5D75A

Crystal structure of human fkbd25 in complex with fk506
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
b'PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDIDLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Crystal structure of the FK506 binding domain of human FKBP25 in complex with FK506.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/inhibitor
total genus 27
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5d75A00
1PINA 5BXJA 2XPAA 5HW6A 1FKSA 1F40A 4O2TA 2VN1A 1BKFA 3MDYB 3TC5A 2ITKA 4DZ3A 1NMWA 1QPFA 4DRHA 2LPVA 1EYMA 1FKKA 5HKGA 1FKBA 4GGQA 4DRQA 2M1IA 1FJDA 1Q6IA 4QT3A 4U84A 3TDBA 3GPKA 4G50A 2XP9A 4LAVA 2MLYA 4ITZA 2RUQA 4IPXA 2MPHA 4DRPA 4JFLA 3O5GA 1D7HA 2XPBA 4DRKA 4JFIA 2LGOA 3NRKA 4JFMA 3JXVA 1KT0A 4J4OA 4LAXA 2PPNA 3I6CA 3KAFA 4C02B 1JVWA 4DH0A 5HTGA 1KT1A 3O5MA 4G2PA 4TW6A 3UQAA 3KADA 3O5LA 4TW8A 4DT4A 2XP8A 5B8IC 1J6YA 1FKLA 1QZ2A 4DZ2A 2Q5AA 4W9QA 5HW8A 5HW7A 4GIVA 1FKRA 2PV3A 3IHZA 5HUAA 1TCOC 5I98A 4W9PA 5D75A 2PPOA 1ROUA 2KO7A 4ODOA 2PV1A 3B7XA 5DIUA 1FKJA 2XP3A 2VCDA 1N1AA 1A7XA 2MF9A 2XP6A 2M08A 2XP7A 2ZR4A 2ZR5A 3FAPA 4ODQA 1FKIA 2MLZA 4ODPA 1HXVA 2MNTA 2OFNA 3KAIA 2FKEA 4MSPA 2XP4A 1FKGA 3O5KA 1QPLA 4JFKA 4NNRA 1Q6HA 1FAPA 2F4EA 5HT1A 1J4RA 2DG4A 3IKDA 3KCEA 2FAPA 1ROTA 3H9RB 4DRMA 1FD9A 3UF8A 2F2DA 2KFWA 3CGMA 3O5EA 1J4IA 2DG9A 3O5QA 2LKNA 3O5DA 1B6CA 2K8IA 4R0XA 4DRIA 3RGCA 3O5FA 5HWCA 2RUDA 3EY6A 1R9HA 4FAPA 4FN2A 4ODNA 4ODMA 3KACA 3UQIA 4N19A 3VAWA 4IQCA 3ODKA 3UI5A 1NSGA 1P5QA 4J4NA 5DITA 4ODRA 4TNSA 3O5RA 3O5OA 2RQSA 2RUCA 5HWBA 4QT2A 1EQ3A 4U86A 3UI6A 3LUOA 1W26A 3PRDA 4BF8A 2JZVA 5J6EA 2L2SA 3CGNA 4ODLA 4TX0A 1D6OA 2F21A 3O5IA 3WH0A 3NI6A 3RFWA 1M5YA 2IF4A 1BL4A 2D9FA 1JNTA 1Q1CA 1NMVA 2KGJA 2PBCA 4LAYA 4U85A 2LJ4A 4DRJA 2ZQUA 4ODKA 1FKFA 3UI4A 1C9HA 3KABA 1F8AB 1Y0OA 2ZQVA 1FKDA 4LAWA 3O5JA 3PA7A 2RURA 1ZK6A 3JYMA 3OOBA 2KR7A 1FKTA 3KAGA 1T11A 3PRBA 2AWGA 4TW7A 2RSEA 3IK8A 3TCZA 3IKGA 2M2AA 3JYJA 4DIPA 2KI3A 3NTPA 1J4HA 4IQ2A 1YW5A 2PPPA 1FKHA 2DG3A 5GPGA 4JYSA 1Q6UA 1D7IA 2ZQSA 3KZ7A 4DROA 4TYOA 2PV2A 2Y78A 2ZQTA 3O5PA 2ZR6A 1D7JA 1PBKA 2N87A 1ZCNA 2XP5A 1U79A 3KAHA 3UQBA 5DIVA 4MGVA 2MLXA 4W9OA 4JFJA 1YATA 1L1PA 1JNSA 4DRNA 2KE0A 2UZ5A 4QIBA
chains in the Genus database with same CATH superfamily
1IX5A 1LL7A 2ETNA 3B9AA 3TC5A 1BKFA 4DZ3A 2LPVA 1FKKA 5HKGA 5GPRA 1ITXA 2M1IA 1FJDA 3GPKA 1WNOA 4S3JA 4LAVA 2MLYA 1NWUA 2LGOA 3BXWA 4JFMA 1ZU8A 5HTGA 2PPNA 2ESCA 3I6CA 1JVWA 4DH0A 3AS0A 3O5MA 4G2PA 3O5LA 2XP8A 3EIPA 1FKLA 4DZ2A 5HW8A 3ALFA 2PV3A 3WD1A 1E9LA 5I98A 5D75A 3AS3A 2VCDA 2M08A 2O92A 1FKIA 1LJYA 2OFNA 2FKEA 1FKGA 4ZS6A 4DRMA 4WKAA 3WL1A 3O5QA 3RGCA 4XAKA 4ODMA 3KACA 4DWSB 4N19A 4IQCA 3PRAA 3ODKA 1NSGA 4TNSA 4MNMA 1ZBWA 3ALGA 3G6MA 1LL6A 1UR9A 5HWBA 3GU0A 3UI6A 1EHNA 4WKHA 3W4RA 3O5IA 3NI6A 3ARQA 1XHGA 2G41A 1Y0OA 1FKDA 3O5JA 3PA7A 1ZK6A 4Z2LA 3PRBA 4TW7A 3IK8A 3TCZA 4IQ2A 2DSZA 1FKHA 4IT4A 3QOKA 1WAWA 4TYOA 2PV2A 3UQBA 1D7JA 3ARRA 2XP5A 1ZCNA 1H0IA 1NWTA 2IUZA 5DF0A 2KE0A 2UZ5A 1PINA 1K9TA 2XPAA 2WLZA 1FKSA 3MDYB 2ITKA 1TFVA 4DRHA 2G8ZA 1NWSA 1JNDA 1W1PA 2DPEA 4DRQA 4DWSD 1Q6IA 4QT3A 1W9UA 2DT1A 4G50A 2WLYA 1E44A 2PI6A 1LQ0A 4ITZA 4HARA 4IPXA 2MPHA 2A3CA 2EULA 4JFLA 4JFIA 5GQBA 1E6RA 3NRKA 3JXVA 1KT0A 3KAFA 3RM8A 1NH6A 3ARPA 4TW6A 2FDMA 4DT4A 1SYTA 5HW7A 5HUAA 2WK2A 3AROA 2PPOA 2KO7A 4ODOA 2PV1A 3B7XA 3WKZA 1FKJA 2XP3A 4DRIA 1ZBKA 2MF9A 3FAPA 4ODPA 2F23A 3KAIA 4P8VA 4JFKA 1D2KA 3IKDA 2YBUA 3KCEA 3H9RB 4Z2KA 3ARSA 4P8XA 3UF8A 4NZCA 2KFWA 1HJWA 1E6ZA 1X6NA 3WQVA 5HWCA 3O5FA 1R9HA 4FN2A 4ODNA 4QZVB 3UQIA 1P5QA 4J4NA 5DITA 3O5RA 3RM4A 2RQSA 3WIJA 1UR8A 3WD4A 1GPFA 2JZVA 3AQUA 2L2SA 5J6EA 2DT3A 4TX0A 3WH0A 2F21A 2IF4A 2D9FA 1JNTA 4LGXA 4AY1A 2PBCA 2LJ4A 4MNKA 3ARTA 3G6LA 4MAVA 4LAWA 4NSBA 4URIA 3JYMA 1ZBCA 1ZB5A 1H0GA 3KAGA 3CHCA 4MTVA 4PTMA 4DIPA 3IKGA 2M2AA 3JYJA 1HJVA 2KI3A 3NTPA 1YW5A 2DG3A 4MPKA 5GPGA 1Q6UA 4Z2JA 4DROA 3KZ7A 4ZPWR 1RD6A 3TDBA 1U79A 1E6PA 2PN0A 2A3BA 4QIBA 1W1YA 1F40A 1NMWA 1EYMA 4MNLA 2B5UB 3CHFA 4DRKA 1D7HA 3FY1A 1O6IA 4LAXA 1GOIA 1KT1A 3CZ8A 3KADA 4TW8A 1J6YA 1QZ2A 2Q5AA 4W9QA 2DT2A 4HBEA 2A3EA 4FAPA 1N1AA 4ODQA 3ARXA 2XP7A 2ZR4A 1X6LA 1HXVA 1HKMA 3ARWA 3CH9A 2WM0A 4MSPA 2XP4A 3B9DA 1W1TA 2F4EA 5HT1A 1J4RA 2DG4A 1E15A 3BMBA 2FAPA 1ROTA 1FD9A 4L72B 4S3KA 3CGMA 1OWQA 4WK9A 1J4IA 1HKJA 3O5DA 2B31A 2K8IA 4R0XA 3EY6A 4WIWA 2DSWA 3AS2A 3VAWA 1OGBA 4Q22A 4ODRA 2RUCA 4Z2IA 4L3NA 4QT2A 1EQ3A 4DWSC 3LUOA 1W26A 4BF8A 3WD2A 3CGNA 3AS1A 3ARUA 1M5YA 1NMVA 4LAYA 4U85A 4DRJA 1FKFA 3UI4A 3ARYA 3GTYX 1LG1A 3OA5A 5DEZA 3OOBA 3CHDA 2KR7A 1T11A 2AWGA 2A3AA 3B8SA 4JYSA 1WB0A 1W9VA 2OLHA 2ZQSA 2Y78A 2ZQTA 3O5PA 2ZR6A 1PBKA 5JH8A 4MGVA 2MLXA 4W9OA 1CTNA 4WJXA 4MNJA 1EDQA 1FFRA 4JFJA 1YATA 1JNSA 2AOSA 4KQZA 5BXJA 3FXYA 1JNEA 5HW6A 1VF8A 1W1VA 2VN1A 4O2TA 4Z2GA 2DSUA 5HBFA 1QPFA 4ZPVR 4ZPTR 1FKBA 4GGQA 1KFWA 4U84A 4R5EA 2XP9A 3ARZA 4DWSA 1GRJA 2RUQA 4DRPA 3O5GA 2XPBA 4C02B 4J4OA 1LG2A 3UQAA 4P8UA 5B8IC 4GIVA 3IHZA 1TCOC 4P8WA 4W9PA 4Z2HA 1ROUA 1E6NA 5DIUA 1A7XA 2XP6A 2ZR5A 1HKKA 2MLZA 2MNTA 1ZBVA 4NNRA 3O5KA 1QPLA 1Q6HA 1FAPA 1XRVA 5DO2A 2F2DA 1W9PA 2DSVA 3O5EA 4Q7NA 2DG9A 2P4VA 2YBTA 2LKNA 4IT6A 3PR9A 1B6CA 4UDMA 1FFQA 1EIBA 2RUDA 3WL0A 1ZL1A 3UI5A 1HKIA 3WQWA 1OGGA 3O5OA 1GUVA 4U86A 1SR0A 3PRDA 4ODLA 3CHEA 1D6OA 3RM9A 3RFWA 1BL4A 1HJXA 1Q1CA 2KGJA 2ZQUA 4ODKA 3ARVA 1C9HA 3B9EA 3KABA 4ML4A 1F8AB 2ZQVA 4W5UA 1LL4A 2RURA 4WKFA 1FKTA 2DT0A 2O9OA 2RSEA 3WD3A 4KR0B 1J4HA 2PPPA 3WD0A 1D7IA 2QF8A 2N87A 3KAHA 5DIVA 1L1PA 4HBOA 4DRNA 1FKRA 1NWRA 1JCHB 3RMEA
chains in the Genus database with same CATH topology
1IX5A 1LL7A 3B9AA 3TC5A 1BKFA 4DZ3A 2LPVA 1FKKA 5HKGA 5GPRA 1ITXA 2M1IA 1FJDA 3GPKA 1WNOA 4S3JA 4LAVA 2MLYA 1NWUA 2LGOA 3BXWA 4JFMA 1ZU8A 5HTGA 2PPNA 2ESCA 3I6CA 1JVWA 4DH0A 3AS0A 3O5MA 4G2PA 3O5LA 2XP8A 1FKLA 4DZ2A 5HW8A 3ALFA 2PV3A 3WD1A 1E9LA 5I98A 5D75A 3AS3A 2VCDA 2M08A 2O92A 1FKIA 1LJYA 2OFNA 2FKEA 1FKGA 4ZS6A 4DRMA 4WKAA 3WL1A 3O5QA 3RGCA 4XAKA 4ODMA 3KACA 4DWSB 4N19A 4IQCA 3PRAA 3ODKA 1NSGA 4TNSA 4MNMA 1ZBWA 3ALGA 3G6MA 1LL6A 1UR9A 5HWBA 3UI6A 1EHNA 4WKHA 3W4RA 3O5IA 3NI6A 3ARQA 1XHGA 2G41A 1Y0OA 1FKDA 3O5JA 3PA7A 1ZK6A 4Z2LA 3PRBA 4TW7A 3IK8A 3TCZA 4IQ2A 2DSZA 1FKHA 4IT4A 3QOKA 1WAWA 4TYOA 2PV2A 3UQBA 1D7JA 3ARRA 2XP5A 1ZCNA 1H0IA 1NWTA 2IUZA 5DF0A 2KE0A 2UZ5A 1PINA 1K9TA 2XPAA 2WLZA 1FKSA 3MDYB 2ITKA 1TFVA 4DRHA 2G8ZA 1NWSA 1JNDA 1W1PA 2DPEA 4DRQA 4DWSD 1Q6IA 4QT3A 1W9UA 2DT1A 4G50A 2WLYA 2PI6A 1LQ0A 4ITZA 4HARA 4IPXA 2MPHA 2A3CA 4JFLA 4JFIA 5GQBA 1E6RA 3NRKA 3JXVA 1KT0A 3KAFA 3RM8A 1NH6A 3ARPA 4TW6A 2FDMA 4DT4A 1SYTA 5HW7A 5HUAA 2WK2A 3AROA 2PPOA 2KO7A 4ODOA 2PV1A 3B7XA 3WKZA 1FKJA 2XP3A 4DRIA 1ZBKA 2MF9A 3FAPA 4ODPA 3KAIA 4P8VA 4JFKA 1D2KA 3IKDA 2YBUA 3KCEA 3H9RB 4Z2KA 3ARSA 4P8XA 3UF8A 4NZCA 2KFWA 1HJWA 1E6ZA 1X6NA 3WQVA 5HWCA 3O5FA 1R9HA 4FN2A 4ODNA 4QZVB 3UQIA 1P5QA 4J4NA 5DITA 3O5RA 3RM4A 2RQSA 3WIJA 1UR8A 3WD4A 1GPFA 2JZVA 3AQUA 2L2SA 5J6EA 2DT3A 4TX0A 3WH0A 2F21A 2IF4A 2D9FA 1JNTA 4LGXA 4AY1A 2PBCA 2LJ4A 4MNKA 3ARTA 3G6LA 4MAVA 4LAWA 4NSBA 4URIA 3JYMA 1ZBCA 1ZB5A 1H0GA 3KAGA 3CHCA 4MTVA 4PTMA 4DIPA 3IKGA 2M2AA 3JYJA 1HJVA 2KI3A 3NTPA 1YW5A 2DG3A 4MPKA 5GPGA 1Q6UA 4Z2JA 4DROA 3KZ7A 4ZPWR 1RD6A 3TDBA 1U79A 1E6PA 2A3BA 4QIBA 1W1YA 1F40A 1NMWA 1EYMA 4MNLA 3CHFA 4DRKA 1D7HA 3FY1A 1O6IA 4LAXA 1GOIA 1KT1A 3CZ8A 3KADA 4TW8A 1J6YA 1QZ2A 2Q5AA 4W9QA 2DT2A 4HBEA 2A3EA 4FAPA 1N1AA 4ODQA 3ARXA 2XP7A 2ZR4A 1X6LA 1HXVA 1HKMA 3ARWA 3CH9A 2WM0A 4MSPA 2XP4A 3B9DA 1W1TA 2F4EA 5HT1A 1J4RA 2DG4A 1E15A 2FAPA 1ROTA 1FD9A 4L72B 4S3KA 3CGMA 1OWQA 4WK9A 1J4IA 1HKJA 3O5DA 2B31A 2K8IA 4R0XA 3EY6A 4WIWA 2DSWA 3AS2A 3VAWA 1OGBA 4Q22A 4ODRA 2RUCA 4Z2IA 4L3NA 4QT2A 1EQ3A 4DWSC 3LUOA 1W26A 4BF8A 3WD2A 3CGNA 3AS1A 3ARUA 1M5YA 1NMVA 4LAYA 4U85A 4DRJA 1FKFA 3UI4A 3ARYA 1LG1A 3OA5A 5DEZA 3OOBA 3CHDA 2KR7A 1T11A 2AWGA 2A3AA 3B8SA 4JYSA 1WB0A 1W9VA 2OLHA 2ZQSA 2Y78A 2ZQTA 3O5PA 2ZR6A 1PBKA 5JH8A 4MGVA 2MLXA 4W9OA 1CTNA 4WJXA 4MNJA 1EDQA 1FFRA 4JFJA 1YATA 1JNSA 2AOSA 4KQZA 5BXJA 3FXYA 1JNEA 5HW6A 1VF8A 1W1VA 2VN1A 4O2TA 4Z2GA 2DSUA 5HBFA 1QPFA 4ZPVR 4ZPTR 1FKBA 4GGQA 1KFWA 4U84A 4R5EA 2XP9A 3ARZA 4DWSA 2RUQA 4DRPA 3O5GA 2XPBA 4C02B 4J4OA 1LG2A 3UQAA 4P8UA 5B8IC 4GIVA 3IHZA 1TCOC 4P8WA 4W9PA 4Z2HA 1ROUA 1E6NA 5DIUA 1A7XA 2XP6A 2ZR5A 1HKKA 2MLZA 2MNTA 1ZBVA 4NNRA 3O5KA 1QPLA 1Q6HA 1FAPA 1XRVA 5DO2A 2F2DA 1W9PA 2DSVA 3O5EA 4Q7NA 2DG9A 2YBTA 2LKNA 4IT6A 3PR9A 1B6CA 1FFQA 1EIBA 2RUDA 3WL0A 1ZL1A 3UI5A 1HKIA 3WQWA 1OGGA 3O5OA 1GUVA 4U86A 1SR0A 3PRDA 4ODLA 3CHEA 1D6OA 3RM9A 3RFWA 1BL4A 1HJXA 1Q1CA 2KGJA 2ZQUA 4ODKA 3ARVA 1C9HA 3B9EA 3KABA 4ML4A 1F8AB 2ZQVA 4W5UA 1LL4A 2RURA 4WKFA 1FKTA 2DT0A 2O9OA 2RSEA 3WD3A 4KR0B 1J4HA 2PPPA 3WD0A 1D7IA 2QF8A 2N87A 3KAHA 5DIVA 1L1PA 4HBOA 4DRNA 1FKRA 1NWRA 3RMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIN A;  5BXJ A;  2XPA A;  5HW6 A;  1FKS A;  1F40 A;  4O2T A;  2VN1 A;  1BKF A;  3MDY B;  3TC5 A;  2ITK A;  4DZ3 A;  1NMW A;  1QPF A;  4DRH A;  2LPV A;  1EYM A;  1FKK A;  5HKG A;  1FKB A;  4GGQ A;  4DRQ A;  2M1I A;  1FJD A;  1Q6I A;  4QT3 A;  4U84 A;  3TDB A;  3GPK A;  4G50 A;  2XP9 A;  4LAV A;  2MLY A;  4ITZ A;  2RUQ A;  4IPX A;  2MPH A;  4DRP A;  4JFL A;  3O5G A;  1D7H A;  2XPB A;  4DRK A;  4JFI A;  2LGO A;  3NRK A;  4JFM A;  3JXV A;  1KT0 A;  4J4O A;  4LAX A;  2PPN A;  3I6C A;  3KAF A;  4C02 B;  1JVW A;  4DH0 A;  5HTG A;  1KT1 A;  3O5M A;  4G2P A;  4TW6 A;  3UQA A;  3KAD A;  3O5L A;  4TW8 A;  4DT4 A;  2XP8 A;  5B8I C;  1J6Y A;  1FKL A;  1QZ2 A;  4DZ2 A;  2Q5A A;  4W9Q A;  5HW8 A;  5HW7 A;  4GIV A;  1FKR A;  2PV3 A;  3IHZ A;  5HUA A;  1TCO C;  5I98 A;  4W9P A;  5D75 A;  2PPO A;  1ROU A;  2KO7 A;  4ODO A;  2PV1 A;  3B7X A;  5DIU A;  1FKJ A;  2XP3 A;  2VCD A;  1N1A A;  1A7X A;  2MF9 A;  2XP6 A;  2M08 A;  2XP7 A;  2ZR4 A;  2ZR5 A;  3FAP A;  4ODQ A;  1FKI A;  2MLZ A;  4ODP A;  1HXV A;  2MNT A;  2OFN A;  3KAI A;  2FKE A;  4MSP A;  2XP4 A;  1FKG A;  3O5K A;  1QPL A;  4JFK A;  4NNR A;  1Q6H A;  1FAP A;  2F4E A;  5HT1 A;  1J4R A;  2DG4 A;  3IKD A;  3KCE A;  2FAP A;  1ROT A;  3H9R B;  4DRM A;  1FD9 A;  3UF8 A;  2F2D A;  2KFW A;  3CGM A;  3O5E A;  1J4I A;  2DG9 A;  3O5Q A;  2LKN A;  3O5D A;  1B6C A;  2K8I A;  4R0X A;  4DRI A;  3RGC A;  3O5F A;  5HWC A;  2RUD A;  3EY6 A;  1R9H A;  4FAP A;  4FN2 A;  4ODN A;  4ODM A;  3KAC A;  3UQI A;  4N19 A;  3VAW A;  4IQC A;  3ODK A;  3UI5 A;  1NSG A;  1P5Q A;  4J4N A;  5DIT A;  4ODR A;  4TNS A;  3O5R A;  3O5O A;  2RQS A;  2RUC A;  5HWB A;  4QT2 A;  1EQ3 A;  4U86 A;  3UI6 A;  3LUO A;  1W26 A;  3PRD A;  4BF8 A;  2JZV A;  5J6E A;  2L2S A;  3CGN A;  4ODL A;  4TX0 A;  1D6O A;  2F21 A;  3O5I A;  3WH0 A;  3NI6 A;  3RFW A;  1M5Y A;  2IF4 A;  1BL4 A;  2D9F A;  1JNT A;  1Q1C A;  1NMV A;  2KGJ A;  2PBC A;  4LAY A;  4U85 A;  2LJ4 A;  4DRJ A;  2ZQU A;  4ODK A;  1FKF A;  3UI4 A;  1C9H A;  3KAB A;  1F8A B;  1Y0O A;  2ZQV A;  1FKD A;  4LAW A;  3O5J A;  3PA7 A;  2RUR A;  1ZK6 A;  3JYM A;  3OOB A;  2KR7 A;  1FKT A;  3KAG A;  1T11 A;  3PRB A;  2AWG A;  4TW7 A;  2RSE A;  3IK8 A;  3TCZ A;  3IKG A;  2M2A A;  3JYJ A;  4DIP A;  2KI3 A;  3NTP A;  1J4H A;  4IQ2 A;  1YW5 A;  2PPP A;  1FKH A;  2DG3 A;  5GPG A;  4JYS A;  1Q6U A;  1D7I A;  2ZQS A;  3KZ7 A;  4DRO A;  4TYO A;  2PV2 A;  2Y78 A;  2ZQT A;  3O5P A;  2ZR6 A;  1D7J A;  1PBK A;  2N87 A;  1ZCN A;  2XP5 A;  1U79 A;  3KAH A;  3UQB A;  5DIV A;  4MGV A;  2MLX A;  4W9O A;  4JFJ A;  1YAT A;  1L1P A;  1JNS A;  4DRN A;  2KE0 A;  2UZ5 A;  4QIB A; 
#chains in the Genus database with same CATH topology
 1IX5 A;  1LL7 A;  2ETN A;  3B9A A;  3TC5 A;  1BKF A;  4DZ3 A;  2LPV A;  1FKK A;  5HKG A;  5GPR A;  1ITX A;  2M1I A;  1FJD A;  3GPK A;  1WNO A;  4S3J A;  4LAV A;  2MLY A;  1NWU A;  2LGO A;  3BXW A;  4JFM A;  1ZU8 A;  5HTG A;  2PPN A;  2ESC A;  3I6C A;  1JVW A;  4DH0 A;  3AS0 A;  3O5M A;  4G2P A;  3O5L A;  2XP8 A;  3EIP A;  1FKL A;  4DZ2 A;  5HW8 A;  3ALF A;  2PV3 A;  3WD1 A;  1E9L A;  5I98 A;  5D75 A;  3AS3 A;  2VCD A;  2M08 A;  2O92 A;  1FKI A;  1LJY A;  2OFN A;  2FKE A;  1FKG A;  4ZS6 A;  4DRM A;  4WKA A;  3WL1 A;  3O5Q A;  3RGC A;  4XAK A;  4ODM A;  3KAC A;  4DWS B;  4N19 A;  4IQC A;  3PRA A;  3ODK A;  1NSG A;  4TNS A;  4MNM A;  1ZBW A;  3ALG A;  3G6M A;  1LL6 A;  1UR9 A;  5HWB A;  3GU0 A;  3UI6 A;  1EHN A;  4WKH A;  3W4R A;  3O5I A;  3NI6 A;  3ARQ A;  1XHG A;  2G41 A;  1Y0O A;  1FKD A;  3O5J A;  3PA7 A;  1ZK6 A;  4Z2L A;  3PRB A;  4TW7 A;  3IK8 A;  3TCZ A;  4IQ2 A;  2DSZ A;  1FKH A;  4IT4 A;  3QOK A;  1WAW A;  4TYO A;  2PV2 A;  3UQB A;  1D7J A;  3ARR A;  2XP5 A;  1ZCN A;  1H0I A;  1NWT A;  2IUZ A;  5DF0 A;  2KE0 A;  2UZ5 A;  1PIN A;  1K9T A;  2XPA A;  2WLZ A;  1FKS A;  3MDY B;  2ITK A;  1TFV A;  4DRH A;  2G8Z A;  1NWS A;  1JND A;  1W1P A;  2DPE A;  4DRQ A;  4DWS D;  1Q6I A;  4QT3 A;  1W9U A;  2DT1 A;  4G50 A;  2WLY A;  1E44 A;  2PI6 A;  1LQ0 A;  4ITZ A;  4HAR A;  4IPX A;  2MPH A;  2A3C A;  2EUL A;  4JFL A;  4JFI A;  5GQB A;  1E6R A;  3NRK A;  3JXV A;  1KT0 A;  3KAF A;  3RM8 A;  1NH6 A;  3ARP A;  4TW6 A;  2FDM A;  4DT4 A;  1SYT A;  5HW7 A;  5HUA A;  2WK2 A;  3ARO A;  2PPO A;  2KO7 A;  4ODO A;  2PV1 A;  3B7X A;  3WKZ A;  1FKJ A;  2XP3 A;  4DRI A;  1ZBK A;  2MF9 A;  3FAP A;  4ODP A;  2F23 A;  3KAI A;  4P8V A;  4JFK A;  1D2K A;  3IKD A;  2YBU A;  3KCE A;  3H9R B;  4Z2K A;  3ARS A;  4P8X A;  3UF8 A;  4NZC A;  2KFW A;  1HJW A;  1E6Z A;  1X6N A;  3WQV A;  5HWC A;  3O5F A;  1R9H A;  4FN2 A;  4ODN A;  4QZV B;  3UQI A;  1P5Q A;  4J4N A;  5DIT A;  3O5R A;  3RM4 A;  2RQS A;  3WIJ A;  1UR8 A;  3WD4 A;  1GPF A;  2JZV A;  3AQU A;  2L2S A;  5J6E A;  2DT3 A;  4TX0 A;  3WH0 A;  2F21 A;  2IF4 A;  2D9F A;  1JNT A;  4LGX A;  4AY1 A;  2PBC A;  2LJ4 A;  4MNK A;  3ART A;  3G6L A;  4MAV A;  4LAW A;  4NSB A;  4URI A;  3JYM A;  1ZBC A;  1ZB5 A;  1H0G A;  3KAG A;  3CHC A;  4MTV A;  4PTM A;  4DIP A;  3IKG A;  2M2A A;  3JYJ A;  1HJV A;  2KI3 A;  3NTP A;  1YW5 A;  2DG3 A;  4MPK A;  5GPG A;  1Q6U A;  4Z2J A;  4DRO A;  3KZ7 A;  4ZPW R;  1RD6 A;  3TDB A;  1U79 A;  1E6P A;  2PN0 A;  2A3B A;  4QIB A;  1W1Y A;  1F40 A;  1NMW A;  1EYM A;  4MNL A;  2B5U B;  3CHF A;  4DRK A;  1D7H A;  3FY1 A;  1O6I A;  4LAX A;  1GOI A;  1KT1 A;  3CZ8 A;  3KAD A;  4TW8 A;  1J6Y A;  1QZ2 A;  2Q5A A;  4W9Q A;  2DT2 A;  4HBE A;  2A3E A;  4FAP A;  1N1A A;  4ODQ A;  3ARX A;  2XP7 A;  2ZR4 A;  1X6L A;  1HXV A;  1HKM A;  3ARW A;  3CH9 A;  2WM0 A;  4MSP A;  2XP4 A;  3B9D A;  1W1T A;  2F4E A;  5HT1 A;  1J4R A;  2DG4 A;  1E15 A;  3BMB A;  2FAP A;  1ROT A;  1FD9 A;  4L72 B;  4S3K A;  3CGM A;  1OWQ A;  4WK9 A;  1J4I A;  1HKJ A;  3O5D A;  2B31 A;  2K8I A;  4R0X A;  3EY6 A;  4WIW A;  2DSW A;  3AS2 A;  3VAW A;  1OGB A;  4Q22 A;  4ODR A;  2RUC A;  4Z2I A;  4L3N A;  4QT2 A;  1EQ3 A;  4DWS C;  3LUO A;  1W26 A;  4BF8 A;  3WD2 A;  3CGN A;  3AS1 A;  3ARU A;  1M5Y A;  1NMV A;  4LAY A;  4U85 A;  4DRJ A;  1FKF A;  3UI4 A;  3ARY A;  3GTY X;  1LG1 A;  3OA5 A;  5DEZ A;  3OOB A;  3CHD A;  2KR7 A;  1T11 A;  2AWG A;  2A3A A;  3B8S A;  4JYS A;  1WB0 A;  1W9V A;  2OLH A;  2ZQS A;  2Y78 A;  2ZQT A;  3O5P A;  2ZR6 A;  1PBK A;  5JH8 A;  4MGV A;  2MLX A;  4W9O A;  1CTN A;  4WJX A;  4MNJ A;  1EDQ A;  1FFR A;  4JFJ A;  1YAT A;  1JNS A;  2AOS A;  4KQZ A;  5BXJ A;  3FXY A;  1JNE A;  5HW6 A;  1VF8 A;  1W1V A;  2VN1 A;  4O2T A;  4Z2G A;  2DSU A;  5HBF A;  1QPF A;  4ZPV R;  4ZPT R;  1FKB A;  4GGQ A;  1KFW A;  4U84 A;  4R5E A;  2XP9 A;  3ARZ A;  4DWS A;  1GRJ A;  2RUQ A;  4DRP A;  3O5G A;  2XPB A;  4C02 B;  4J4O A;  1LG2 A;  3UQA A;  4P8U A;  5B8I C;  4GIV A;  3IHZ A;  1TCO C;  4P8W A;  4W9P A;  4Z2H A;  1ROU A;  1E6N A;  5DIU A;  1A7X A;  2XP6 A;  2ZR5 A;  1HKK A;  2MLZ A;  2MNT A;  1ZBV A;  4NNR A;  3O5K A;  1QPL A;  1Q6H A;  1FAP A;  1XRV A;  5DO2 A;  2F2D A;  1W9P A;  2DSV A;  3O5E A;  4Q7N A;  2DG9 A;  2P4V A;  2YBT A;  2LKN A;  4IT6 A;  3PR9 A;  1B6C A;  4UDM A;  1FFQ A;  1EIB A;  2RUD A;  3WL0 A;  1ZL1 A;  3UI5 A;  1HKI A;  3WQW A;  1OGG A;  3O5O A;  1GUV A;  4U86 A;  1SR0 A;  3PRD A;  4ODL A;  3CHE A;  1D6O A;  3RM9 A;  3RFW A;  1BL4 A;  1HJX A;  1Q1C A;  2KGJ A;  2ZQU A;  4ODK A;  3ARV A;  1C9H A;  3B9E A;  3KAB A;  4ML4 A;  1F8A B;  2ZQV A;  4W5U A;  1LL4 A;  2RUR A;  4WKF A;  1FKT A;  2DT0 A;  2O9O A;  2RSE A;  3WD3 A;  4KR0 B;  1J4H A;  2PPP A;  3WD0 A;  1D7I A;  2QF8 A;  2N87 A;  3KAH A;  5DIV A;  1L1P A;  4HBO A;  4DRN A;  1FKR A;  1NWR A;  1JCH B;  3RME A; 
#chains in the Genus database with same CATH homology
 1IX5 A;  1LL7 A;  3B9A A;  3TC5 A;  1BKF A;  4DZ3 A;  2LPV A;  1FKK A;  5HKG A;  5GPR A;  1ITX A;  2M1I A;  1FJD A;  3GPK A;  1WNO A;  4S3J A;  4LAV A;  2MLY A;  1NWU A;  2LGO A;  3BXW A;  4JFM A;  1ZU8 A;  5HTG A;  2PPN A;  2ESC A;  3I6C A;  1JVW A;  4DH0 A;  3AS0 A;  3O5M A;  4G2P A;  3O5L A;  2XP8 A;  1FKL A;  4DZ2 A;  5HW8 A;  3ALF A;  2PV3 A;  3WD1 A;  1E9L A;  5I98 A;  5D75 A;  3AS3 A;  2VCD A;  2M08 A;  2O92 A;  1FKI A;  1LJY A;  2OFN A;  2FKE A;  1FKG A;  4ZS6 A;  4DRM A;  4WKA A;  3WL1 A;  3O5Q A;  3RGC A;  4XAK A;  4ODM A;  3KAC A;  4DWS B;  4N19 A;  4IQC A;  3PRA A;  3ODK A;  1NSG A;  4TNS A;  4MNM A;  1ZBW A;  3ALG A;  3G6M A;  1LL6 A;  1UR9 A;  5HWB A;  3UI6 A;  1EHN A;  4WKH A;  3W4R A;  3O5I A;  3NI6 A;  3ARQ A;  1XHG A;  2G41 A;  1Y0O A;  1FKD A;  3O5J A;  3PA7 A;  1ZK6 A;  4Z2L A;  3PRB A;  4TW7 A;  3IK8 A;  3TCZ A;  4IQ2 A;  2DSZ A;  1FKH A;  4IT4 A;  3QOK A;  1WAW A;  4TYO A;  2PV2 A;  3UQB A;  1D7J A;  3ARR A;  2XP5 A;  1ZCN A;  1H0I A;  1NWT A;  2IUZ A;  5DF0 A;  2KE0 A;  2UZ5 A;  1PIN A;  1K9T A;  2XPA A;  2WLZ A;  1FKS A;  3MDY B;  2ITK A;  1TFV A;  4DRH A;  2G8Z A;  1NWS A;  1JND A;  1W1P A;  2DPE A;  4DRQ A;  4DWS D;  1Q6I A;  4QT3 A;  1W9U A;  2DT1 A;  4G50 A;  2WLY A;  2PI6 A;  1LQ0 A;  4ITZ A;  4HAR A;  4IPX A;  2MPH A;  2A3C A;  4JFL A;  4JFI A;  5GQB A;  1E6R A;  3NRK A;  3JXV A;  1KT0 A;  3KAF A;  3RM8 A;  1NH6 A;  3ARP A;  4TW6 A;  2FDM A;  4DT4 A;  1SYT A;  5HW7 A;  5HUA A;  2WK2 A;  3ARO A;  2PPO A;  2KO7 A;  4ODO A;  2PV1 A;  3B7X A;  3WKZ A;  1FKJ A;  2XP3 A;  4DRI A;  1ZBK A;  2MF9 A;  3FAP A;  4ODP A;  3KAI A;  4P8V A;  4JFK A;  1D2K A;  3IKD A;  2YBU A;  3KCE A;  3H9R B;  4Z2K A;  3ARS A;  4P8X A;  3UF8 A;  4NZC A;  2KFW A;  1HJW A;  1E6Z A;  1X6N A;  3WQV A;  5HWC A;  3O5F A;  1R9H A;  4FN2 A;  4ODN A;  4QZV B;  3UQI A;  1P5Q A;  4J4N A;  5DIT A;  3O5R A;  3RM4 A;  2RQS A;  3WIJ A;  1UR8 A;  3WD4 A;  1GPF A;  2JZV A;  3AQU A;  2L2S A;  5J6E A;  2DT3 A;  4TX0 A;  3WH0 A;  2F21 A;  2IF4 A;  2D9F A;  1JNT A;  4LGX A;  4AY1 A;  2PBC A;  2LJ4 A;  4MNK A;  3ART A;  3G6L A;  4MAV A;  4LAW A;  4NSB A;  4URI A;  3JYM A;  1ZBC A;  1ZB5 A;  1H0G A;  3KAG A;  3CHC A;  4MTV A;  4PTM A;  4DIP A;  3IKG A;  2M2A A;  3JYJ A;  1HJV A;  2KI3 A;  3NTP A;  1YW5 A;  2DG3 A;  4MPK A;  5GPG A;  1Q6U A;  4Z2J A;  4DRO A;  3KZ7 A;  4ZPW R;  1RD6 A;  3TDB A;  1U79 A;  1E6P A;  2A3B A;  4QIB A;  1W1Y A;  1F40 A;  1NMW A;  1EYM A;  4MNL A;  3CHF A;  4DRK A;  1D7H A;  3FY1 A;  1O6I A;  4LAX A;  1GOI A;  1KT1 A;  3CZ8 A;  3KAD A;  4TW8 A;  1J6Y A;  1QZ2 A;  2Q5A A;  4W9Q A;  2DT2 A;  4HBE A;  2A3E A;  4FAP A;  1N1A A;  4ODQ A;  3ARX A;  2XP7 A;  2ZR4 A;  1X6L A;  1HXV A;  1HKM A;  3ARW A;  3CH9 A;  2WM0 A;  4MSP A;  2XP4 A;  3B9D A;  1W1T A;  2F4E A;  5HT1 A;  1J4R A;  2DG4 A;  1E15 A;  2FAP A;  1ROT A;  1FD9 A;  4L72 B;  4S3K A;  3CGM A;  1OWQ A;  4WK9 A;  1J4I A;  1HKJ A;  3O5D A;  2B31 A;  2K8I A;  4R0X A;  3EY6 A;  4WIW A;  2DSW A;  3AS2 A;  3VAW A;  1OGB A;  4Q22 A;  4ODR A;  2RUC A;  4Z2I A;  4L3N A;  4QT2 A;  1EQ3 A;  4DWS C;  3LUO A;  1W26 A;  4BF8 A;  3WD2 A;  3CGN A;  3AS1 A;  3ARU A;  1M5Y A;  1NMV A;  4LAY A;  4U85 A;  4DRJ A;  1FKF A;  3UI4 A;  3ARY A;  1LG1 A;  3OA5 A;  5DEZ A;  3OOB A;  3CHD A;  2KR7 A;  1T11 A;  2AWG A;  2A3A A;  3B8S A;  4JYS A;  1WB0 A;  1W9V A;  2OLH A;  2ZQS A;  2Y78 A;  2ZQT A;  3O5P A;  2ZR6 A;  1PBK A;  5JH8 A;  4MGV A;  2MLX A;  4W9O A;  1CTN A;  4WJX A;  4MNJ A;  1EDQ A;  1FFR A;  4JFJ A;  1YAT A;  1JNS A;  2AOS A;  4KQZ A;  5BXJ A;  3FXY A;  1JNE A;  5HW6 A;  1VF8 A;  1W1V A;  2VN1 A;  4O2T A;  4Z2G A;  2DSU A;  5HBF A;  1QPF A;  4ZPV R;  4ZPT R;  1FKB A;  4GGQ A;  1KFW A;  4U84 A;  4R5E A;  2XP9 A;  3ARZ A;  4DWS A;  2RUQ A;  4DRP A;  3O5G A;  2XPB A;  4C02 B;  4J4O A;  1LG2 A;  3UQA A;  4P8U A;  5B8I C;  4GIV A;  3IHZ A;  1TCO C;  4P8W A;  4W9P A;  4Z2H A;  1ROU A;  1E6N A;  5DIU A;  1A7X A;  2XP6 A;  2ZR5 A;  1HKK A;  2MLZ A;  2MNT A;  1ZBV A;  4NNR A;  3O5K A;  1QPL A;  1Q6H A;  1FAP A;  1XRV A;  5DO2 A;  2F2D A;  1W9P A;  2DSV A;  3O5E A;  4Q7N A;  2DG9 A;  2YBT A;  2LKN A;  4IT6 A;  3PR9 A;  1B6C A;  1FFQ A;  1EIB A;  2RUD A;  3WL0 A;  1ZL1 A;  3UI5 A;  1HKI A;  3WQW A;  1OGG A;  3O5O A;  1GUV A;  4U86 A;  1SR0 A;  3PRD A;  4ODL A;  3CHE A;  1D6O A;  3RM9 A;  3RFW A;  1BL4 A;  1HJX A;  1Q1C A;  2KGJ A;  2ZQU A;  4ODK A;  3ARV A;  1C9H A;  3B9E A;  3KAB A;  4ML4 A;  1F8A B;  2ZQV A;  4W5U A;  1LL4 A;  2RUR A;  4WKF A;  1FKT A;  2DT0 A;  2O9O A;  2RSE A;  3WD3 A;  4KR0 B;  1J4H A;  2PPP A;  3WD0 A;  1D7I A;  2QF8 A;  2N87 A;  3KAH A;  5DIV A;  1L1P A;  4HBO A;  4DRN A;  1FKR A;  1NWR A;  3RME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...