5D75A

Crystal structure of human fkbd25 in complex with fk506
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDIDLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Crystal structure of the FK506 binding domain of human FKBP25 in complex with FK506.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 120
sequence length 120
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5d75A00
2RUDA 3O5LA 4JFMA 1J4HA 1F8AB 3IK8A 4DRPA 3GPKA 4N19A 2XP4A 2VCDA 1R9HA 4TX0A 4J4NA 4U86A 5BXJA 4IQCA 4W9OA 1FKDA 3IKDA 1FKKA 4IQ2A 1NMWA 3O5PA 4J4OA 1A7XA 1D7IA 2FAPA 1JNSA 5HKGA 2Y78A 5HW6A 3JXVA 2IF4A 1FKLA 2KFWA 4LAYA 1NMVA 2LGOA 2ZR4A 1ZCNA 3KZ7A 1YW5A 3KABA 2KGJA 4FAPA 4G2PA 3KAFA 5DITA 3UQAA 1FKRA 3UI4A 2F21A 4C02B 4DRMA 1P5QA 2LPVA 3O5GA 5DIUA 4DT4A 1JNTA 4QIBA 2PPPA 1FKJA 1PBKA 1FJDA 3O5DA 2MLXA 4O2TA 4TW8A 1PINA 4DROA 2JZVA 5DIVA 4TW6A 2D9FA 3UQIA 1FAPA 2RSEA 4LAWA 1FKFA 1L1PA 3KCEA 3O5MA 4TW7A 4JYSA 4QT3A 3TC5A 3WH0A 2N87A 4DRQA 1Q6IA 2DG4A 3OOBA 1J4RA 2XP6A 2XPBA 4JFIA 5B8IC 3UQBA 4BF8A 5HUAA 2ZQSA 1ROUA 1Q6HA 3FAPA 1BL4A 3O5QA 2K8IA 1N1AA 1FKSA 2Q5AA 2PPOA 2ZQTA 4IPXA 3KACA 2DG3A 2RQSA 4DIPA 2AWGA 4NNRA 1C9HA 5D75A 1B6CA 2MF9A 3LUOA 2MPHA 4ODOA 4W9QA 4DRNA 2KE0A 5HWCA 1QZ2A 2PV1A 2VN1A 4LAXA 2KR7A 2XPAA 4MGVA 4ODRA 3KAIA 3KAHA 2XP3A 4ODMA 3RFWA 1QPFA 1F40A 2XP8A 4R0XA 1ROTA 3IKGA 3JYMA 4DRKA 1D6OA 3O5EA 1FKBA 4ITZA 5GPGA 4DZ3A 1M5YA 2PV2A 3B7XA 2ZQVA 4DRJA 1EQ3A 3O5KA 4GGQA 4DZ2A 1W26A 2M08A 2MLZA 2XP7A 3O5JA 3PA7A 4MSPA 2XP5A 5HW7A 3EY6A 3O5IA 2ZR5A 4DRIA 4U85A 1Q1CA 2PV3A 3O5OA 3UI5A 2FKEA 3O5FA 4ODQA 2ZR6A 2M2AA 2MNTA 1BKFA 1KT0A 2OFNA 1KT1A 3CGMA 1FKTA 4TYOA 1TCOC 4LAVA 4ODPA 1U79A 2PBCA 3I6CA 3MDYB 3UI6A 2LKNA 1YATA 2ZQUA 3NRKA 3TDBA 4DH0A 1HXVA 2UZ5A 1J4IA 3UF8A 4W9PA 2L2SA 4U84A 1ZK6A 3CGNA 3JYJA 4ODLA 1J6YA 4JFKA 4TNSA 3VAWA 1JVWA 2DG9A 2ITKA 2RURA 3ODKA 4JFJA 5I98A 4GIVA 1D7HA 5J6EA 2F4EA 1QPLA 1FD9A 2RUCA 2PPNA 3O5RA 1FKIA 5HWBA 4DRHA 2KO7A 2XP9A 2KI3A 5HT1A 1T11A 2LJ4A 4JFLA 1FKGA 1Q6UA 1D7JA 3IHZA 4ODKA 4QT2A 2RUQA 3H9RB 3NI6A 3NTPA 2F2DA 2M1IA 1FKHA 4G50A 5HW8A 1EYMA 3PRDA 3TCZA 3KAGA 3KADA 3PRBA 4ODNA 1Y0OA 2MLYA 3RGCA 5HTGA 1NSGA 4FN2A
chains in the Genus database with same CATH superfamily
2RUDA 1EDQA 4WK9A 1CTNA 3IK8A 1GRJA 2VCDA 4TX0A 4J4NA 5BXJA 3WD2A 4S3JA 3ARVA 3O5PA 2FAPA 1W9UA 2G41A 4LAYA 4Z2KA 2LGOA 1YW5A 3RM4A 4G2PA 1HJVA 4C02B 4DRMA 2LPVA 4QIBA 3CHDA 1LQ0A 2WM0A 2DT3A 4TW6A 4DWSC 1FKFA 1L1PA 1E6NA 3B9EA 3WH0A 4DRQA 1Q6IA 4JFIA 3UQBA 4BF8A 4P8UA 1W1VA 3CHCA 1C9HA 4ODOA 2KE0A 2PV1A 2DPEA 2XPAA 3RFWA 1RD6A 1K9TA 4ITZA 4IT6A 2PV2A 4MAVA 2ZQVA 3WL1A 4DZ2A 1XHGA 3PA7A 4P8WA 2XP5A 3ARQA 1Q1CA 3ARUA 2WK2A 3ALFA 4MNLA 1BKFA 1JNEA 1KT1A 2WLYA 4URIA 1HKJA 2DSVA 3UI6A 2LKNA 4DH0A 4WIWA 1ZBVA 1OGGA 1J4IA 4L72B 4Q22A 3UF8A 5DF0A 3ARPA 4TNSA 3VAWA 3WQWA 1JVWA 2DG9A 4MTVA 1D7HA 5J6EA 2YBTA 2P4VA 1QPLA 1FD9A 2PPNA 1O6IA 2XP9A 3CH9A 4JFLA 4ML4A 3H9RB 2M1IA 1FKHA 4DWSB 1D2KA 1H0GA 3WL0A 2MLYA 1OGBA 3PR9A 1SR0A 1TFVA 1JNDA 1LG1A 4JFMA 4S3KA 1J4HA 1NWTA 4DRPA 3BXWA 1R9HA 4W9OA 5DEZA 1FKKA 1UR8A 4J4OA 1E6ZA 1W9VA 5HKGA 2Y78A 5HW6A 2WLZA 1HJXA 2KFWA 2O92A 2EULA 3KZ7A 3WD1A 1LJYA 3KABA 4FAPA 5DITA 3CHFA 4HBOA 5DIUA 1HKKA 1VF8A 2B5UB 2DT2A 2MLXA 1PINA 1NH6A 2D9FA 3UQIA 1FAPA 3ARWA 3O5MA 4TW7A 2QF8A 2N87A 2XPBA 2AOSA 1BL4A 4L3NA 3G6MA 1LL6A 4IPXA 3AS2A 4DIPA 3FXYA 1LL4A 4W9QA 1ZBCA 4ZS6A 3ALGA 1HJWA 2KR7A 3KAIA 2XP3A 4R0XA 3IKGA 1H0IA 2B31A 3BMBA 5JH8A 4Z2HA 1W26A 2M08A 3EY6A 3O5IA 2ZR5A 2PN0A 2ZR6A 1KT0A 3CGMA 1FKTA 4TYOA 1W9PA 1NWUA 3PRAA 3MDYB 1HXVA 1EIBA 3CGNA 3ARZA 1KFWA 3AS0A 2RURA 4LGXA 2F4EA 3O5RA 4DRHA 2KI3A 1T11A 2FDMA 4ODKA 3IHZA 5HW8A 3NTPA 3EIPA 1JCHB 3ARYA 4MNKA 1UR9A 2G8ZA 4ODNA 4MNJA 3RGCA 3O5LA 2A3AA 3GPKA 4N19A 2XP4A 1GPFA 1WNOA 4IQCA 1FKDA 3IKDA 1NWRA 4IQ2A 1A7XA 3ARXA 2ETNA 1XRVA 3JXVA 4ZPWR 4Z2IA 2ZR4A 1W1PA 2KGJA 1OWQA 4Z2LA 1FKRA 4W5UA 3O5GA 4DT4A 1JNTA 2DSWA 2PPPA 1FKJA 1PBKA 3O5DA 3WD4A 4KQZA 2JZVA 5DIVA 4LAWA 3TC5A 5DO2A 3OOBA 5B8IC 5HUAA 3FAPA 3O5QA 3ARSA 1NWSA 2K8IA 1FKSA 2Q5AA 1WB0A 2PPOA 2ZQTA 3KACA 2DG3A 4NNRA 2MF9A 3LUOA 2MPHA 3G6LA 1QZ2A 2VN1A 3B8SA 4LAXA 4ODMA 1F40A 2A3EA 3WKZA 2XP8A 1ROTA 4DRKA 2IUZA 4DZ3A 1ZU8A 2DT1A 2A3CA 1EQ3A 3O5KA 4P8XA 3O5JA 4MNMA 5HW7A 1WAWA 4U85A 1ZBWA 2PV3A 3O5OA 3O5FA 2A3BA 1E6PA 2M2AA 2MNTA 2OFNA 3CZ8A 4QZVB 4LAVA 4WJXA 1HKMA 3FY1A 4ODPA 1U79A 2PBCA 3I6CA 1YATA 4Z2JA 4WKHA 4W9PA 4ODLA 1J6YA 4JFKA 1IX5A 3ODKA 4GIVA 2OLHA 3AQUA 1FKIA 1ZL1A 1ZBKA 2KO7A 2LJ4A 1Q6UA 1D7JA 4QT2A 2RUQA 3GU0A 4NZCA 1EYMA 3PRDA 1GOIA 3KADA 1Y0OA 4HBEA 4MPKA 4IT4A 4PTMA 4DWSD 5HTGA 3ARRA 1NSGA 4WKAA 4FN2A 4Q7NA 1F8AB 4ZPTR 4ZPVR 5GQBA 4P8VA 4DWSA 4U86A 1NMWA 1D7IA 1JNSA 1ZB5A 1E44A 2IF4A 1FKLA 3AROA 1NMVA 1LL7A 1W1TA 1ZCNA 3WQVA 3KAFA 3W4RA 3UQAA 3UI4A 3B9DA 2F21A 1P5QA 1FJDA 3RM9A 4O2TA 4TW8A 4DROA 3AS3A 4XAKA 2RSEA 1HKIA 2DSUA 3KCEA 4KR0B 4JYSA 4QT3A 2DG4A 1J4RA 2XP6A 1W1YA 4WKFA 5GPRA 3ARTA 2ZQSA 1ROUA 1Q6HA 1X6LA 4NSBA 1FFRA 1N1AA 2RQSA 4AY1A 2AWGA 1LG2A 1EHNA 5D75A 1E6RA 1B6CA 1X6NA 4DRNA 5HWCA 4ODRA 4MGVA 3CHEA 3KAHA 5HBFA 1QPFA 3JYMA 3OA5A 1D6OA 3O5EA 1FKBA 5GPGA 1M5YA 4UDMA 2YBUA 3B7XA 2PI6A 4DRJA 4GGQA 2MLZA 2XP7A 4MSPA 2F23A 4DRIA 2O9OA 3UI5A 2FKEA 3QOKA 4ODQA 3WIJA 2DSZA 1TCOC 1SYTA 3NRKA 2ZQUA 3TDBA 3WD0A 2UZ5A 2L2SA 4U84A 1ZK6A 3JYJA 3RMEA 1ITXA 1GUVA 2ITKA 5I98A 4JFJA 1E9LA 4R5EA 3WD3A 2RUCA 5HWBA 2DT0A 1E15A 3AS1A 5HT1A 1FKGA 3B9AA 4G50A 3NI6A 2F2DA 4HARA 3RM8A 2ESCA 3TCZA 3KAGA 3PRBA 4Z2GA 1FFQA 3GTYX
chains in the Genus database with same CATH topology
2RUDA 1EDQA 4WK9A 1CTNA 3IK8A 2VCDA 4TX0A 4J4NA 5BXJA 3WD2A 4S3JA 3ARVA 3O5PA 2FAPA 1W9UA 2G41A 4LAYA 4Z2KA 2LGOA 1YW5A 3RM4A 4G2PA 1HJVA 4C02B 4DRMA 2LPVA 4QIBA 3CHDA 1LQ0A 2WM0A 2DT3A 4TW6A 4DWSC 1FKFA 1L1PA 1E6NA 3B9EA 3WH0A 4DRQA 1Q6IA 4JFIA 3UQBA 4BF8A 4P8UA 1W1VA 3CHCA 1C9HA 4ODOA 2KE0A 2PV1A 2DPEA 2XPAA 3RFWA 1RD6A 1K9TA 4ITZA 4IT6A 2PV2A 4MAVA 2ZQVA 3WL1A 4DZ2A 1XHGA 3PA7A 4P8WA 2XP5A 3ARQA 1Q1CA 3ARUA 2WK2A 3ALFA 4MNLA 1BKFA 1JNEA 1KT1A 2WLYA 4URIA 1HKJA 2DSVA 3UI6A 2LKNA 4DH0A 4WIWA 1ZBVA 1OGGA 1J4IA 4L72B 4Q22A 3UF8A 5DF0A 3ARPA 4TNSA 3VAWA 3WQWA 1JVWA 2DG9A 4MTVA 1D7HA 5J6EA 2YBTA 1QPLA 1FD9A 2PPNA 1O6IA 2XP9A 3CH9A 4JFLA 4ML4A 3H9RB 2M1IA 1FKHA 4DWSB 1D2KA 1H0GA 3WL0A 2MLYA 1OGBA 3PR9A 1SR0A 1TFVA 1JNDA 1LG1A 4JFMA 4S3KA 1J4HA 1NWTA 4DRPA 3BXWA 1R9HA 4W9OA 5DEZA 1FKKA 1UR8A 4J4OA 1E6ZA 1W9VA 5HKGA 2Y78A 5HW6A 2WLZA 1HJXA 2KFWA 2O92A 3KZ7A 3WD1A 1LJYA 3KABA 4FAPA 5DITA 3CHFA 4HBOA 5DIUA 1HKKA 1VF8A 2DT2A 2MLXA 1PINA 1NH6A 2D9FA 3UQIA 1FAPA 3ARWA 3O5MA 4TW7A 2QF8A 2N87A 2XPBA 2AOSA 1BL4A 4L3NA 3G6MA 1LL6A 4IPXA 3AS2A 4DIPA 3FXYA 1LL4A 4W9QA 1ZBCA 4ZS6A 3ALGA 1HJWA 2KR7A 3KAIA 2XP3A 4R0XA 3IKGA 1H0IA 2B31A 5JH8A 4Z2HA 1W26A 2M08A 3EY6A 3O5IA 2ZR5A 2ZR6A 1KT0A 3CGMA 1FKTA 4TYOA 1W9PA 1NWUA 3PRAA 3MDYB 1HXVA 1EIBA 3CGNA 3ARZA 1KFWA 3AS0A 2RURA 4LGXA 2F4EA 3O5RA 4DRHA 2KI3A 1T11A 2FDMA 4ODKA 3IHZA 5HW8A 3NTPA 4MNKA 3ARYA 1UR9A 2G8ZA 4ODNA 4MNJA 3RGCA 3O5LA 2A3AA 3GPKA 4N19A 2XP4A 1GPFA 1WNOA 4IQCA 1FKDA 3IKDA 1NWRA 4IQ2A 1A7XA 3ARXA 1XRVA 3JXVA 4ZPWR 4Z2IA 2ZR4A 1W1PA 2KGJA 1OWQA 4Z2LA 1FKRA 4W5UA 3O5GA 4DT4A 1JNTA 2DSWA 2PPPA 1FKJA 1PBKA 3O5DA 3WD4A 4KQZA 2JZVA 5DIVA 4LAWA 3TC5A 5DO2A 3OOBA 5B8IC 5HUAA 3FAPA 3O5QA 3ARSA 1NWSA 2K8IA 1FKSA 2Q5AA 1WB0A 2PPOA 2ZQTA 3KACA 2DG3A 4NNRA 2MF9A 3LUOA 2MPHA 3G6LA 1QZ2A 2VN1A 3B8SA 4LAXA 4ODMA 1F40A 2A3EA 3WKZA 2XP8A 1ROTA 4DRKA 2IUZA 4DZ3A 1ZU8A 2DT1A 2A3CA 1EQ3A 3O5KA 4P8XA 3O5JA 4MNMA 5HW7A 1WAWA 4U85A 1ZBWA 2PV3A 3O5OA 3O5FA 2A3BA 1E6PA 2M2AA 2MNTA 2OFNA 3CZ8A 4QZVB 4LAVA 4WJXA 1HKMA 3FY1A 4ODPA 1U79A 2PBCA 3I6CA 1YATA 4Z2JA 4WKHA 4W9PA 4ODLA 1J6YA 4JFKA 1IX5A 3ODKA 4GIVA 2OLHA 3AQUA 1FKIA 1ZL1A 1ZBKA 2KO7A 2LJ4A 1Q6UA 1D7JA 4QT2A 2RUQA 4NZCA 1EYMA 3PRDA 1GOIA 3KADA 1Y0OA 4HBEA 4MPKA 4IT4A 4PTMA 4DWSD 5HTGA 3ARRA 1NSGA 4WKAA 4FN2A 4Q7NA 1F8AB 4ZPTR 4ZPVR 5GQBA 4P8VA 4DWSA 4U86A 1NMWA 1D7IA 1JNSA 1ZB5A 2IF4A 1FKLA 3AROA 1NMVA 1LL7A 1W1TA 1ZCNA 3WQVA 3KAFA 3W4RA 3UQAA 3UI4A 3B9DA 2F21A 1P5QA 1FJDA 3RM9A 4O2TA 4TW8A 4DROA 3AS3A 4XAKA 2RSEA 1HKIA 2DSUA 3KCEA 4KR0B 4JYSA 4QT3A 2DG4A 1J4RA 2XP6A 1W1YA 4WKFA 5GPRA 3ARTA 2ZQSA 1ROUA 1Q6HA 1X6LA 4NSBA 1FFRA 1N1AA 2RQSA 4AY1A 2AWGA 1LG2A 1EHNA 5D75A 1E6RA 1B6CA 1X6NA 4DRNA 5HWCA 4ODRA 4MGVA 3CHEA 3KAHA 5HBFA 1QPFA 3JYMA 3OA5A 1D6OA 3O5EA 1FKBA 5GPGA 1M5YA 2YBUA 3B7XA 2PI6A 4DRJA 4GGQA 2MLZA 2XP7A 4MSPA 4DRIA 2O9OA 3UI5A 2FKEA 3QOKA 4ODQA 3WIJA 2DSZA 1TCOC 1SYTA 3NRKA 2ZQUA 3TDBA 3WD0A 2UZ5A 2L2SA 4U84A 1ZK6A 3JYJA 3RMEA 1ITXA 1GUVA 2ITKA 5I98A 4JFJA 1E9LA 4R5EA 3WD3A 2RUCA 5HWBA 2DT0A 1E15A 3AS1A 5HT1A 1FKGA 3B9AA 4G50A 3NI6A 2F2DA 4HARA 3RM8A 2ESCA 3TCZA 3KAGA 3PRBA 4Z2GA 1FFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUD A;  3O5L A;  4JFM A;  1J4H A;  1F8A B;  3IK8 A;  4DRP A;  3GPK A;  4N19 A;  2XP4 A;  2VCD A;  1R9H A;  4TX0 A;  4J4N A;  4U86 A;  5BXJ A;  4IQC A;  4W9O A;  1FKD A;  3IKD A;  1FKK A;  4IQ2 A;  1NMW A;  3O5P A;  4J4O A;  1A7X A;  1D7I A;  2FAP A;  1JNS A;  5HKG A;  2Y78 A;  5HW6 A;  3JXV A;  2IF4 A;  1FKL A;  2KFW A;  4LAY A;  1NMV A;  2LGO A;  2ZR4 A;  1ZCN A;  3KZ7 A;  1YW5 A;  3KAB A;  2KGJ A;  4FAP A;  4G2P A;  3KAF A;  5DIT A;  3UQA A;  1FKR A;  3UI4 A;  2F21 A;  4C02 B;  4DRM A;  1P5Q A;  2LPV A;  3O5G A;  5DIU A;  4DT4 A;  1JNT A;  4QIB A;  2PPP A;  1FKJ A;  1PBK A;  1FJD A;  3O5D A;  2MLX A;  4O2T A;  4TW8 A;  1PIN A;  4DRO A;  2JZV A;  5DIV A;  4TW6 A;  2D9F A;  3UQI A;  1FAP A;  2RSE A;  4LAW A;  1FKF A;  1L1P A;  3KCE A;  3O5M A;  4TW7 A;  4JYS A;  4QT3 A;  3TC5 A;  3WH0 A;  2N87 A;  4DRQ A;  1Q6I A;  2DG4 A;  3OOB A;  1J4R A;  2XP6 A;  2XPB A;  4JFI A;  5B8I C;  3UQB A;  4BF8 A;  5HUA A;  2ZQS A;  1ROU A;  1Q6H A;  3FAP A;  1BL4 A;  3O5Q A;  2K8I A;  1N1A A;  1FKS A;  2Q5A A;  2PPO A;  2ZQT A;  4IPX A;  3KAC A;  2DG3 A;  2RQS A;  4DIP A;  2AWG A;  4NNR A;  1C9H A;  5D75 A;  1B6C A;  2MF9 A;  3LUO A;  2MPH A;  4ODO A;  4W9Q A;  4DRN A;  2KE0 A;  5HWC A;  1QZ2 A;  2PV1 A;  2VN1 A;  4LAX A;  2KR7 A;  2XPA A;  4MGV A;  4ODR A;  3KAI A;  3KAH A;  2XP3 A;  4ODM A;  3RFW A;  1QPF A;  1F40 A;  2XP8 A;  4R0X A;  1ROT A;  3IKG A;  3JYM A;  4DRK A;  1D6O A;  3O5E A;  1FKB A;  4ITZ A;  5GPG A;  4DZ3 A;  1M5Y A;  2PV2 A;  3B7X A;  2ZQV A;  4DRJ A;  1EQ3 A;  3O5K A;  4GGQ A;  4DZ2 A;  1W26 A;  2M08 A;  2MLZ A;  2XP7 A;  3O5J A;  3PA7 A;  4MSP A;  2XP5 A;  5HW7 A;  3EY6 A;  3O5I A;  2ZR5 A;  4DRI A;  4U85 A;  1Q1C A;  2PV3 A;  3O5O A;  3UI5 A;  2FKE A;  3O5F A;  4ODQ A;  2ZR6 A;  2M2A A;  2MNT A;  1BKF A;  1KT0 A;  2OFN A;  1KT1 A;  3CGM A;  1FKT A;  4TYO A;  1TCO C;  4LAV A;  4ODP A;  1U79 A;  2PBC A;  3I6C A;  3MDY B;  3UI6 A;  2LKN A;  1YAT A;  2ZQU A;  3NRK A;  3TDB A;  4DH0 A;  1HXV A;  2UZ5 A;  1J4I A;  3UF8 A;  4W9P A;  2L2S A;  4U84 A;  1ZK6 A;  3CGN A;  3JYJ A;  4ODL A;  1J6Y A;  4JFK A;  4TNS A;  3VAW A;  1JVW A;  2DG9 A;  2ITK A;  2RUR A;  3ODK A;  4JFJ A;  5I98 A;  4GIV A;  1D7H A;  5J6E A;  2F4E A;  1QPL A;  1FD9 A;  2RUC A;  2PPN A;  3O5R A;  1FKI A;  5HWB A;  4DRH A;  2KO7 A;  2XP9 A;  2KI3 A;  5HT1 A;  1T11 A;  2LJ4 A;  4JFL A;  1FKG A;  1Q6U A;  1D7J A;  3IHZ A;  4ODK A;  4QT2 A;  2RUQ A;  3H9R B;  3NI6 A;  3NTP A;  2F2D A;  2M1I A;  1FKH A;  4G50 A;  5HW8 A;  1EYM A;  3PRD A;  3TCZ A;  3KAG A;  3KAD A;  3PRB A;  4ODN A;  1Y0O A;  2MLY A;  3RGC A;  5HTG A;  1NSG A;  4FN2 A; 
#chains in the Genus database with same CATH topology
 2RUD A;  1EDQ A;  4WK9 A;  1CTN A;  3IK8 A;  1GRJ A;  2VCD A;  4TX0 A;  4J4N A;  5BXJ A;  3WD2 A;  4S3J A;  3ARV A;  3O5P A;  2FAP A;  1W9U A;  2G41 A;  4LAY A;  4Z2K A;  2LGO A;  1YW5 A;  3RM4 A;  4G2P A;  1HJV A;  4C02 B;  4DRM A;  2LPV A;  4QIB A;  3CHD A;  1LQ0 A;  2WM0 A;  2DT3 A;  4TW6 A;  4DWS C;  1FKF A;  1L1P A;  1E6N A;  3B9E A;  3WH0 A;  4DRQ A;  1Q6I A;  4JFI A;  3UQB A;  4BF8 A;  4P8U A;  1W1V A;  3CHC A;  1C9H A;  4ODO A;  2KE0 A;  2PV1 A;  2DPE A;  2XPA A;  3RFW A;  1RD6 A;  1K9T A;  4ITZ A;  4IT6 A;  2PV2 A;  4MAV A;  2ZQV A;  3WL1 A;  4DZ2 A;  1XHG A;  3PA7 A;  4P8W A;  2XP5 A;  3ARQ A;  1Q1C A;  3ARU A;  2WK2 A;  3ALF A;  4MNL A;  1BKF A;  1JNE A;  1KT1 A;  2WLY A;  4URI A;  1HKJ A;  2DSV A;  3UI6 A;  2LKN A;  4DH0 A;  4WIW A;  1ZBV A;  1OGG A;  1J4I A;  4L72 B;  4Q22 A;  3UF8 A;  5DF0 A;  3ARP A;  4TNS A;  3VAW A;  3WQW A;  1JVW A;  2DG9 A;  4MTV A;  1D7H A;  5J6E A;  2YBT A;  2P4V A;  1QPL A;  1FD9 A;  2PPN A;  1O6I A;  2XP9 A;  3CH9 A;  4JFL A;  4ML4 A;  3H9R B;  2M1I A;  1FKH A;  4DWS B;  1D2K A;  1H0G A;  3WL0 A;  2MLY A;  1OGB A;  3PR9 A;  1SR0 A;  1TFV A;  1JND A;  1LG1 A;  4JFM A;  4S3K A;  1J4H A;  1NWT A;  4DRP A;  3BXW A;  1R9H A;  4W9O A;  5DEZ A;  1FKK A;  1UR8 A;  4J4O A;  1E6Z A;  1W9V A;  5HKG A;  2Y78 A;  5HW6 A;  2WLZ A;  1HJX A;  2KFW A;  2O92 A;  2EUL A;  3KZ7 A;  3WD1 A;  1LJY A;  3KAB A;  4FAP A;  5DIT A;  3CHF A;  4HBO A;  5DIU A;  1HKK A;  1VF8 A;  2B5U B;  2DT2 A;  2MLX A;  1PIN A;  1NH6 A;  2D9F A;  3UQI A;  1FAP A;  3ARW A;  3O5M A;  4TW7 A;  2QF8 A;  2N87 A;  2XPB A;  2AOS A;  1BL4 A;  4L3N A;  3G6M A;  1LL6 A;  4IPX A;  3AS2 A;  4DIP A;  3FXY A;  1LL4 A;  4W9Q A;  1ZBC A;  4ZS6 A;  3ALG A;  1HJW A;  2KR7 A;  3KAI A;  2XP3 A;  4R0X A;  3IKG A;  1H0I A;  2B31 A;  3BMB A;  5JH8 A;  4Z2H A;  1W26 A;  2M08 A;  3EY6 A;  3O5I A;  2ZR5 A;  2PN0 A;  2ZR6 A;  1KT0 A;  3CGM A;  1FKT A;  4TYO A;  1W9P A;  1NWU A;  3PRA A;  3MDY B;  1HXV A;  1EIB A;  3CGN A;  3ARZ A;  1KFW A;  3AS0 A;  2RUR A;  4LGX A;  2F4E A;  3O5R A;  4DRH A;  2KI3 A;  1T11 A;  2FDM A;  4ODK A;  3IHZ A;  5HW8 A;  3NTP A;  3EIP A;  1JCH B;  3ARY A;  4MNK A;  1UR9 A;  2G8Z A;  4ODN A;  4MNJ A;  3RGC A;  3O5L A;  2A3A A;  3GPK A;  4N19 A;  2XP4 A;  1GPF A;  1WNO A;  4IQC A;  1FKD A;  3IKD A;  1NWR A;  4IQ2 A;  1A7X A;  3ARX A;  2ETN A;  1XRV A;  3JXV A;  4ZPW R;  4Z2I A;  2ZR4 A;  1W1P A;  2KGJ A;  1OWQ A;  4Z2L A;  1FKR A;  4W5U A;  3O5G A;  4DT4 A;  1JNT A;  2DSW A;  2PPP A;  1FKJ A;  1PBK A;  3O5D A;  3WD4 A;  4KQZ A;  2JZV A;  5DIV A;  4LAW A;  3TC5 A;  5DO2 A;  3OOB A;  5B8I C;  5HUA A;  3FAP A;  3O5Q A;  3ARS A;  1NWS A;  2K8I A;  1FKS A;  2Q5A A;  1WB0 A;  2PPO A;  2ZQT A;  3KAC A;  2DG3 A;  4NNR A;  2MF9 A;  3LUO A;  2MPH A;  3G6L A;  1QZ2 A;  2VN1 A;  3B8S A;  4LAX A;  4ODM A;  1F40 A;  2A3E A;  3WKZ A;  2XP8 A;  1ROT A;  4DRK A;  2IUZ A;  4DZ3 A;  1ZU8 A;  2DT1 A;  2A3C A;  1EQ3 A;  3O5K A;  4P8X A;  3O5J A;  4MNM A;  5HW7 A;  1WAW A;  4U85 A;  1ZBW A;  2PV3 A;  3O5O A;  3O5F A;  2A3B A;  1E6P A;  2M2A A;  2MNT A;  2OFN A;  3CZ8 A;  4QZV B;  4LAV A;  4WJX A;  1HKM A;  3FY1 A;  4ODP A;  1U79 A;  2PBC A;  3I6C A;  1YAT A;  4Z2J A;  4WKH A;  4W9P A;  4ODL A;  1J6Y A;  4JFK A;  1IX5 A;  3ODK A;  4GIV A;  2OLH A;  3AQU A;  1FKI A;  1ZL1 A;  1ZBK A;  2KO7 A;  2LJ4 A;  1Q6U A;  1D7J A;  4QT2 A;  2RUQ A;  3GU0 A;  4NZC A;  1EYM A;  3PRD A;  1GOI A;  3KAD A;  1Y0O A;  4HBE A;  4MPK A;  4IT4 A;  4PTM A;  4DWS D;  5HTG A;  3ARR A;  1NSG A;  4WKA A;  4FN2 A;  4Q7N A;  1F8A B;  4ZPT R;  4ZPV R;  5GQB A;  4P8V A;  4DWS A;  4U86 A;  1NMW A;  1D7I A;  1JNS A;  1ZB5 A;  1E44 A;  2IF4 A;  1FKL A;  3ARO A;  1NMV A;  1LL7 A;  1W1T A;  1ZCN A;  3WQV A;  3KAF A;  3W4R A;  3UQA A;  3UI4 A;  3B9D A;  2F21 A;  1P5Q A;  1FJD A;  3RM9 A;  4O2T A;  4TW8 A;  4DRO A;  3AS3 A;  4XAK A;  2RSE A;  1HKI A;  2DSU A;  3KCE A;  4KR0 B;  4JYS A;  4QT3 A;  2DG4 A;  1J4R A;  2XP6 A;  1W1Y A;  4WKF A;  5GPR A;  3ART A;  2ZQS A;  1ROU A;  1Q6H A;  1X6L A;  4NSB A;  1FFR A;  1N1A A;  2RQS A;  4AY1 A;  2AWG A;  1LG2 A;  1EHN A;  5D75 A;  1E6R A;  1B6C A;  1X6N A;  4DRN A;  5HWC A;  4ODR A;  4MGV A;  3CHE A;  3KAH A;  5HBF A;  1QPF A;  3JYM A;  3OA5 A;  1D6O A;  3O5E A;  1FKB A;  5GPG A;  1M5Y A;  4UDM A;  2YBU A;  3B7X A;  2PI6 A;  4DRJ A;  4GGQ A;  2MLZ A;  2XP7 A;  4MSP A;  2F23 A;  4DRI A;  2O9O A;  3UI5 A;  2FKE A;  3QOK A;  4ODQ A;  3WIJ A;  2DSZ A;  1TCO C;  1SYT A;  3NRK A;  2ZQU A;  3TDB A;  3WD0 A;  2UZ5 A;  2L2S A;  4U84 A;  1ZK6 A;  3JYJ A;  3RME A;  1ITX A;  1GUV A;  2ITK A;  5I98 A;  4JFJ A;  1E9L A;  4R5E A;  3WD3 A;  2RUC A;  5HWB A;  2DT0 A;  1E15 A;  3AS1 A;  5HT1 A;  1FKG A;  3B9A A;  4G50 A;  3NI6 A;  2F2D A;  4HAR A;  3RM8 A;  2ESC A;  3TCZ A;  3KAG A;  3PRB A;  4Z2G A;  1FFQ A;  3GTY X; 
#chains in the Genus database with same CATH homology
 2RUD A;  1EDQ A;  4WK9 A;  1CTN A;  3IK8 A;  2VCD A;  4TX0 A;  4J4N A;  5BXJ A;  3WD2 A;  4S3J A;  3ARV A;  3O5P A;  2FAP A;  1W9U A;  2G41 A;  4LAY A;  4Z2K A;  2LGO A;  1YW5 A;  3RM4 A;  4G2P A;  1HJV A;  4C02 B;  4DRM A;  2LPV A;  4QIB A;  3CHD A;  1LQ0 A;  2WM0 A;  2DT3 A;  4TW6 A;  4DWS C;  1FKF A;  1L1P A;  1E6N A;  3B9E A;  3WH0 A;  4DRQ A;  1Q6I A;  4JFI A;  3UQB A;  4BF8 A;  4P8U A;  1W1V A;  3CHC A;  1C9H A;  4ODO A;  2KE0 A;  2PV1 A;  2DPE A;  2XPA A;  3RFW A;  1RD6 A;  1K9T A;  4ITZ A;  4IT6 A;  2PV2 A;  4MAV A;  2ZQV A;  3WL1 A;  4DZ2 A;  1XHG A;  3PA7 A;  4P8W A;  2XP5 A;  3ARQ A;  1Q1C A;  3ARU A;  2WK2 A;  3ALF A;  4MNL A;  1BKF A;  1JNE A;  1KT1 A;  2WLY A;  4URI A;  1HKJ A;  2DSV A;  3UI6 A;  2LKN A;  4DH0 A;  4WIW A;  1ZBV A;  1OGG A;  1J4I A;  4L72 B;  4Q22 A;  3UF8 A;  5DF0 A;  3ARP A;  4TNS A;  3VAW A;  3WQW A;  1JVW A;  2DG9 A;  4MTV A;  1D7H A;  5J6E A;  2YBT A;  1QPL A;  1FD9 A;  2PPN A;  1O6I A;  2XP9 A;  3CH9 A;  4JFL A;  4ML4 A;  3H9R B;  2M1I A;  1FKH A;  4DWS B;  1D2K A;  1H0G A;  3WL0 A;  2MLY A;  1OGB A;  3PR9 A;  1SR0 A;  1TFV A;  1JND A;  1LG1 A;  4JFM A;  4S3K A;  1J4H A;  1NWT A;  4DRP A;  3BXW A;  1R9H A;  4W9O A;  5DEZ A;  1FKK A;  1UR8 A;  4J4O A;  1E6Z A;  1W9V A;  5HKG A;  2Y78 A;  5HW6 A;  2WLZ A;  1HJX A;  2KFW A;  2O92 A;  3KZ7 A;  3WD1 A;  1LJY A;  3KAB A;  4FAP A;  5DIT A;  3CHF A;  4HBO A;  5DIU A;  1HKK A;  1VF8 A;  2DT2 A;  2MLX A;  1PIN A;  1NH6 A;  2D9F A;  3UQI A;  1FAP A;  3ARW A;  3O5M A;  4TW7 A;  2QF8 A;  2N87 A;  2XPB A;  2AOS A;  1BL4 A;  4L3N A;  3G6M A;  1LL6 A;  4IPX A;  3AS2 A;  4DIP A;  3FXY A;  1LL4 A;  4W9Q A;  1ZBC A;  4ZS6 A;  3ALG A;  1HJW A;  2KR7 A;  3KAI A;  2XP3 A;  4R0X A;  3IKG A;  1H0I A;  2B31 A;  5JH8 A;  4Z2H A;  1W26 A;  2M08 A;  3EY6 A;  3O5I A;  2ZR5 A;  2ZR6 A;  1KT0 A;  3CGM A;  1FKT A;  4TYO A;  1W9P A;  1NWU A;  3PRA A;  3MDY B;  1HXV A;  1EIB A;  3CGN A;  3ARZ A;  1KFW A;  3AS0 A;  2RUR A;  4LGX A;  2F4E A;  3O5R A;  4DRH A;  2KI3 A;  1T11 A;  2FDM A;  4ODK A;  3IHZ A;  5HW8 A;  3NTP A;  4MNK A;  3ARY A;  1UR9 A;  2G8Z A;  4ODN A;  4MNJ A;  3RGC A;  3O5L A;  2A3A A;  3GPK A;  4N19 A;  2XP4 A;  1GPF A;  1WNO A;  4IQC A;  1FKD A;  3IKD A;  1NWR A;  4IQ2 A;  1A7X A;  3ARX A;  1XRV A;  3JXV A;  4ZPW R;  4Z2I A;  2ZR4 A;  1W1P A;  2KGJ A;  1OWQ A;  4Z2L A;  1FKR A;  4W5U A;  3O5G A;  4DT4 A;  1JNT A;  2DSW A;  2PPP A;  1FKJ A;  1PBK A;  3O5D A;  3WD4 A;  4KQZ A;  2JZV A;  5DIV A;  4LAW A;  3TC5 A;  5DO2 A;  3OOB A;  5B8I C;  5HUA A;  3FAP A;  3O5Q A;  3ARS A;  1NWS A;  2K8I A;  1FKS A;  2Q5A A;  1WB0 A;  2PPO A;  2ZQT A;  3KAC A;  2DG3 A;  4NNR A;  2MF9 A;  3LUO A;  2MPH A;  3G6L A;  1QZ2 A;  2VN1 A;  3B8S A;  4LAX A;  4ODM A;  1F40 A;  2A3E A;  3WKZ A;  2XP8 A;  1ROT A;  4DRK A;  2IUZ A;  4DZ3 A;  1ZU8 A;  2DT1 A;  2A3C A;  1EQ3 A;  3O5K A;  4P8X A;  3O5J A;  4MNM A;  5HW7 A;  1WAW A;  4U85 A;  1ZBW A;  2PV3 A;  3O5O A;  3O5F A;  2A3B A;  1E6P A;  2M2A A;  2MNT A;  2OFN A;  3CZ8 A;  4QZV B;  4LAV A;  4WJX A;  1HKM A;  3FY1 A;  4ODP A;  1U79 A;  2PBC A;  3I6C A;  1YAT A;  4Z2J A;  4WKH A;  4W9P A;  4ODL A;  1J6Y A;  4JFK A;  1IX5 A;  3ODK A;  4GIV A;  2OLH A;  3AQU A;  1FKI A;  1ZL1 A;  1ZBK A;  2KO7 A;  2LJ4 A;  1Q6U A;  1D7J A;  4QT2 A;  2RUQ A;  4NZC A;  1EYM A;  3PRD A;  1GOI A;  3KAD A;  1Y0O A;  4HBE A;  4MPK A;  4IT4 A;  4PTM A;  4DWS D;  5HTG A;  3ARR A;  1NSG A;  4WKA A;  4FN2 A;  4Q7N A;  1F8A B;  4ZPT R;  4ZPV R;  5GQB A;  4P8V A;  4DWS A;  4U86 A;  1NMW A;  1D7I A;  1JNS A;  1ZB5 A;  2IF4 A;  1FKL A;  3ARO A;  1NMV A;  1LL7 A;  1W1T A;  1ZCN A;  3WQV A;  3KAF A;  3W4R A;  3UQA A;  3UI4 A;  3B9D A;  2F21 A;  1P5Q A;  1FJD A;  3RM9 A;  4O2T A;  4TW8 A;  4DRO A;  3AS3 A;  4XAK A;  2RSE A;  1HKI A;  2DSU A;  3KCE A;  4KR0 B;  4JYS A;  4QT3 A;  2DG4 A;  1J4R A;  2XP6 A;  1W1Y A;  4WKF A;  5GPR A;  3ART A;  2ZQS A;  1ROU A;  1Q6H A;  1X6L A;  4NSB A;  1FFR A;  1N1A A;  2RQS A;  4AY1 A;  2AWG A;  1LG2 A;  1EHN A;  5D75 A;  1E6R A;  1B6C A;  1X6N A;  4DRN A;  5HWC A;  4ODR A;  4MGV A;  3CHE A;  3KAH A;  5HBF A;  1QPF A;  3JYM A;  3OA5 A;  1D6O A;  3O5E A;  1FKB A;  5GPG A;  1M5Y A;  2YBU A;  3B7X A;  2PI6 A;  4DRJ A;  4GGQ A;  2MLZ A;  2XP7 A;  4MSP A;  4DRI A;  2O9O A;  3UI5 A;  2FKE A;  3QOK A;  4ODQ A;  3WIJ A;  2DSZ A;  1TCO C;  1SYT A;  3NRK A;  2ZQU A;  3TDB A;  3WD0 A;  2UZ5 A;  2L2S A;  4U84 A;  1ZK6 A;  3JYJ A;  3RME A;  1ITX A;  1GUV A;  2ITK A;  5I98 A;  4JFJ A;  1E9L A;  4R5E A;  3WD3 A;  2RUC A;  5HWB A;  2DT0 A;  1E15 A;  3AS1 A;  5HT1 A;  1FKG A;  3B9A A;  4G50 A;  3NI6 A;  2F2D A;  4HAR A;  3RM8 A;  2ESC A;  3TCZ A;  3KAG A;  3PRB A;  4Z2G A;  1FFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...