 A;  4IQC A;  1BL4 A;  2LJ4 A;  2MLX A;  4ODR A;  1PIN A;  2DG3 A;  4LAV A;  2ZQT A;  3IKG A;  4N19 A;  3MDY B;  1Q6I A;  2MNT A;  2ZQV A;  4ODK A;  2DG4 A;  3UI5 A;  2KE0 A;  4LAY A;  5D75 A;  3KZ7 A;  1JNS A;  1Q6H A;  3JYM A;  1JNT A;  3CGM A;  1FKH A;  1FKT A;  1Y0O A;  3WH0 A;  5B8I C;  2RUC A;  3O5F A;  2Y78 A;  3B7X A;  4U86 A;  3UQI A;  2ZR6 A;  1FAP A;  1J4R A;  2L2S A;  1L1P A;  5HWC A;  2RUD A;  2XP8 A;  2ZR4 A;  2PV2 A;  3UI4 A;  4DRK A;  4DRH A;  2MPH A;  4R0X A;  2XP5 A;  2LGO A;  3EY6 A;  2KGJ A;  4IPX A;  1FKK A;  4FN2 A;  4W9P A;  5HKG A;  1F8A B;  1QPF A;  1JVW A;  4JFI A;  1EQ3 A;  3PA7 A;  5J6E A;  4TYO A;  1C9H A;  3OOB A;  2IF4 A;  3O5M A;  4QT2 A;  1KT1 A;  2PV1 A;  2ZR5 A;  3LUO A;  1HXV A;  4G2P A;  5BXJ A;  1FKL A;  4DRN A;  4BF8 A;  4J4O A;  3VAW A;  4DRJ A;  2RUR A;  1W26 A;  3GPK A;  3O5P A;  4JFM A;  5DIU A;  5DIV A;  1KT0 A;  4LAX A;  4W9Q A;  3UI6 A;  2N87 A;  2PPN A;  1BKF A;  2PV3 A;  3KCE A;  4J4N A;  1ROU A;  1J6Y A;  4IQ2 A;  3UF8 A;  3TCZ A;  1YAT A;  4JFJ A;  2K8I A;  4DIP A;  5HUA A;  4ODQ A;  3UQA A;  1Q6U A;  2ZQS A;  1ZK6 A;  2KFW A;  4QT3 A;  3O5I A;  3CGN A;  4DT4 A;  3TDB A;  2PBC A;  1D7J A;  1QZ2 A;  3RGC A;  3KAI A;  2FKE A;  2D9F A;  3PRD A;  1T11 A;  2KO7 A;  3TC5 A;  4DRI A;  4TW6 A;  2MLY A;  3KAD A;  3O5R A;  2M1I A;  3O5O A;  2XP3 A;  3UQB A;  3KAH A;  2XP9 A;  1FKG A;  2OFN A;  1QPL A;  1FKR A;  1D7I A;  5HW6 A;  5HWB A;  2M08 A;  4ODP A;  3O5G A;  1NMW A;  3O5D A;  3IKD A;  1FKS A;  2VN1 A;  4U85 A;  3RFW A;  2F21 A;  4DH0 A;  4TW8 A;  1N1A A;  3JYJ A;  3NI6 A;  3PRB A;  4DRQ A;  2M2A A;  2XP4 A;  2ITK A;  2MLZ A;  2RSE A;  4JFL A;  3JXV A;  2RUQ A;  1FD9 A;  3KAB A; 
#chains in the Genus database with same CATH topology
 2F4E A;  1GRJ A;  2RQS A;  1E15 A;  4DZ2 A;  1FJD A;  2DG9 A;  3FAP A;  1J4H A;  3NRK A;  1NWU A;  3NTP A;  2PPO A;  1F40 A;  1E6N A;  5I98 A;  1NMV A;  2AWG A;  4Z2J A;  1NSG A;  4L72 B;  4MAV A;  5HTG A;  2FDM A;  5JH8 A;  2A3A A;  4C02 B;  1M5Y A;  1TCO C;  2XPB A;  1YW5 A;  2KI3 A;  5B8I C;  1A7X A;  2MF9 A;  1E6R A;  1Q1C A;  2O9O A;  4UDM A;  2YBU A;  4ITZ A;  3GU0 A;  4NZC A;  4XAK A;  4WIW A;  1ITX A;  3IK8 A;  4W9O A;  1BL4 A;  1PIN A;  3ARV A;  3IKG A;  3AS0 A;  4ODK A;  1LL7 A;  1JNS A;  4KQZ A;  1ZBW A;  5DEZ A;  3G6L A;  1SR0 A;  2Y78 A;  4U86 A;  5DO2 A;  3CHE A;  3UQI A;  3WD0 A;  3EIP A;  4Q22 A;  2L2S A;  1WNO A;  2DSZ A;  2XP8 A;  2G8Z A;  1RD6 A;  2B5U B;  1ZB5 A;  1JVW A;  1FFQ A;  4JFI A;  4Z2G A;  2PV1 A;  3LUO A;  5BXJ A;  4Z2I A;  4DRN A;  4BF8 A;  3VAW A;  4DRJ A;  1W26 A;  5DIV A;  3UI6 A;  4LAX A;  1HJW A;  4W9Q A;  2N87 A;  1W9V A;  2PPN A;  2PV3 A;  1OGB A;  1D2K A;  1W9P A;  3KCE A;  4J4N A;  3TCZ A;  2K8I A;  3UQA A;  4ODQ A;  4WKA A;  3WQV A;  2ZQS A;  1E44 A;  1CTN A;  3KAI A;  4DWS B;  4P8W A;  3KAD A;  1D7I A;  1HKJ A;  5HW6 A;  1UR9 A;  3O5D A;  3IKD A;  2VN1 A;  1N1A A;  3PRB A;  2RSE A;  2MLZ A;  3JXV A;  1HKI A;  1X6N A;  3O5L A;  4NNR A;  4JFK A;  4ML4 A;  3ARZ A;  3KAF A;  4ODM A;  4DRM A;  1D7H A;  1PBK A;  3O5K A;  4QIB A;  1H0I A;  4GGQ A;  4TW7 A;  4IT4 A;  4MNJ A;  4TX0 A;  2VCD A;  4NSB A;  4W5U A;  2P4V A;  1J4I A;  2FAP A;  3KAC A;  4S3J A;  2O92 A;  3RM9 A;  3ALF A;  4AY1 A;  3ODK A;  1HKM A;  4URI A;  2LPV A;  2ZQU A;  1LJY A;  3WQW A;  2B31 A;  4DWS A;  3O5E A;  4MSP A;  2LJ4 A;  3ARO A;  3WD2 A;  2PI6 A;  2ETN A;  4DWS C;  1JND A;  1Q6I A;  1X6L A;  3OA5 A;  3KZ7 A;  3JYM A;  3CGM A;  1FKH A;  5GPR A;  1JNE A;  3AS1 A;  3CHD A;  1LG2 A;  1WAW A;  4R5E A;  1L1P A;  1W1V A;  1OGG A;  5HWC A;  2RUD A;  2ZR4 A;  1ZU8 A;  1WB0 A;  3UI4 A;  3WD4 A;  2DPE A;  2MPH A;  5HBF A;  3WKZ A;  4P8V A;  2DT1 A;  1O6I A;  5HKG A;  1QPF A;  1EQ3 A;  3AS3 A;  5J6E A;  1ZBK A;  3OOB A;  4MTV A;  1KT1 A;  1IX5 A;  3B8S A;  3ARW A;  4Z2H A;  4J4O A;  3ALG A;  3ARY A;  1ZL1 A;  1J6Y A;  4JFJ A;  1ZK6 A;  2KFW A;  3CGN A;  2PBC A;  1QZ2 A;  3RGC A;  2WK2 A;  4IT6 A;  2KO7 A;  4DRI A;  4TW6 A;  2MLY A;  1EDQ A;  3UQB A;  3O5O A;  2XP3 A;  1FKG A;  2DSV A;  4LGX A;  2WLY A;  1NMW A;  1FKS A;  1XRV A;  3RFW A;  2F21 A;  3NI6 A;  2M2A A;  1LL6 A;  2DT0 A;  1FD9 A;  4LAW A;  1JCH B;  3B9D A;  1HKK A;  3QOK A;  3CH9 A;  3PRA A;  4L3N A;  5GPG A;  1P5Q A;  4MNK A;  1NWS A;  4JYS A;  5DIT A;  3KAG A;  4DZ3 A;  1H0G A;  1GUV A;  3CHF A;  4ODN A;  1FKB A;  2LKN A;  4DRO A;  4G50 A;  2PPP A;  1B6C A;  1ROT A;  3I6C A;  3H9R B;  4ODL A;  3PR9 A;  4MNL A;  1ZCN A;  5HT1 A;  3AS2 A;  4TNS A;  1R9H A;  1ZBV A;  3G6M A;  4MGV A;  4U84 A;  2KR7 A;  2Q5A A;  2XPA A;  4WJX A;  3FXY A;  1U79 A;  1E6P A;  4ODR A;  3ART A;  2DG3 A;  3ARQ A;  4LAV A;  2ZQT A;  4N19 A;  3MDY B;  2MNT A;  2ZQV A;  4ZS6 A;  2DG4 A;  3UI5 A;  5D75 A;  4LAY A;  1Q6H A;  3BXW A;  1FKT A;  1Y0O A;  3WH0 A;  2RUC A;  3O5F A;  3WD3 A;  2ZR6 A;  1KFW A;  1FAP A;  3WL1 A;  4HBO A;  3ARP A;  3WD1 A;  4DRK A;  2A3E A;  2F23 A;  4DRH A;  4R0X A;  2XP5 A;  2LGO A;  4W9P A;  2A3C A;  1F8A B;  3O5M A;  2IUZ A;  1HXV A;  1NWR A;  3B9A A;  3RM8 A;  5GQB A;  2RUR A;  1HJX A;  3GPK A;  5DIU A;  2A3B A;  3UF8 A;  3ARX A;  1Q6U A;  3GTY X;  2WLZ A;  4KR0 B;  4Q7N A;  3TDB A;  3PRD A;  3W4R A;  3TC5 A;  3O5R A;  4ZPW R;  1NH6 A;  2M1I A;  1LG1 A;  3KAH A;  4ZPT R;  5HWB A;  2M08 A;  4ODP A;  4U85 A;  3WIJ A;  4DRQ A;  4JFL A;  2XP4 A;  2ITK A;  1EIB A;  3KAB A;  5DF0 A;  5HW8 A;  2OLH A;  4S3K A;  4QZV B;  1EYM A;  4GIV A;  1GOI A;  4O2T A;  1FKD A;  1XHG A;  3AQU A;  4FAP A;  2UZ5 A;  2XP6 A;  4MNM A;  1HJV A;  2XP7 A;  4Z2K A;  4PTM A;  1EHN A;  3IHZ A;  2F2D A;  2DT3 A;  2PN0 A;  1W9U A;  1FKF A;  3O5Q A;  4DRP A;  1FKI A;  1W1Y A;  1LQ0 A;  4WKH A;  3O5J A;  3B9E A;  5HW7 A;  2JZV A;  3FY1 A;  3CHC A;  1FKJ A;  4ODO A;  4Z2L A;  1D6O A;  3BMB A;  4WK9 A;  4DWS D;  1K9T A;  1FFR A;  4IQC A;  2DT2 A;  2MLX A;  1LL4 A;  2EUL A;  3RM4 A;  3CZ8 A;  1OWQ A;  1NWT A;  2KE0 A;  1JNT A;  2AOS A;  1W1P A;  3WL0 A;  4HBE A;  2QF8 A;  3B7X A;  2YBT A;  3ARS A;  1J4R A;  4P8X A;  2PV2 A;  3EY6 A;  2KGJ A;  4IPX A;  1FKK A;  4FN2 A;  4HAR A;  1TFV A;  2G41 A;  2DSU A;  3PA7 A;  4TYO A;  1C9H A;  2IF4 A;  4QT2 A;  2ZR5 A;  4MPK A;  2WM0 A;  4G2P A;  3RME A;  1SYT A;  3ARU A;  1FKL A;  1ZBC A;  3ARR A;  3O5P A;  1UR8 A;  4JFM A;  1KT0 A;  1GPF A;  1BKF A;  1ROU A;  4IQ2 A;  4DIP A;  1YAT A;  5HUA A;  2ESC A;  4QT3 A;  3O5I A;  2DSW A;  4DT4 A;  1D7J A;  1E6Z A;  2FKE A;  2D9F A;  1VF8 A;  1T11 A;  4WKF A;  2XP9 A;  2OFN A;  1QPL A;  4ZPV R;  1FKR A;  3O5G A;  4P8U A;  4DH0 A;  1E9L A;  4TW8 A;  3JYJ A;  1W1T A;  2RUQ A; 
#chains in the Genus database with same CATH homology
 2F4E A;  2RQS A;  1E15 A;  4DZ2 A;  1FJD A;  2DG9 A;  3FAP A;  1J4H A;  3NRK A;  1NWU A;  3NTP A;  2PPO A;  1F40 A;  1E6N A;  5I98 A;  1NMV A;  2AWG A;  4Z2J A;  1NSG A;  4L72 B;  4MAV A;  5HTG A;  2FDM A;  5JH8 A;  2A3A A;  4C02 B;  1M5Y A;  1TCO C;  2XPB A;  1YW5 A;  2KI3 A;  5B8I C;  1A7X A;  2MF9 A;  1E6R A;  1Q1C A;  2O9O A;  2YBU A;  4ITZ A;  4XAK A;  4NZC A;  4WIW A;  1ITX A;  3IK8 A;  4W9O A;  1BL4 A;  1PIN A;  3ARV A;  3IKG A;  3AS0 A;  4ODK A;  1LL7 A;  1JNS A;  4KQZ A;  1ZBW A;  5DEZ A;  3G6L A;  1SR0 A;  2Y78 A;  4U86 A;  5DO2 A;  3CHE A;  3UQI A;  3WD0 A;  4Q22 A;  2L2S A;  1WNO A;  2DSZ A;  2XP8 A;  2G8Z A;  1RD6 A;  1ZB5 A;  1JVW A;  1FFQ A;  4JFI A;  4Z2G A;  2PV1 A;  3LUO A;  5BXJ A;  4Z2I A;  4DRN A;  4BF8 A;  3VAW A;  4DRJ A;  1W26 A;  5DIV A;  3UI6 A;  4LAX A;  1HJW A;  4W9Q A;  2N87 A;  1W9V A;  2PPN A;  2PV3 A;  1OGB A;  1D2K A;  1W9P A;  3KCE A;  4J4N A;  3TCZ A;  2K8I A;  3UQA A;  4ODQ A;  4WKA A;  3WQV A;  2ZQS A;  1CTN A;  3KAI A;  4DWS B;  4P8W A;  3KAD A;  1D7I A;  1HKJ A;  5HW6 A;  1UR9 A;  3O5D A;  3IKD A;  2VN1 A;  1N1A A;  3PRB A;  2RSE A;  2MLZ A;  3JXV A;  1HKI A;  1X6N A;  3O5L A;  4NNR A;  4JFK A;  4ML4 A;  3ARZ A;  3KAF A;  4ODM A;  4DRM A;  1D7H A;  1PBK A;  3O5K A;  4QIB A;  1H0I A;  4GGQ A;  4TW7 A;  4IT4 A;  4MNJ A;  4TX0 A;  2VCD A;  4NSB A;  4W5U A;  1J4I A;  2FAP A;  3KAC A;  4S3J A;  2O92 A;  3RM9 A;  3ALF A;  4AY1 A;  3ODK A;  1HKM A;  4URI A;  2LPV A;  2ZQU A;  1LJY A;  3WQW A;  2B31 A;  4DWS A;  3O5E A;  4MSP A;  2LJ4 A;  3ARO A;  3WD2 A;  2PI6 A;  4DWS C;  1JND A;  1Q6I A;  1X6L A;  3OA5 A;  3KZ7 A;  3JYM A;  3CGM A;  1FKH A;  5GPR A;  1JNE A;  3AS1 A;  3CHD A;  1LG2 A;  1WAW A;  4R5E A;  1L1P A;  1W1V A;  1OGG A;  5HWC A;  2RUD A;  2ZR4 A;  1ZU8 A;  1WB0 A;  3UI4 A;  3WD4 A;  2DPE A;  2MPH A;  5HBF A;  3WKZ A;  4P8V A;  2DT1 A;  1O6I A;  5HKG A;  1QPF A;  1EQ3 A;  3AS3 A;  5J6E A;  1ZBK A;  3OOB A;  4MTV A;  1KT1 A;  1IX5 A;  3B8S A;  3ARW A;  4Z2H A;  4J4O A;  3ALG A;  3ARY A;  1ZL1 A;  1J6Y A;  4JFJ A;  1ZK6 A;  2KFW A;  3CGN A;  2PBC A;  1QZ2 A;  3RGC A;  2WK2 A;  4IT6 A;  2KO7 A;  4DRI A;  4TW6 A;  2MLY A;  1EDQ A;  3UQB A;  3O5O A;  2XP3 A;  1FKG A;  2DSV A;  4LGX A;  2WLY A;  1NMW A;  1FKS A;  1XRV A;  3RFW A;  2F21 A;  3NI6 A;  2M2A A;  1LL6 A;  2DT0 A;  1FD9 A;  4LAW A;  3B9D A;  1HKK A;  3QOK A;  3CH9 A;  3PRA A;  4L3N A;  5GPG A;  1P5Q A;  4MNK A;  1NWS A;  4JYS A;  5DIT A;  3KAG A;  4DZ3 A;  1H0G A;  1GUV A;  3CHF A;  4ODN A;  1FKB A;  2LKN A;  4DRO A;  4G50 A;  2PPP A;  1B6C A;  1ROT A;  3I6C A;  3H9R B;  4ODL A;  3PR9 A;  4MNL A;  1ZCN A;  5HT1 A;  3AS2 A;  4TNS A;  1R9H A;  1ZBV A;  3G6M A;  4MGV A;  4U84 A;  2KR7 A;  2Q5A A;  2XPA A;  4WJX A;  3FXY A;  1U79 A;  1E6P A;  4ODR A;  3ART A;  2DG3 A;  3ARQ A;  4LAV A;  2ZQT A;  4N19 A;  3MDY B;  2MNT A;  2ZQV A;  4ZS6 A;  2DG4 A;  3UI5 A;  5D75 A;  4LAY A;  1Q6H A;  3BXW A;  1FKT A;  1Y0O A;  3WH0 A;  2RUC A;  3O5F A;  3WD3 A;  2ZR6 A;  1KFW A;  1FAP A;  3WL1 A;  4HBO A;  3ARP A;  3WD1 A;  4DRK A;  2A3E A;  4DRH A;  4R0X A;  2XP5 A;  2LGO A;  4W9P A;  2A3C A;  1F8A B;  3O5M A;  2IUZ A;  1HXV A;  1NWR A;  3B9A A;  3RM8 A;  5GQB A;  2RUR A;  1HJX A;  3GPK A;  5DIU A;  2A3B A;  3UF8 A;  3ARX A;  1Q6U A;  2WLZ A;  4KR0 B;  4Q7N A;  3TDB A;  3PRD A;  3W4R A;  3TC5 A;  3O5R A;  4ZPW R;  1NH6 A;  2M1I A;  1LG1 A;  3KAH A;  4ZPT R;  5HWB A;  2M08 A;  4ODP A;  4U85 A;  3WIJ A;  4DRQ A;  4JFL A;  2XP4 A;  2ITK A;  1EIB A;  3KAB A;  5DF0 A;  5HW8 A;  2OLH A;  4S3K A;  4QZV B;  1EYM A;  4GIV A;  1GOI A;  4O2T A;  1FKD A;  1XHG A;  3AQU A;  4FAP A;  2UZ5 A;  2XP6 A;  4MNM A;  1HJV A;  2XP7 A;  4Z2K A;  4PTM A;  1EHN A;  3IHZ A;  2F2D A;  2DT3 A;  1W9U A;  1FKF A;  3O5Q A;  4DRP A;  1FKI A;  1W1Y A;  1LQ0 A;  4WKH A;  3O5J A;  3B9E A;  5HW7 A;  2JZV A;  3FY1 A;  3CHC A;  1FKJ A;  4ODO A;  4Z2L A;  1D6O A;  4WK9 A;  4DWS D;  1K9T A;  1FFR A;  4IQC A;  2DT2 A;  2MLX A;  1LL4 A;  3RM4 A;  3CZ8 A;  1OWQ A;  1NWT A;  2KE0 A;  1JNT A;  2AOS A;  1W1P A;  3WL0 A;  4HBE A;  2QF8 A;  3B7X A;  2YBT A;  3ARS A;  1J4R A;  4P8X A;  2PV2 A;  3EY6 A;  2KGJ A;  4IPX A;  1FKK A;  4FN2 A;  4HAR A;  1TFV A;  2G41 A;  2DSU A;  3PA7 A;  4TYO A;  1C9H A;  2IF4 A;  4QT2 A;  2ZR5 A;  4MPK A;  2WM0 A;  4G2P A;  3RME A;  1SYT A;  3ARU A;  1FKL A;  1ZBC A;  3ARR A;  3O5P A;  1UR8 A;  4JFM A;  1KT0 A;  1GPF A;  1BKF A;  1ROU A;  4IQ2 A;  4DIP A;  1YAT A;  5HUA A;  2ESC A;  4QT3 A;  3O5I A;  2DSW A;  4DT4 A;  1D7J A;  1E6Z A;  2FKE A;  2D9F A;  1VF8 A;  1T11 A;  4WKF A;  2XP9 A;  2OFN A;  1QPL A;  4ZPV R;  1FKR A;  3O5G A;  4P8U A;  4DH0 A;  1E9L A;  4TW8 A;  3JYJ A;  1W1T A;  2RUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...